[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tthe0:AAS80708.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1adjA.bssp"
#ERROR : Can't open dsspfile "1h4vB.bssp"
#ERROR : Can't open dsspfile "1kmmC.bssp"
#ERROR : Can't open dsspfile "1kmmA.bssp"
#ERROR : Can't open dsspfile "2el9D.bssp"
#ERROR : Can't open dsspfile "2el9B.bssp"
#ERROR : Can't open dsspfile "1kmnA.bssp"
#ERROR : Can't open dsspfile "2el9A.bssp"
#ERROR : Can't open dsspfile "2el9C.bssp"
#ERROR : Can't open dsspfile "1httA.bssp"
#ERROR : Can't open dsspfile "1kmnB.bssp"
#ERROR : Can't open dsspfile "1qe0A.bssp"
#ERROR : Can't open dsspfile "1httB.bssp"
#ERROR : Can't open dsspfile "1kmmD.bssp"
#ERROR : Can't open dsspfile "1kmmB.bssp"
#ERROR : Can't open dsspfile "1qe0B.bssp"
#ERROR : Can't open dsspfile "1wu7B.bssp"
#ERROR : Can't open dsspfile "1wu7A.bssp"
#ERROR : Can't open dsspfile "1z7mB.bssp"
#ERROR : Can't open dsspfile "1z7mD.bssp"
#ERROR : Can't open dsspfile "1z7nD.bssp"
#ERROR : Can't open dsspfile "1z7nA.bssp"
#ERROR : Can't open dsspfile "1z7mA.bssp"
#ERROR : Can't open dsspfile "1z7mC.bssp"
#ERROR : Can't open dsspfile "1z7nC.bssp"
#ERROR : Can't open dsspfile "2zceA.bssp"
#ERROR : Can't open dsspfile "2zcdA.bssp"
#ERROR : Can't open dsspfile "2e3cA.bssp"
#ERROR : Can't open dsspfile "2q7hA.bssp"
#ERROR : Can't open dsspfile "2q7eA.bssp"
#ERROR : Can't open dsspfile "2q7gA.bssp"
#ERROR : Can't open dsspfile "1httB.bssp"
#ERROR : Can't open dsspfile "1kmmD.bssp"
#ERROR : Can't open dsspfile "1kmmB.bssp"
#ERROR : Can't open dsspfile "1qe0B.bssp"

## Summary of PDB Search
:421
      0.0 100%  1adjA  [d.104.1 - c.51.1] HISTIDYL-TRNA SYNTHETASE
      0.0 100%  1h4vB  [d.104.1 - c.51.1] HISTIDYL-TRNA SYNTHETASE
    6e-72  43%  1kmmC  [d.104.1 - c.51.1] HISTIDYL-TRNA SYNTHETASE
    6e-72  43%  1kmmA  [d.104.1 - c.51.1] HISTIDYL-TRNA SYNTHETASE
    2e-71  43%  2el9D  [x.x.x] HISTIDYL-TRNA SYNTHETASE
    1e-70  44%  2el9B  [x.x.x] HISTIDYL-TRNA SYNTHETASE
    7e-70  43%  1kmnA  [d.104.1 - c.51.1] HISTIDYL-TRNA SYNTHETASE
    5e-68  44%  2el9A  [x.x.x] HISTIDYL-TRNA SYNTHETASE
    6e-67  43%  2el9C  [x.x.x] HISTIDYL-TRNA SYNTHETASE
    3e-66  43%  1httA  [d.104.1 - c.51.1] HISTIDYL-TRNA SYNTHETASE
    4e-65  44%  1kmnB  [d.104.1 - c.51.1] HISTIDYL-TRNA SYNTHETASE
    5e-62  38%  1qe0A  [d.104.1 - c.51.1] HISTIDYL-TRNA SYNTHETASE
    1e-42  49%  1httB  [d.104.1 - c.51.1] HISTIDYL-TRNA SYNTHETASE
    1e-41  47%  1kmmD  [d.104.1 - c.51.1] HISTIDYL-TRNA SYNTHETASE
    1e-41  47%  1kmmB  [d.104.1 - c.51.1] HISTIDYL-TRNA SYNTHETASE
    2e-31  45%  1qe0B  [d.104.1 - c.51.1] HISTIDYL-TRNA SYNTHETASE
    1e-25  34%  1wu7B  [x.x.x] HISTIDYL-TRNA SYNTHETASE
    1e-25  34%  1wu7A  [x.x.x] HISTIDYL-TRNA SYNTHETASE
    7e-12  23%  1z7mB  [x.x.x] ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBUNIT
    2e-11  24%  1z7mD  [x.x.x] ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBUNIT
    6e-11  25%  1z7nD  [x.x.x] ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBUNIT
    9e-09  23%  1z7nA  [x.x.x] ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBUNIT
    2e-08  23%  1z7mA  [x.x.x] ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBUNIT
    2e-07  24%  1z7mC  [x.x.x] ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBUNIT
    3e-07  24%  1z7nC  [x.x.x] ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBUNIT
