[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tthe0:dsbA

[Show Plain Result]

#ERROR : Can't open dsspfile "3f4rA.bssp"
#ERROR : Can't open dsspfile "3f4sA.bssp"
#ERROR : Can't open dsspfile "3f4tA.bssp"
#ERROR : Can't open dsspfile "3eu4A.bssp"
#ERROR : Can't open dsspfile "3eu3A.bssp"
#ERROR : Can't open dsspfile "3bd2A.bssp"
#ERROR : Can't open dsspfile "3bciA.bssp"
#ERROR : Can't open dsspfile "3gykB.bssp"
#ERROR : Can't open dsspfile "3gykA.bssp"
#ERROR : Can't open dsspfile "3bckA.bssp"
#ERROR : Can't open dsspfile "3gmfA.bssp"
#ERROR : Can't open dsspfile "2h0hB.bssp"
#ERROR : Can't open dsspfile "2h0hA.bssp"
#ERROR : Can't open dsspfile "1v58A.bssp"
#ERROR : Can't open dsspfile "2h0iA.bssp"
#ERROR : Can't open dsspfile "2h0gA.bssp"

## Summary of PDB Search
:211
    2e-18  31%  3f4rA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    9e-18  30%  3f4sA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    3e-17  30%  3f4tA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    9e-13  28%  3eu4A  [x.x.x] BDBD
    9e-13  28%  3eu3A  [x.x.x] BDBD
    1e-09  29%  3bd2A  [x.x.x] DISULFIDE BOND PROTEIN A
    1e-09  28%  3bciA  [x.x.x] DISULFIDE BOND PROTEIN A
    3e-09  37%  3gykB  [x.x.x] 27KDA OUTER MEMBRANE PROTEIN
    3e-09  37%  3gykA  [x.x.x] 27KDA OUTER MEMBRANE PROTEIN
    6e-09  28%  3bckA  [x.x.x] DISULFIDE BOND PROTEIN A
    1e-06  26%  3gmfA  [x.x.x] PROTEIN-DISULFIDE ISOMERASE
    2e-04  35%  2h0hB  [x.x.x] THIOL:DISULFIDE INTERCHANGE PROTEIN DSBG
    2e-04  35%  2h0hA  [x.x.x] THIOL:DISULFIDE INTERCHANGE PROTEIN DSBG
    3e-04  35%  1v58A  [d.17.3 - c.47.1] THIOL:DISULFIDE INTERCHANGE PROTEIN DSBG
    3e-04  35%  2h0iA  [x.x.x] THIOL:DISULFIDE INTERCHANGE PROTEIN DSBG
    3e-04  35%  2h0gA  [x.x.x] THIOL:DISULFIDE INTERCHANGE PROTEIN DSBG
:211

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxPKGKAGLDPAEGARFALGREDAPVVVVDFSNYLCPHCQNHALNVLPR
3f4rA           --------------------------------------------APILMIEYASLTCYHCSLFHRNVFPK
3f4sA           --------------------------------------------APILMIEYASLTCYHCSLFHRNVFPK
3f4tA           --------------------------------------------APILMIEYASLTCYHCSLFHRNVFPK
3eu4A           ---------------------------------------LGKDDAPVTVVEFGDYKCPSCKVFNSDIFPK
3eu3A           ---------------------------------------LGKDDAPVTVVEFGDYKCPSCKVFNSDIFPK
3bd2A           ---------------------------------------------PLVVV-YGDYKCPYCKELDEKVMPK
3bciA           ---------------------------------------------PLVVV-YGDYKCPYCKELDEKVMPK
3gykB           ---------------------------------------LGNPEGDVTVVEFFDYNCPYCR-RAAEVQGL
3gykA           ---------------------------------------LGNPEGDVTVVEFFDYNCPYCR-RAAEVQGL
3bckA           ---------------------------------------------PLVVV-YGDYKCPYCKELDEKVMPK
3gmfA           ---------------------------------------LGNPAAKLRLVEFVSYTCPHCSHFEIESEGQ
2h0hB           -----------------------PAGREMWQRMEQSHWLLGKKDAPVIVYVFADPFCPYCEQFWQQARP-
2h0hA           -----------------------PAGREMWQRMEQSHWLLGKKDAPVIVYVFADPFCPYCEQFWQQARP-
1v58A           -----------------------PAGREMWQRMEQSHWLLGKKDAPVIVYVFADPFCPYCKQFWQQARP-
2h0iA           -----------------------PAGREMWQRMEQSHWLLGKKDAPVIVYVFADPFCPYCKQFWQQARP-
2h0gA           -----------------------PAGREMWQRMEQSHWLLGKKDAPVIVYVFADPFCPYCKQFWQQARP-


