[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tthe0:AAS80689.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1vj5A.bssp"
#ERROR : Can't open dsspfile "3i28A.bssp"
#ERROR : Can't open dsspfile "3fobB.bssp"
#ERROR : Can't open dsspfile "3fobA.bssp"
#ERROR : Can't open dsspfile "3e3aB.bssp"
#ERROR : Can't open dsspfile "3e3aA.bssp"
#ERROR : Can't open dsspfile "2ockA.bssp"
#ERROR : Can't open dsspfile "1ek1A.bssp"
#ERROR : Can't open dsspfile "1cqzB.bssp"
#ERROR : Can't open dsspfile "1cqzA.bssp"
#ERROR : Can't open dsspfile "2ocgA.bssp"
#ERROR : Can't open dsspfile "2oclA.bssp"
#ERROR : Can't open dsspfile "1y37A.bssp"
#ERROR : Can't open dsspfile "1c4xA.bssp"
#ERROR : Can't open dsspfile "1brtA.bssp"
#ERROR : Can't open dsspfile "1broA.bssp"
#ERROR : Can't open dsspfile "1a7uA.bssp"
#ERROR : Can't open dsspfile "1j1iA.bssp"
#ERROR : Can't open dsspfile "2d0dA.bssp"
#ERROR : Can't open dsspfile "1iupA.bssp"
#ERROR : Can't open dsspfile "1iuoA.bssp"
#ERROR : Can't open dsspfile "1iunB.bssp"
#ERROR : Can't open dsspfile "1iunA.bssp"
#ERROR : Can't open dsspfile "1hkhA.bssp"
#ERROR : Can't open dsspfile "1mj5A.bssp"
#ERROR : Can't open dsspfile "1k5pA.bssp"
#ERROR : Can't open dsspfile "1iz7A.bssp"
#ERROR : Can't open dsspfile "1g42A.bssp"
#ERROR : Can't open dsspfile "1cv2A.bssp"
#ERROR : Can't open dsspfile "2qvbB.bssp"
#ERROR : Can't open dsspfile "2qvbA.bssp"
#ERROR : Can't open dsspfile "2o2iA.bssp"
#ERROR : Can't open dsspfile "2o2hA.bssp"

## Summary of PDB Search
:257
    4e-08  34%  1vj5A  [c.108.1 - c.69.1] EPOXIDE HYDROLASE 2, CYTOPLASMIC
    4e-08  34%  3i28A  [c.108.1 - c.69.1 (1s8oA)] EPOXIDE HYDROLASE 2
    4e-08  36%  3fobB  [x.x.x] BROMOPEROXIDASE
    4e-08  36%  3fobA  [x.x.x] BROMOPEROXIDASE
    2e-07  31%  3e3aB  [x.x.x] POSSIBLE PEROXIDASE BPOC
    2e-07  31%  3e3aA  [x.x.x] POSSIBLE PEROXIDASE BPOC
    7e-07  32%  2ockA  [x.x.x] VALACYCLOVIR HYDROLASE
    2e-06  31%  1ek1A  [c.108.1 - c.69.1] EPOXIDE HYDROLASE
    2e-06  31%  1cqzB  [c.108.1 - c.69.1] EPOXIDE HYDROLASE
    2e-06  31%  1cqzA  [c.108.1 - c.69.1] EPOXIDE HYDROLASE
    3e-06  31%  2ocgA  [x.x.x] VALACYCLOVIR HYDROLASE
    6e-06  30%  2oclA  [x.x.x] VALACYCLOVIR HYDROLASE
    1e-05  32%  1y37A  [x.x.x] FLUOROACETATE DEHALOGENASE
    2e-05  33%  1c4xA  [c.69.1] PROTEIN (2-HYDROXY-6-OXO-6-PHENYLHEXA-2,4-
    3e-05  31%  1brtA  [x.x.x] BROMOPEROXIDASE A2
    5e-05  31%  1broA  [c.69.1] BROMOPEROXIDASE A2
    5e-05  31%  1a7uA  [c.69.1] CHLOROPEROXIDASE T
    6e-05  31%  1j1iA  [c.69.1] META CLEAVAGE COMPOUND HYDROLASE
    8e-05  30%  2d0dA  [x.x.x] 2-HYDROXY-6-OXO-7-METHYLOCTA-2,4-DIENOATE
    2e-04  29%  1iupA  [c.69.1] META-CLEAVAGE PRODUCT HYDROLASE
    2e-04  29%  1iuoA  [c.69.1] META-CLEAVAGE PRODUCT HYDROLASE
    2e-04  29%  1iunB  [c.69.1] META-CLEAVAGE PRODUCT HYDROLASE
    2e-04  29%  1iunA  [c.69.1] META-CLEAVAGE PRODUCT HYDROLASE
    2e-04  32%  1hkhA  [c.69.1] GAMMA LACTAMASE
    7e-04  35%  1mj5A  [c.69.1] 1,3,4,6-TETRACHLORO-1,4-CYCLOHEXADIENE HYDROLASE
    7e-04  35%  1k5pA  [c.69.1] 1,3,4,6-TETRACHLORO-1,4-CYCLOHEXADIENE HYDROLASE
    7e-04  35%  1iz7A  [c.69.1] HALOALKANE DEHALOGENASE, LINB
    7e-04  35%  1g42A  [c.69.1] 1,3,4,6-TETRACHLORO-1,4-CYCLOHEXADIENE HYDROLASE
    7e-04  35%  1cv2A  [c.69.1] HALOALKANE DEHALOGENASE
    0.001  36%  2qvbB  [x.x.x] HALOALKANE DEHALOGENASE 3
    0.001  36%  2qvbA  [x.x.x] HALOALKANE DEHALOGENASE 3
    0.001  36%  2o2iA  [x.x.x] HALOALKANE DEHALOGENASE 3
    0.001  36%  2o2hA  [x.x.x] HALOALKANE DEHALOGENASE 3
:257

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxRLRYRLEGEGPPVVLLNGIFQRLESWDPVLPHLTGFTLLRYDMRGQGESEAPEGPYPPRXXXXXXXXX
