[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tthe0:AAS80786.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1t6sA.bssp"
#ERROR : Can't open dsspfile "2z99A.bssp"

## Summary of PDB Search
:177
    9e-25  43%  1t6sA  [a.4.5 - a.4.5] CONSERVED HYPOTHETICAL PROTEIN
    1e-20  39%  2z99A  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
:177

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxEAPSLKTLLLAVLFAAGRPVALKELRALGHPEEAVLRALKALERDLEAGHLGVALERVAGGWRLVVHP
1t6sA           --------------IFSSEEPVNLQTLSQIAHPSE-LQEAVDELNRDYEATGRTFRIHAIAGGYRFLTEP
2z99A           --DADELKRVLEALLLVIDTPVTADALAAATEPVYRVAAKLQLMADELTGRDSGIDLRHTSEGWRMYTRA


                         .         .         *         .         .         .         .:140
query           KALEAVERVLKPSPPRLSRAALEVLALVAYHQPVTRAELEAMRGKGVEGVLESLLERGLVRVVGEKEAPG
1t6sA           EFADLVRQLLAPVQRRLSRSMLEVLAVVAWHQPVTKGEIQQIRGASPDYSIDRLLARGLIEVRGRADSPG
2z99A           RFAPYVEKLLLDGATKLTRAALETLAVVAYRQPVTRARVSAVRGVNVDAVMRTLLARGLITEVG-TDADT


                         +         .         .         .         .         *         .:210
query           RPKLYGTTERFLEVFGLxxxxxxxxxxxxxxxxxxxx
1t6sA           RPLQYGTTEVFLDLFHL--------------------
2z99A           GAVTFATTELFLERLGL--------------------