    6e-05  28%  2zceA  [x.x.x] PYRROLYSYL-TRNA SYNTHETASE
    6e-05  28%  2zcdA  [x.x.x] PYRROLYSYL-TRNA SYNTHETASE
    6e-05  28%  2e3cA  [x.x.x] PYRROLYSYL-TRNA SYNTHETASE
    8e-05  28%  2q7hA  [x.x.x] PYRROLYSYL-TRNA SYNTHETASE
    8e-05  28%  2q7eA  [x.x.x] PYRROLYSYL-TRNA SYNTHETASE
    1e-04  28%  2q7gA  [x.x.x] PYRROLYSYL-TRNA SYNTHETASE
    1e-25  38%  1httB  [d.104.1 - c.51.1] HISTIDYL-TRNA SYNTHETASE(query 231->421)
    2e-28  38%  1kmmD  [d.104.1 - c.51.1] HISTIDYL-TRNA SYNTHETASE(query 229->421)
    2e-28  38%  1kmmB  [d.104.1 - c.51.1] HISTIDYL-TRNA SYNTHETASE(query 229->421)
    6e-21  32%  1qe0B  [d.104.1 - c.51.1] HISTIDYL-TRNA SYNTHETASE(query 233->415)
:421

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xTARAVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAATDIVRKEMFTFQD
1adjA           -TARAVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAATDIVRKEMFTFQD
1h4vB           -TARAVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGA------KEMFTFQD
1kmmC           ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
1kmmA           ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
2el9D           ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
2el9B           ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
1kmnA           ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
2el9A           ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
2el9C           ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
1httA           ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
1kmnB           ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
1qe0A           ------RGTQDILPEDSKKWRYIENQLDELMTFYNYKEIRTPIFE-----------STDLFAREMYTFKD
1httB           ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
1kmmD           ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
1kmmB           ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
1qe0B           ------RGTQDILPEDSKKWRYIENQLDELMTFYNYKEIRTPIFE-----------STDLFAREMYTFKD
1wu7B           --------------------------------------------------------------QQTYSFVD
1wu7A           --------------------------------------------------------------QQTYSFVD
1z7mB           ---------------QVKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKTFNQEKMFQFIK
1z7mD           ---------------QVKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYT----ALETFNQEKMFQFIK
1z7nD           ---------------QVKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLY-------TALFNQEMFQFIK
1z7nA           ---------------QVKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKTFNQEKMFQFIK
1z7mA           ---------------QVKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKTFNQEKMFQFIK
1z7mC           ---------------QVKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTAN--------QEKMFQFIK
1z7nC           ---------------QVKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLY-------TALENQEMFQFIK
2zceA           ----------------------------------GFLEIKSPILIPLEYIERGIDNDTEL-SKQIF----
2zcdA           ----------------------------------GFLEIKSPILIPLEYIERGIDNDTEL-SKQIF----
2e3cA           ----------------------------------GFLEIKSPILIPLEYIERGIDNDTEL-SKQIF----
2q7hA           ----------------------------------GFLEIKSPILIPLEYIER---MGIDELSKQIF----
2q7eA           ----------------------------------GFLEIKSPILIPLEYIER---MGIDNLSKQIF----
