[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tthe0:fecD

[Show Plain Result]

#ERROR : Can't open dsspfile "2nq2B.bssp"
#ERROR : Can't open dsspfile "2nq2A.bssp"
#ERROR : Can't open dsspfile "1l7vA.bssp"
#ERROR : Can't open dsspfile "2qi9A.bssp"

## Summary of PDB Search
:342
    2e-06  37%  2nq2B  [x.x.x] HYPOTHETICAL ABC TRANSPORTER PERMEASE PROTEIN
    1e-05  41%  2nq2A  [x.x.x] HYPOTHETICAL ABC TRANSPORTER PERMEASE PROTEIN
    3e-05  69%  1l7vA  [f.22.1] VITAMIN B12 TRANSPORT SYSTEM PERMEASE PROTEIN
    4e-05  69%  2qi9A  [x.x.x] VITAMIN B12 IMPORT SYSTEM PERMEASE PROTEIN BTUC
:342

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxENPIVTELRLPRXXXXXXXX
2nq2B           --------------------------------------------------QQQVIFQVRLPRILTALCVG
2nq2A           ----------------------------------------------------------RLPRILTALCVG
1l7vA           ----------------------------------------------------------------------
2qi9A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXFQGLFRNPLADPYLMGSASGAAFAVTLFASLLGGLSPAFSQHAVFQHLPLSATFFGFxxxx
2nq2B           AGLALSGVVLQGIFRNPLVNPHIIGVTSGSAFGGTL-AIFFG-----FSLYGLF----TSTILFGF----
2nq2A           AGLALSGVVLQGIFRNPLVNPHIIGVTSGSAFGGTL-AIFFG-----FSLYGLF----TSTILFGF----
1l7vA           ----------------------------------------------------------------------
2qi9A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2nq2B           ----------------------------------------------------------------------
2nq2A           ----------------------------------------------------------------------
1l7vA           ----------------------------------------------------------------------
2qi9A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGIIGFVGLVTPHLLRR
2nq2B           ----------------------------------------------------------------------
2nq2A           ----------------------------------------------------------------------
1l7vA           ------------------------------------------------------GAIGFIGLVIPHILRL
2qi9A           ------------------------------------------------------GAIGFIGLVIPHILRL


                         .         *         .         .         .         .         +:350
query           LLGEDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELPVGVVTTLLGGPFFLYLMxxxxxxx
2nq2B           --------------------------------------------------------------
2nq2A           --------------------------------------------------------------
1l7vA           CGLTDHRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPVFIWLL-------
2qi9A           SGLTDHRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPVFIWLL-------