[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tthe0:AAS80787.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1hruA.bssp"
#ERROR : Can't open dsspfile "1hruB.bssp"
#ERROR : Can't open dsspfile "1jcuA.bssp"
#ERROR : Can't open dsspfile "2eqaA.bssp"
#ERROR : Can't open dsspfile "1k7jA.bssp"

## Summary of PDB Search
:195
    1e-19  37%  1hruA  [d.115.1] YRDC GENE PRODUCT
    5e-19  37%  1hruB  [d.115.1] YRDC GENE PRODUCT
    2e-18  37%  1jcuA  [d.115.1] CONSERVED PROTEIN MTH1692
    7e-18  36%  2eqaA  [x.x.x] HYPOTHETICAL PROTEIN ST1526
    2e-05  29%  1k7jA  [d.115.1] PROTEIN YCIO
:195

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxQEALAKAAETLKGGGLVAFPTDTVWGVLALMEDEAACKRIYEVKGRPEDKPLQVLVADLESALEL
1hruA           -----RDAIAAAIDVLNEERVIAYPTEAVFGVGCDPDSETAV-RLLELKQRPVDKGLILIAANYEQLKPY
1hruB           -----RDAIAAAIDVLNEERVIAYPTEAVFGVGCDPDSETAV-RLLELKQRPVDKGLILIAANYEQLKPY
1jcuA           ------DVLEEAISVMEGGGIVIYPTDTIYGLGVNALDEDAVRRLFRVKGRSPHKPVSICVSCVD---EI
2eqaA           -----------AADVIRNGGTVAFPTETVYGLGANAFDGNACLKIFQAKNRPVDNPLIVHIADFNQLFEV
1k7jA           -----QRLINQAVEIVRKGGVIVYPTDSGYALGCKIEDKNA-ERICRIRQLPDGHNF-TLCRDLS---EL


                         .         .         *         .         .         .         .:140
query           VDLGPLEGKFLRLAEAFWPGGLTVVVPGKAIPPWISKDGSVGLRMPDHALLRELLRRVGGHAAATSLNKS
1hruA           ID-DTLTDVQRETIFSRWPGPVTFVFPAPATTPWLTRFDSLAVRVTDHPLVVALCQAYGKPLVSTSANLS
1hruB           ID-DTLTDVQRETIFSRWPGPVTFVFPAPATTPWLTRFDSLAVRVTDHPLVVALCQAYGKPLVSTSANLS
1jcuA           PRFSRPSGDAMELMERILPGPYTVVLERNELIPDVITGGSVGIRVPDDEICRRIAARF--PVTATSANIS
2eqaA           AK--DIPDKVLEIAQIVWPGPLTFVLKTERVPKEVTAGLDTVAVRPAHPIALQLIRESGVPIAAPSANLA
1k7jA           STYSFVDNVAFRLKNN-TPGNYTFILKGKEVPRRLEKRKTIG-RVPSNPIAQALLEAL-GEPLSTSLTES


                         +         .         .         .         .         *         .:210
query           GEPPVRTEAEARTFAVDFVFPGEAGGLASSVVDLRTGEVLREGxxxxxxxxxxxx
1hruA           GLPPCRTVDEVRAFGAAFVVPGETGGRPSEIRDALTGELFR--------------
1hruB           GLPPCRTVDEVRAFGAAFVVPGETGGRPSEIRDALTGEL----------------
1jcuA           GKPP---------------------------------------------------
2eqaA           TRPPTKAE-----------------------------------------------
1k7jA           DPEEIKDRLEKQVDLI--IHGGYLGQKPTTVIDLTTPVVVREG------------