2q7gA           ----------------------------------GFLEIKSPILIPLEYIERGIDLSKQIFRVD------
1httB           ----------------------------------------------------------------------
1kmmD           ----------------------------------------------------------------------
1kmmB           ----------------------------------------------------------------------
1qe0B           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           RGGRSLTLRPEGTAAMVRAYLEHGMKVWPQPVRLWMAGPMFRAERPQKGRYRQFHQVNYEALGSENPILD
1adjA           RGGRSLTLRPEGTAAMVRAYLEHGMKVWPQPVRLWMAGPMFRAERPQKGRYRQFHQVNYEALGSENPILD
1h4vB           RGGRSLTLRPEGTAAMVRAYLEHGMKVWPQPVRLWMAGPMFRAERP----YRQFHQVNYEALGSENPILD
1kmmC           RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDID
1kmmA           RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDID
2el9D           RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDID
2el9B           RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDID
1kmnA           RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDID
2el9A           RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDID
2el9C           RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDID
1httA           RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDID
1kmnB           RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDID
1qe0A           KGDRSITLRPEGTAAVVRSYIEHKMQGNPQPIKLYYNGPMFRY-------YRQFNQFGVEAIGAENPSVD
1httB           RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDID
1kmmD           RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDID
1kmmB           RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDID
1qe0B           KGDRSITLRPEGTAAVVRSYIEHKMQGNPQPIKLYYNGPMFR-------YYRQFNQFGVEAIGAENPSVD
1wu7B           KGGREVTLIPEATPSTVRVTSRKDLQ---RPLRWYSFPKVWRYEEPQAGRYREHYQFNADIFGSDSPEAD
1wu7A           KGGREVTLIPEATPSTVRVTSRKDLQ---RPLRWYSFPKVWRYEEPQAGRYREHYQFNADIFGSDSPEAD
1z7mB           HEGQSITLRYDFTLPLVRLYSQIKDST---SARYSYFGKIFRKEKRHKGRSTENYQIGIELFGESADKSE
1z7mD           HEGQSITLRYDFTLPLVRLYSQIKDST---SARYSYFGKIFRKEKRHKGRSTENYQIGIELFGESADKSE
1z7nD           HEGQSITLRYDFTLPLVRLYSQIKDST---SARYSYFGKIFRKEKRHKGRSTENYQIGIELFGESADKSE
1z7nA           HEGQSITLRYDFTLPLVRLYSQIKDST---SARYSYFGKIFRKEKRHEN-----YQIGIELFGESADKSE
1z7mA           HEGQSITLRYDFTLPLVRLYSQIKDST---SARYSYFGKIFRKE-------KENYQIGIELFGESADKSE
1z7mC           HEGQSITLRYDFTLPLVRLYSQIKDST---SARYSYFGKIFRKE--------ENYQIGIELFGESADKSE
1z7nC           HEGQSITLRYDFTLPLVRLYSQIKDST---SARYSYFGKIFRKEKN--------YQIGIELFGESADKSE
2zceA           RVDKNFCLRPM-LAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTREN
2zcdA           RVDKNFCLRPM-LAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTREN
2e3cA           RVDKNFCLRPM-LAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTREN
2q7hA           RVDKNFCLRPM-LAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTREN
2q7eA           RVDKNFCLRPM-LAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTREN
2q7gA           ---KNFCLRPM-LAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTREN
1httB           ----------------------------------------------------------------------
1kmmD           ----------------------------------------------------------------------
1kmmB           ----------------------------------------------------------------------