1vj5A           --RLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAGYRVLAMDMKGYGESSAPPEEYCMEVLCKEMVTF
3i28A           --RLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAGYRVLAMDMKGYGESSAPPEEYCMEVLCKEMVTF
3fobB           -----YEDHGTGKPVVLIHGWPLSGRSWEYQVPALAGYRVITYDRRGFGKSSQPWEGYEYDTFTSDXXXX
3fobA           -----YEDHGTGKPVVLIHGWPLSGRSWEYQVPALAGYRVITYDRRGFGKSSQPWEGYEYDTFTSDXXXX
3e3aB           ---LAYDDNGTGDPVVFIAGRGGAGRTWHPQVPAFAGYRCITFDNRGIGATENAEG-FTTQTMVADTAAL
3e3aA           ---LAYDDNGTGDPVVFIAGRGGAGRTWHPQVPAFAGYRCITFDNRGIGATENAEG-FTTQTMVADTAAL
2ockA           --QLHYQQTGEGDAVLLLPGMLGSGETFGPQLKNLNKFTVVAWDPRGYGHSRPPDRDFPAERDAKDAVDL
1ek1A           --RLHFVEMGSGPALCLCHGFPESWFSWRYQIPALAGFRVLAIDMKGYGDSSSPPEIEEYAMELLCKEMV
1cqzB           --RLHFVEMGSGPALCLCHGFPESWFSWRYQIPALAGFRVLAIDMKGYGDSSSPPEIEEYAMELLCKEMV
1cqzA           --RLHFVEMGSGPALCLCHGFPESWFSWRYQIPALAGFRVLAIDMKGYGDSSSPPEIEEYAMELLCKEMV
2ocgA           --QLHYQQTGEGDAVLLLPGMLGSGETFGPQLKNLNKFTVVAWDPRGYGHSRPPDRDFPAERDAKDAVDL
2oclA           --QLHYQQTGEGDAVLLLPGMLGSGETFGPQLKNLNKFTVVAWDPRGYGHSRPPDRDFPAERDAKDAVDL
1y37A           ---------GSGPALLLLHGFPQNLHMWARVAPLLANYTVVCADLRGYGGSSKPVGAYSFRAMASDQREL
1c4xA           ----------QSPAVVLLXXXXXXXSNWRPIIPDLANFFVVAPDLIGFGQSEYPE-TYPGHIMSWVGMRV
1brtA           ---LYYEDHGTGQPVVLIHGFPLSGHSWERQSAALAGYRVITYDRRGFGQSSQPTTGYDYDTFAADLNTV
1broA           ---LYYEDHGTGQPVVLIHGFPLSGHSWERQSAALAGYRVITYDRRGFGQSSQPTTGYDYDTFAADLNTV
1a7uA           ---LYYEDHGAGQPVVLIHGFPLSGHSWERQSAALAGYRVITYDRRGFGQSSQPTTGYDYDTFAADLNTV
1j1iA           ----RYLEAGKGQPVILIHGGGAGAESWRNVIPILAHYRVIAMDMLGFGKTAKPDIEYQDRRIRHLHDFI
2d0dA           -----YHDVGEGQPVILIHGSVSAYANWRLTIPALSKFRVIAPDMVGFGFTDRPENNYSKDSWVDHIIGI
1iupA           -----YHDVGEGQPVILIHGSVSAYANWRLTIPALSKFRVIAPDMVGFGFTDRPENNYSKDSWVDHIIGI
1iuoA           -----YHDVGEGQPVILIHGSVSAYANWRLTIPALSKFRVIAPDMVGFGFTDRPENNYSKDSWVDHIIGI
1iunB           -----YHDVGEGQPVILIHGSVSAYANWRLTIPALSKFRVIAPDMVGFGFTDRPENNYSKDSWVDHIIGI
1iunA           -----YHDVGEGQPVILIHGSVSAYANWRLTIPALSKFRVIAPDMVGFGFTDRPENNYSKDSWVDHIIGI
1hkhA           ---LYYEDQGSGQPVVLIHGYPLDGHSWERQTRELQGYRVITYDRRGFGGSSKVNTGYDYDTFAADLHTV
1mj5A           --RMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLRLIACDLIGMGDSDKPSGP-------------
1k5pA           --RMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLRLIACDLIGMGDSDKPSGP-------------
1iz7A           --RMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLRLIACDLIGMGDSDKPSGP-------------
1g42A           --RMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLRLIACDLIGMGDSDKPSGP-------------
1cv2A           --RMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLRLIACDLIGMGDSDKPSGP-------------
2qvbB           --RMAYIDEGKGDAIVFQHGNPTSSYLWRNIMPHLEGLRLVACDLIGMGASDSPSGP-------------
2qvbA           --RMAYIDEGKGDAIVFQHGNPTSSYLWRNIMPHLEGLRLVACDLIGMGASDSPSGP-------------
2o2iA           --RMAYIDEGKGDAIVFQHGNPTSSYLWRNIMPHLEGLRLVACDLIGMGASDSPSGP-------------
2o2hA           --RMAYIDEGKGDAIVFQHGNPTSSYLWRNIMPHLEGLRLVACDLIGMGASDSPSGP-------------


                         .         .         *         .         .         .         .:140
query           XXXXKLSRPALVGLSNGGIVAMEAALLAPERFSALVLCCTTPYLDAALRAKVESWLHALKTGGTVLRLRV
1vj5A           LDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRA-VASLNTPFIPA------------------------
3i28A           LDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRA-VASLNTPFIPA------------------------
3fobB           XXXXXXXNVTLVGFSGGGEVARYISTYGTDRIEKVVFAAVPPYLDHPEGALDDATIETFKSG--VINDRL
3fobA           XXXXXXXNVTLVGFSGGGEVARYISTYGTDRIEKVVFAAVPPYLDHPEGALDDATIETFKSG--VINDRL
3e3aB           IETLDIAPARVVGVSMGAFIAQELMVVAPELVSSAVLMATRGRLDRA-----------------------
3e3aA           IETLDIAPARVVGVSMGAFIAQELMVVAPELVSSAVLMATRGRLDRA-----------------------
