[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tthe0:AAS80912.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2e7uA.bssp"
#ERROR : Can't open dsspfile "2gsaA.bssp"
#ERROR : Can't open dsspfile "2hozA.bssp"
#ERROR : Can't open dsspfile "3bs8A.bssp"
#ERROR : Can't open dsspfile "2hozB.bssp"
#ERROR : Can't open dsspfile "2hoyA.bssp"
#ERROR : Can't open dsspfile "2hp1B.bssp"
#ERROR : Can't open dsspfile "2hoyB.bssp"
#ERROR : Can't open dsspfile "2zsmB.bssp"
#ERROR : Can't open dsspfile "2zsmA.bssp"
#ERROR : Can't open dsspfile "2epjA.bssp"
#ERROR : Can't open dsspfile "2cfbA.bssp"
#ERROR : Can't open dsspfile "2cy8A.bssp"
#ERROR : Can't open dsspfile "1vefA.bssp"
#ERROR : Can't open dsspfile "1szsA.bssp"
#ERROR : Can't open dsspfile "1szkA.bssp"
#ERROR : Can't open dsspfile "1sffA.bssp"
#ERROR : Can't open dsspfile "1szuA.bssp"
#ERROR : Can't open dsspfile "2eo5A.bssp"
#ERROR : Can't open dsspfile "2eh6A.bssp"
#ERROR : Can't open dsspfile "2ordA.bssp"
#ERROR : Can't open dsspfile "2e54A.bssp"
#ERROR : Can't open dsspfile "2oatA.bssp"
#ERROR : Can't open dsspfile "1gbnA.bssp"
#ERROR : Can't open dsspfile "2pb2B.bssp"
#ERROR : Can't open dsspfile "2pb2A.bssp"
#ERROR : Can't open dsspfile "2pb0B.bssp"
#ERROR : Can't open dsspfile "2pb0A.bssp"
#ERROR : Can't open dsspfile "2bylA.bssp"
#ERROR : Can't open dsspfile "2byjA.bssp"
#ERROR : Can't open dsspfile "1dgdA.bssp"
#ERROR : Can't open dsspfile "1d7uA.bssp"
#ERROR : Can't open dsspfile "1zodA.bssp"
#ERROR : Can't open dsspfile "1z7dD.bssp"
#ERROR : Can't open dsspfile "1z7dC.bssp"
#ERROR : Can't open dsspfile "1z3zA.bssp"
#ERROR : Can't open dsspfile "1z7dE.bssp"
#ERROR : Can't open dsspfile "1z7dA.bssp"
#ERROR : Can't open dsspfile "1z7dB.bssp"
#ERROR : Can't open dsspfile "1s0aB.bssp"
#ERROR : Can't open dsspfile "1s08A.bssp"
#ERROR : Can't open dsspfile "1s06B.bssp"
#ERROR : Can't open dsspfile "1s09B.bssp"
#ERROR : Can't open dsspfile "1dtyA.bssp"
#ERROR : Can't open dsspfile "1s07B.bssp"
#ERROR : Can't open dsspfile "1s07A.bssp"
#ERROR : Can't open dsspfile "1qj5B.bssp"
#ERROR : Can't open dsspfile "1mlyB.bssp"
#ERROR : Can't open dsspfile "1mgvA.bssp"
#ERROR : Can't open dsspfile "2zukB.bssp"
#ERROR : Can't open dsspfile "1qj3B.bssp"
#ERROR : Can't open dsspfile "1s08B.bssp"
#ERROR : Can't open dsspfile "1qj3A.bssp"
#ERROR : Can't open dsspfile "1s0aA.bssp"
#ERROR : Can't open dsspfile "1s06A.bssp"
#ERROR : Can't open dsspfile "1s09A.bssp"
#ERROR : Can't open dsspfile "3dxvA.bssp"
#ERROR : Can't open dsspfile "1qj5A.bssp"
#ERROR : Can't open dsspfile "1mlyA.bssp"
#ERROR : Can't open dsspfile "3gjuA.bssp"
#ERROR : Can't open dsspfile "2zukA.bssp"
#ERROR : Can't open dsspfile "3dxvB.bssp"
#ERROR : Can't open dsspfile "3i4jA.bssp"
#ERROR : Can't open dsspfile "3i4jB.bssp"
#ERROR : Can't open dsspfile "3i5tB.bssp"
#ERROR : Can't open dsspfile "3i5tA.bssp"