1qe0B           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AEAVVLLYECLKELGLRRLKVKLSSVGDPEDRARYNAYLREVLSPHREALSEDSKERLELNPMRILDSKS
1adjA           AEAVVLLYECLKELGLRRLKVKLSSVGDPEDRARYNAYLREVLSPHREALSEDSKERLEENPMRILDSKS
1h4vB           AEAVVLLYECLKELGLRRLKVKLSSVGDPEDRARYNAYLREVLSPHREALSEDSKERLEENPMRILDSKS
1kmmC           AELIMLTARWWRALGIEHVTLELNSIGSLEARANYRDALVAFLEQH------------------------
1kmmA           AELIMLTARWWRALGIEHVTLELNSIGSLEARANYRDALVAFLEQH------------------------
2el9D           AELIMLTARWWRALGIEHVTLELNSIGSLEARANY-----------RDALVAFLEQALG-----------
2el9B           AELIMLTARWWRALGIEHVTLELNSIGSLEARANYRA---------------------------------
1kmnA           AELIMLTARWWRALGIEHVTLELNSIGSLEARANYRDALVAFL---------------------------
2el9A           AELIMLTARWWRALGIEHVTLELNSIGSLEARANY-----------RDALG-------------------
2el9C           AELIMLTARWWRALGIEHVTLELNSIGSLEARANY-----------------------------------
1httA           AELIMLTARWWRALGIEHVTLELNSIGSLEARANY-----------------------------------
1kmnB           AELIMLTARWWRALG---------------------------ISEH---------VTLELNSIGYLDEES
1qe0A           AEVLAMVMHIYQSFGLKHLKLVINSVGDMASRKEYNEALVKHFEPVIHEFCSDCQSRLHTDPMRILTAPR
1httB           AELIMLTARWWRALGIEHVTLELNSIGDEESREHF-----------------------------------
1kmmD           AELIMLTARWWRALGIEHVTLELNSIGLDEESREHFAGLCKLL---------------------------
1kmmB           AELIMLTARWWRALGIEHVTLELNSIGLDEESREHFAGLCKLL---------------------------
1qe0B           AEVLAMVMHIYQSFGLKHLKLVINSVGDMASSKAYKAYLDDLGIPYTE----------------------
1wu7B           AEVIALASSILDRLGLQDIEIRINSIGGTSSDPRYHKISREVDQLRSAGIGEDGVSIADLDEARITGKSS
1wu7A           AEVIALASSILDRLGLQDIEIRINSIGGTSSDPRYHKISREVDQLRSAGIGEDGVSIADLDEARITGKSS
1z7mB           LEILSLALQVIEQLGLNKTVFEIGS-------AKFFQRLCQLAXXXXXXXXXXXXXXXXXXXNAFIEKNS
1z7mD           LEILSLALQVIEQLGLNKTVFEIGS-------AKFFQRLCQLAXXXXXXXXXXXXXXXXXXXNAFIEKNS
1z7nD           LEILSLALQVIEQLGLNKTVFEIGS-------AKFFQRLCQLAXXXXXXXXXXXXXXXXXXXNAFIEKNS
1z7nA           LEILSLALQVIEQLGLNKTVFEIGS-------AKFFQRLCQLAXXXXXXXXXXXXXXXXXXXNAFIEKNS
1z7mA           LEILSLALQVIEQLGLNKTVFEIGS-------AKFFQRLCQLAXXXXXXXXXXXXXXXXXXXNAFIEKNS
1z7mC           LEILSLALQVIEQLGLNKTVFEIGS-------AKFFQRLCQLAXXXXXXXXXXXXXXXXXXXNAFIEKNS
1z7nC           LEILSLALQVIEQLGLNKTVFEIGS-------AKFFQRLCQLAXXXXXXXXXXXXXXXXXXXNAFIEKNS
2zceA           LESIIT--DFLNHLGI------------------------------------------------------
2zcdA           LESIIT--DFLNHLGI------------------------------------------------------
2e3cA           LESIIT--DFLNHLGI------------------------------------------------------
2q7hA           LESIIT--DFLNHLGI------------------------------------------------------
2q7eA           LESIIT--DFLNHLGI------------------------------------------------------
2q7gA           LESIITDF-------LNHLGIDFKIVGDTLD---------------------------------------
1httB           ----------------------------------------------------------------------
1kmmD           ----------------------------------------------------------------------
1kmmB           ----------------------------------------------------------------------
1qe0B           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ERDQALLKELGVRPMLDFLGEEARAHLKEVERHLERLSVPYELEPALVRGLDYYVRTAFEVHHEEIGAQS
1adjA           ERDQALLKELGVRPMLDFLGEEARAHLKEVERHLERLSVPYELEPALVRGLDYYVRTAFEVHHEEIGAQS
1h4vB           ERDQALLKELGVRPMLDFLGEEARAHLKEVERHLERLSVPYELEPALVRGLDYYVRTAFEVHH------S