                         .         .         *         .         .         .         .:140
query           LKAEYIDTGKVRYLFRDFPFPGQANVIRXXXXXXXXXXQGRYYDYHEVLFRAAAGWGNLTGEALDRYLVD
3f4rA           IKEKYIDTGKMLYIFRHFPLDYRG--LKAAMLSHCYEKQEDYFNFNKAVFNSIDSWNNLSDLTL---LQR
3f4sA           IKEKYIDTGKMLYIFRHFPLDYRG--LKAAMLSHCYEKQEDYFNFNKAVFNSIDSWNNLSDLTL---LQR
3f4tA           IKEKYIDTGKMLYIFRHFPLDYRG--LKAAMLSHAYEKQEDYFNFNKAVFNSIDSWNNLSDLTL---LQR
3eu4A           IQKDFIDKGDVKFSFVNVMFHGKSRLAALASEEVWKEDPDSFWDFHEKLFETEQEWPGLLGD-LAKSTTK
3eu3A           IQKDFIDKGDVKFSFVNVMFHGKSRLAALASEEVWKEDPDSFWDFHEKLFETEQEWPGLLGD-LAKSTTK
3bd2A           LRKNYIDNHKVEYQFVNLAFLGKDSIVGSRASHAVLMYAPKFLDFQKQLFAAQQDQNKLTKELLDKHI--
3bciA           LRKNYIDNHKVEYQFVNLAFLGKDSIVGSRASHAVLMYAPKFLDFQKQLFAAQQDENKLTKELLDKHI--
3gykB           VDAD----PNVRLVYREWPILGEGSDF-XXXXXXXXXQQGKYEAFH---------WALGSGKANETGVLR
3gykA           VDAD----PNVRLVYREWPILGEGSDF-XXXXXXXXXQQGKYEAFH---------WALGSGKANETGVLR
3bckA           LRKNYIDNHKVEYQFVNLAFLGKDSIVGSRASHAVLMYAPKFLDFQKQLFAAQQDENKLTKELLDKHI--
3gmfA           LKIGMVQPGKGAIEVRNFV---RDPIDMTVALITNCVPPSRFFTLHTAFMRSQAQWGPLANSASDFRFYD
2h0hB           ----WVDSGKVQ----------------------------------------------------------
2h0hA           ----WVDSGKVQ----------------------------------------------------------
1v58A           ----WVDSGKVQ----------------------------------------------------------
2h0iA           ----WVDSGKVQ----------------------------------------------------------
2h0gA           ----WVDSGKVQ----------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LAGQIGLDEGAFAACLASGRHREEVLADQKLATDLGLTGTPTFFIAGEKHTGFLPYEEWKRLLDEALAKA
3f4rA           IAALSNLKQDAFNQCINDKKIMDKIVNDKSLAINLGITATPIFFIKKVKHGGYKELKYFTNVIDKLYGKA
3f4sA           IAALSNLKQDAFNQCINDKKIMDKIVNDKSLAINLGITAVPIFFIKKVKHGGYKELKYFTNVIDKLYGKA
3f4tA           IAALSNLKQDAFNQAINDKKIMDKIVNDKSLAINLGITATPIFFIKKVKHGGYKELKYFTNVIDKLYGKA
3eu4A           IKPETNLDKETFAS---------QVEKDSDLNQKMNIQATPTIYVNDKVIKNFADYDEIKETIEKEL---
3eu3A           IKPETNLDKETFAS---------QVEKDSDLNQKMNIQATPTIYVNDKVIKNFADYDEIKETIEKEL---
3bd2A           --KQLHLDKETENKIIKDYKTKDSXXXXXXXXXXNHIKTTPTAFINGEKVEDPYDYESYEKLL-------
3bciA           --KQLHLDKETENKIIKDYKTKDSXXXXXXXXXXNHIKTTPTAFINGEKVEDPYDYESYEKLLKD-----
3gykB           IAREVGLD--------TEQLQRDEAIAQSALAQKLGFNGTPSFVVEDALVPGFVEQSQLQDAVDRA----
3gykA           IAREVGLD--------TEQLQRDEAIAQSALAQKLGFNGTPSFVVEDALVPGFVEQSQLQDAVDRA----
3bckA           --KQLHLDKETENKIIKDYKTKDSXXXXXXXXXXNHIKTVPTAFINGEKVEDPYDYESYEKLL-------
3gmfA           FMAARGMDRSTLDRCLSNEALAKKLAAEDEAINQYNVSGTPSFMIDGILLAG---THDWASLRPQILAR-
2h0hB           ----------------------------------------------------------------------
2h0hA           ----------------------------------------------------------------------
1v58A           ----------------------------------------------------------------------
2h0iA           ----------------------------------------------------------------------
2h0gA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           x
3f4rA           -
3f4sA           -
3f4tA           -
3eu4A           -
3eu3A           -
3bd2A           -
3bciA           -
3gykB           -
3gykA           -
3bckA           -
3gmfA           -
2h0hB           -
2h0hA           -
1v58A           -
2h0iA           -
2h0gA           -