[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tthe0:AAS80903.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3bd0A.bssp"

## Summary of PDB Search
:370
    6e-04  28%  3bd0A  [x.x.x] PROTEIN MEMO1
:370

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3bd0A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxARVL
3bd0A           ------------------------------------------------------------------ARAI


                         +         .         .         .         .         *         .:210
query           LMPHLEPSRVPEVYGAALAALEKTPPPERIYLVGVAHRPLKEKAAALPVPFQTPFGXXXXXXXXXXXXXX
3bd0A           IAPHAGYTYC----GSCAAHAYKQVDPSRIFILGPSHHPLSRCALSSVDIYRTPLYDLRIDQKIYGELWK


                         .         .         .         +         .         .         .:280
query           XXXFELFNTPLAFREEHSLELPLFFLKGRFPEARVLPLLVARRSPELGEALKVVLRDFPGLLVLAVDLSH
3bd0A           TGMFERMSLQTD-EDEHSIEMHLPYMESHKDEFTIIPVLVGALSEEFGKLFSKYLADPSNLFVVSSDFCH


                         .         *         .         .         .         .         +:350
query           VGPRFxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3bd0A           WGQRF-----------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxx
3bd0A           --------------------