1kmmC           -------PALG-----DYLDEESREHFAGLCKLLESAGIAYTVNQRLVRGLDYYNRTVFEWVTNSLGSQG
1kmmA           --------ALG-----DYLDEESREHFAGLCKLLESAGIAYTVNQRLVRGLDYYNRTVFEWVTNSLGSQG
2el9D           ----------------DYLDEESREHFAGLCKLLESAGIAYTVNQRLVRGLDYYNRTVFEWVTNSLGSQG
2el9B           ---------LG-----DYLDEESREHFAGLCKLLESAGIAYTVNQRLVRGLDYYNRTVFEWVTNSLGSQG
1kmnA           -----------------YLDEESREHFAGLCKLLESAGIAYTVNQRLVRGLDYYNRTVFEWVTNSLGSQG
2el9A           ----------------DYLDEESREHFAGLCKLLESAGIAYTVNQRLVRGLDYYNRTVFE------WVTN
2el9C           ------------RDAGDYLDEESREHFAGLCKLLESAGIAYTVNQRLVRGLDYYNRTVF-----EWVTNG
1httA           ------------------LDEESREHFAGLCKLLESAGIAYTVNQRLVRGLDYYNRTVF----EWVTNQG
1kmnB           REHFAGLCKL-----------------------LESAGIAYTVNQRLVRGLDYYNRTVFEWVTNSLGSQG
1qe0A           --------------ITDFLNEESKAYYEQVKAYLDDLGIPYTEDPNLVRGLDYYTHTAFELMMDNDGAIT
1httB           ----------------------------------------------------------------------
1kmmD           ----------------------------------------------------------------------
1kmmB           ----------------------------------------------------------------------
1qe0B           ----------------------------------------------------------------------
1wu7B           E-------------------EIARAAVEDLLASYGVKNVRYDF--SIVRGLSYYTGIVFEA-YDRSGQFR
1wu7A           E-------------------EIARAAVEDLLASYGVKNVRYDF--SIVRGLSYYTGIVFEA-YDRSGQFR
1z7mB           KELRGLLKEIFITNELSRLDDVLISSFDQLKEFSEKLSMPIIIDLGMVPKMDYYTDLMFKAYSS--AANQ
1z7mD           KELRGLLKEIFITNELSRLDDVLISSFDQLKEFSEKLSMPIIIDLGMVPKMDYYTDLMFKAYSS--AANQ
1z7nD           KELRGLLKEIFITNELSRLDDVLISSFDQLKEFSEKLSMPIIIDLGMVPKMDYYTDLMFKAYSS--AANQ
1z7nA           KELRGLLKEIFITNELSRLDDVLISSFDQLKEFSEKLSMPIIIDLGMVPKMDYYTDLMFKAYSS--AANQ
1z7mA           KELRGLLKEIFITNELSRLDDVLISSFDQLKEFSEKLSMPIIIDLGMVPKMDYYTDLMFKAYSS--AANQ
1z7mC           KELRGLLKEIFITNELSRLDDVLISSFDQLKEFSEKLSMPIIIDLGMVPKMDYYTDLMFKAYSS--AANQ
1z7nC           KELRGLLKEIFITNELSRLDDVLISSFDQLKEFSEKLSMPIIIDLGMVPKMDYYTDLMFKAYSS--AANQ
2zceA           ----------------------------------------------------------------------
2zcdA           ----------------------------------------------------------------------
2e3cA           ----------------------------------------------------------------------
2q7hA           ----------------------------------------------------------------------
2q7eA           ----------------------------------------------------------------------
2q7gA           ----------------------------------------------------------------------
1httB           --------------------EESREHFAGLCKLLESAGIAYTVNQRLVRGLDYYNRTVFEW----VTNQG
1kmmD           ------------------LDEESREHFAGLCKLLESAGIAYTVNQRLVRGLDYYNRTVFEWVTNSLGSQG
1kmmB           ------------------LDEESREHFAGLCKLLESAGIAYTVNQRLVRGLDYYNRTVFEWVTNSLGSQG
1qe0B           ----------------------SKAYYEQVKAYLDDLGIPYTEDPNLVRGLDYYTHTAFELMMDNDGAIT


                         .         *         .         .         .         .         +:350
query           ALGGGGRYDGLSELLGGPRVPGVGFAFGVERVALALEAEGFGLPEEKGPDLYLIPLTEEAVAEAFYLAEA
1adjA           ALGGGGRYDGLSELLGGPRVPGVGFAFGVERVALALEAEGFGLPEEKGPDLYLIPLTEEAVAEAFYLAEA
1h4vB           ALGGGGRYDGLSELLGGPRVPGVGFAFGVERVALALEAEGFGLPEEKGPDLYLIPLTEEAVAEAFYLAEA
1kmmC           TVCAGGRYDGLVEQLGGRATPAVGFAMGLERLVLLVQAVNPEFKADPVVDIYLVASGADTQSAAMALAER