2ockA           MKALKFKKVSLLGWSNGGITALIAAAKYPSYIHKMVIWGANAYV--------------------------
1ek1A           TFLDKLGIPVFIGHDWAGVMVWNMALFYPERVRA-VASLNTPFM--------------------------
1cqzB           TFLDKLGIPVFIGHDWAGVMVWNMALFYPERVRA-VASLNTPFM--------------------------
1cqzA           TFLDKLGIPVFIGHDWAGVMVWNMALFYPERVRA-VASLNTPFM--------------------------
2ocgA           MKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYV--------------------------
2oclA           MKALKFKKVSLLGWADGGITALIAAAKYPSYIHKMVIWGANAYV--------------------------
1y37A           MRTLGFERFHLVGHDRGGRTGHRMALDHPDSVLSLAVLDIIP----------------------------
1c4xA           EQILGLEKSHIVGNSMGGAVTLQLVVEAPERFDKVAL---------------------------------
1brtA           LETLDLQDAVLVGFSTGGEVARYVSSYGTARIAKVALASLEPFL--------------------------
1broA           LETLDLQDAVLVGFSMGGEVARYVSSYGTARIAKVALASLEPFL--------------------------
1a7uA           LETLDLQDAVLVGFSMGGEVARYVSSYGTARIAKVALASLEPFL--------------------------
1j1iA           KAMNFDGKVSIVGNSMGGATGLGVSVLHSELVNALVL---------------------------------
2d0dA           MDALEIEKAHIVGNSFGGGLAIATALRYSERVDRMVL---------------------------------
1iupA           MDALEIEKAHIVGNAFGGGLAIATALRYSERVDRMVL---------------------------------
1iuoA           MDALEIEKAHIVGNAFGGGLAIATALRYSERVDRMVL---------------------------------
1iunB           MDALEIEKAHIVGNAFGGGLAIATALRYSERVDRMVL---------------------------------
1iunA           MDALEIEKAHIVGNAFGGGLAIATALRYSERVDRMVL---------------------------------
1hkhA           LETLDLRDVVLVGFSMGGELARYVARYGHERVAKLALASLEPFL--------------------------
1mj5A           ----------------------------------------------------------------------
1k5pA           ----------------------------------------------------------------------
1iz7A           ----------------------------------------------------------------------
1g42A           ----------------------------------------------------------------------
1cv2A           ----------------------------------------------------------------------
2qvbB           ----------------------------------------------------------------------
2qvbA           ----------------------------------------------------------------------
2o2iA           ----------------------------------------------------------------------
2o2hA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ALPWVFGRGFLEAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1vj5A           ----------------------------------------------------------------------
3i28A           ----------------------------------------------------------------------
3fobB           AFLDEFTKGFFAA---------------------------------------------------------
3fobA           AFLDEFTKGFFAA---------------------------------------------------------
3e3aB           ----------------------------------------------------------------------
3e3aA           ----------------------------------------------------------------------
2ockA           ----------------------------------------------------------------------
1ek1A           ----------------------------------------------------------------------
1cqzB           ----------------------------------------------------------------------
1cqzA           ----------------------------------------------------------------------
2ocgA           ----------------------------------------------------------------------
2oclA           ----------------------------------------------------------------------
1y37A           ----------------------------------------------------------------------
1c4xA           ----------------------------------------------------------------------
1brtA           ----------------------------------------------------------------------