1kmmA           TVCAGGRYDGLVEQLGGRATPAVGFAMGLERLVLLVQAVNPEFKADPVVDIYLVASGADTQSAAMALAER
2el9D           TVCAGGRYDGLVEQLGGRATPAVGFAMGLERLVLLVQAVNPEFKADPVVDIYLVASGADTQSAAMALAER
2el9B           TVCAGGRYDGLVEQLGGRATPAVGFAMGLERLVLLVQAVNPEFKADPVVDIYLVASGADTQSAAMALAER
1kmnA           TVCAGGRYDGLVEQLGGRATPAVGFAMGLERLVLLVQAVNPEFKADPVVDIYLVASGADTQSAAMALAER
2el9A           TVCAGGRYDGLVEQLGGRATPAVGFAMGLERLVLLVQAVNPEFKADPVVDIYLVASGADTQSAAMALAER
2el9C           TVCAGGRYDGLVEQLGGRATPAVGFAMGLERLVLLVQAVNPEFKADPVVDIYLVASGADTQSAAMALAER
1httA           TVCAGGRYDGLVEQLGGRATPAVGFAMGLERLVLLVQAVNPEFKADPVVDIYLVASGADTQSAAMALAER
1kmnB           TVCAGGRYDGLVEQLGGRATPAVGFAMGLERLVLLVQAVNPEFKADPVVDIYLVASGADTQSAAMALAER
1qe0A           TLCGGGRYNGLLELLDGPSETGIGFAXXXXXXXXXXXXXXXXXXXXXXXXXXXVTMGDQADRYAVKLLNH
1httB           ----------------------------------------------------------------------
1kmmD           ----------------------------------------------------------------------
1kmmB           ----------------------------------------------------------------------
1qe0B           ----------------------------------------------------------------------
1wu7B           AILGGGRYDNLAS-LSGESVPAVGFG-GDAVISLLLKRENVQIPREK-KSVYICRVGKINSSINEY-SRK
1wu7A           AILGGGRYDNLAS-LSGESVPAVGFG-GDAVISLLLKRENVQIPREK-KSVYICRVGKINSSINEY-SRK
1z7mB           PILSGGRYDQLLSNF-QEEAFAIGFCCHMDTILKALERQ-------------------------------
1z7mD           PILSGGRYDQLLSNF-QEEAFAIGFCCHMDTILKALERQ-------------------------------
1z7nD           PILSGGRYDQLLSNF-QEEAFAIGFCCHMDTILKALERQ-------------------------------
1z7nA           PILSGGRYDQLLSNF-QEEAFAIGFCCHMDTILKALERQ-------------------------------
1z7mA           PILSGGRYDQLLSNF-QEEAFAIGFCCHMDTILKALERQ-------------------------------
1z7mC           PILSGGRYDQLLSNF-QEEAFAIGFCCHMDTILKALERQ-------------------------------
1z7nC           PILSGGRYDQLLSNF-QEEAFAIGFCCHMDTILKALERQ-------------------------------
2zceA           ----------------------------------------------------------------------
2zcdA           ----------------------------------------------------------------------
2e3cA           ----------------------------------------------------------------------
2q7hA           ----------------------------------------------------------------------
2q7eA           ----------------------------------------------------------------------
2q7gA           ----------------------------------------------------------------------
1httB           TVCAGGRYDGLVEQLGGRATPAVGFAMGLERLVLLVQAVNPEFKADPVVDIYLVASGADTQSAAMALAER
1kmmD           TVCAGGRYDGLVEQLGGRATPAVGFAMGLERLVLLVQAVNPEFKADPVVDIYLVASGADTQSAAMALAER
1kmmB           TVCAGGRYDGLVEQLGGRATPAVGFAMGLERLVLLVQAVNPEFKADPVVDIYLVASGADTQSAAMALAER
1qe0B           TLCGGGRYNGLLELLDGPSETGIGFAXXXXXXXXXXXXXXXXXXXXXXXXXXXVTMGDQADRYAVKLLNH


                         .         .         .         .         *         .         .:420
query           LRPRLRAEYALAPRKPAKGLEEALKRGAAFAGFLGEDELRAGEVTLKRLATGEQVRLSREEVPGYLLQAL
1adjA           LRPRLRAEYALAPRKPAKGLEEALKRGAAFAGFLGEDELRAGEVTLKRLATGEQVRLSREEVPGYLLQAL
1h4vB           LRPRLRAEYALAPRKPAKGLEEALKRGAAFAGFLGEDELRAGEVTLKRLATGEQVRLSREEVPGYLLQAL
1kmmC           LRDELPGVKLMTNHGGGKQFARADKWGARVAVVLGESEVANGTAVVKDLRSGEQTAVAQDSVAAHLRTLL
1kmmA           LRDELPGVKLMTNHGGGKQFARADKWGARVAVVLGESEVANGTAVVKDLRSGEQTAVAQDSVAAHLRTLL
2el9D           LRDELPGVKLMTNHGGGKQFARADKWGARVAVVLGESEVANGTAVVKDLRSGEQTAVAQDSVAAHLRTLL
2el9B           LRDELPGVKLMTNHGGGKQFARADKWGARVAVVLGESEVANGTAVVKDLRSGEQTAVAQDSVAAHLRTLL
1kmnA           LRDELPGVKLMTNHGGGKQFARADKWGARVAVVLGESEVANGTAVVKDLRSGEQTAVAQDSVAAHLRTLL
2el9A           LRDELPGVKLMTNHGGGKQFARADKWGARVAVVLGESEVANGTAVVKDLRSGEQTAVAQDSVAAHLRTLL
2el9C           LRDELPGVKLMTNHGGGKQFARADKWGARVAVVLGESEVANGTAVVKDLRSGEQTAVAQDSVAAHLRTLL
1httA           LRDELPGVKLMTNHGGGKQFARADKWGARVAVVLGESEVANGTAVVKDLRSGEQTAVAQDSVAAHLRTLL
1kmnB           LRDELPGVKLMTNHGGGKQFARADKWGARVAVVLGESEVANGTAVVKDLRSGEQTAVAQDSVAAHLRTLL
1qe0A           LRHNIKADKDYLQRKIKGQMKQADRLGAKFTIVIGDQELENNKIDVKNMTTGESETIELDALVEY-----
1httB           ----------------------------------------------------------------------
1kmmD           ----------------------------------------------------------------------
1kmmB           ----------------------------------------------------------------------
1qe0B           ----------------------------------------------------------------------
1wu7B           LRERGNVTVEI-ERGLSAQLKYASAIGADFAVIFGERDLERGVVTIRNY-TGSQENVGLDSVVEHLI---
1wu7A           LRERGNVTVEI-ERGLSAQLKYASAIGADFAVIFGERDLERGVVTIRNY-TGSQENVGLDSVVEHLI---
1z7mB           ----------------------------------------------------------------------
1z7mD           ----------------------------------------------------------------------
1z7nD           ----------------------------------------------------------------------
1z7nA           ----------------------------------------------------------------------
1z7mA           ----------------------------------------------------------------------
1z7mC           ----------------------------------------------------------------------
1z7nC           ----------------------------------------------------------------------
2zceA           ----------------------------------------------------------------------
2zcdA           ----------------------------------------------------------------------
2e3cA           ----------------------------------------------------------------------
2q7hA           ----------------------------------------------------------------------
2q7eA           ----------------------------------------------------------------------
2q7gA           ----------------------------------------------------------------------
1httB           LRDELPGVKLMTNHGGGKQFARADKWGARVAVVLGESEVANGTAVVKDLRSGEQTAVAQDSVAAHLRTLL
1kmmD           LRDELPGVKLMTNHGGGKQFARADKWGARVAVVLGESEVANGTAVVKDLRSGEQTAVAQDSVAAHLRTLL
1kmmB           LRDELPGVKLMTNHGGGKQFARADKWGARVAVVLGESEVANGTAVVKDLRSGEQTAVAQDSVAAHLRTLL
1qe0B           LRHNIKADKDYLQRKIKGQMKQADRLGAKFTIVIGDQELENNKIDVKNMTTGESETIELDALVEY-----


                         .         .         +         .         .         .         .:490
query           G
1adjA           G
1h4vB           G
1kmmC           G
1kmmA           G
2el9D           G
2el9B           G
1kmnA           G
2el9A           G
2el9C           G
1httA           G
1kmnB           G
1qe0A           -
1httB           -
1kmmD           -
1kmmB           -
1qe0B           -
1wu7B           -
1wu7A           -
1z7mB           -
1z7mD           -
1z7nD           -
1z7nA           -
1z7mA           -
1z7mC           -
1z7nC           -
2zceA           -
2zcdA           -
2e3cA           -
2q7hA           -
2q7eA           -
2q7gA           -
1httB           G
1kmmD           G
1kmmB           G
1qe0B           -