1broA           ----------------------------------------------------------------------
1a7uA           ----------------------------------------------------------------------
1j1iA           ----------------------------------------------------------------------
2d0dA           ----------------------------------------------------------------------
1iupA           ----------------------------------------------------------------------
1iuoA           ----------------------------------------------------------------------
1iunB           ----------------------------------------------------------------------
1iunA           ----------------------------------------------------------------------
1hkhA           ----------------------------------------------------------------------
1mj5A           ----------------------------------------------------------------------
1k5pA           ----------------------------------------------------------------------
1iz7A           ----------------------------------------------------------------------
1g42A           ----------------------------------------------------------------------
1cv2A           ----------------------------------------------------------------------
2qvbB           ----------------------------------------------------------------------
2qvbA           ----------------------------------------------------------------------
2o2iA           ----------------------------------------------------------------------
2o2hA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1vj5A           -----------------------------------------------
3i28A           -----------------------------------------------
3fobB           -----------------------------------------------
3fobA           -----------------------------------------------
3e3aB           -----------------------------------------------
3e3aA           -----------------------------------------------
2ockA           -----------------------------------------------
1ek1A           -----------------------------------------------
1cqzB           -----------------------------------------------
1cqzA           -----------------------------------------------
2ocgA           -----------------------------------------------
2oclA           -----------------------------------------------
1y37A           -----------------------------------------------
1c4xA           -----------------------------------------------
1brtA           -----------------------------------------------
1broA           -----------------------------------------------
1a7uA           -----------------------------------------------
1j1iA           -----------------------------------------------
2d0dA           -----------------------------------------------
1iupA           -----------------------------------------------
1iuoA           -----------------------------------------------
1iunB           -----------------------------------------------
1iunA           -----------------------------------------------
1hkhA           -----------------------------------------------
1mj5A           -----------------------------------------------
1k5pA           -----------------------------------------------
1iz7A           -----------------------------------------------
1g42A           -----------------------------------------------
1cv2A           -----------------------------------------------
2qvbB           -----------------------------------------------
2qvbA           -----------------------------------------------
2o2iA           -----------------------------------------------
2o2hA           -----------------------------------------------