#ERROR : Can't open dsspfile "3bv0B.bssp"
#ERROR : Can't open dsspfile "3bv0A.bssp"
#ERROR : Can't open dsspfile "3hmuB.bssp"
#ERROR : Can't open dsspfile "3hmuA.bssp"
#ERROR : Can't open dsspfile "3fcrA.bssp"
#ERROR : Can't open dsspfile "1ohvA.bssp"
#ERROR : Can't open dsspfile "1gtxA.bssp"

## Summary of PDB Search
:427
      0.0  92%  2e7uA  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
    e-109  52%  2gsaA  [c.67.1] GLUTAMATE SEMIALDEHYDE AMINOTRANSFERASE
    e-109  52%  2hozA  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE (GSAM)
    e-108  48%  3bs8A  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
    e-104  51%  2hozB  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE (GSAM)
    1e-96  51%  2hoyA  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE (GSAM)
    2e-95  51%  2hp1B  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE (GSAM)
    1e-92  51%  2hoyB  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE (GSAM)
    8e-80  42%  2zsmB  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
    8e-80  42%  2zsmA  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
    8e-80  42%  2epjA  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
    9e-79  46%  2cfbA  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
    6e-27  35%  2cy8A  [x.x.x] D-PHENYLGLYCINE AMINOTRANSFERASE
    8e-24  40%  1vefA  [x.x.x] ACETYLORNITHINE/ACETYL-LYSINE AMINOTRANSFERASE
    2e-23  30%  1szsA  [x.x.x] 4-AMINOBUTYRATE AMINOTRANSFERASE
    2e-23  30%  1szkA  [x.x.x] 4-AMINOBUTYRATE AMINOTRANSFERASE
    3e-23  30%  1sffA  [c.67.1] 4-AMINOBUTYRATE AMINOTRANSFERASE
    9e-23  30%  1szuA  [x.x.x] 4-AMINOBUTYRATE AMINOTRANSFERASE
    2e-20  34%  2eo5A  [x.x.x] 419AA LONG HYPOTHETICAL AMINOTRANSFERASE
    2e-19  33%  2eh6A  [x.x.x] ACETYLORNITHINE AMINOTRANSFERASE
    4e-18  31%  2ordA  [x.x.x] ACETYLORNITHINE AMINOTRANSFERASE
    4e-18  26%  2e54A  [x.x.x] ACETYLORNITHINE AMINOTRANSFERASE
    7e-17  33%  2oatA  [c.67.1] ORNITHINE AMINOTRANSFERASE
    7e-17  33%  1gbnA  [c.67.1] ORNITHINE AMINOTRANSFERASE
    2e-16  33%  2pb2B  [x.x.x] ACETYLORNITHINE/SUCCINYLDIAMINOPIMELATE
    2e-16  33%  2pb2A  [x.x.x] ACETYLORNITHINE/SUCCINYLDIAMINOPIMELATE
    2e-16  33%  2pb0B  [x.x.x] ACETYLORNITHINE/SUCCINYLDIAMINOPIMELATE
    2e-16  33%  2pb0A  [x.x.x] ACETYLORNITHINE/SUCCINYLDIAMINOPIMELATE
    3e-16  33%  2bylA  [x.x.x] ORNITHINE AMINOTRANSFERASE
    3e-16  33%  2byjA  [x.x.x] ORNITHINE AMINOTRANSFERASE
    3e-14  32%  1dgdA  [x.x.x] DIALKYLGLYCINE DECARBOXYLASE
    3e-14  32%  1d7uA  [c.67.1] PROTEIN (2,2-DIALKYLGLYCINE DECARBOXYLASE
    6e-14  30%  1zodA  [c.67.1 (1m0nA)] 2,2-DIALKYLGLYCINE DECARBOXYLASE
    6e-14  36%  1z7dD  [x.x.x] ORNITHINE AMINOTRANSFERASE
    7e-14  34%  1z7dC  [x.x.x] ORNITHINE AMINOTRANSFERASE
    7e-14  30%  1z3zA  [x.x.x] DIALKYLGLYCINE DECARBOXYLASE
    1e-13  35%  1z7dE  [x.x.x] ORNITHINE AMINOTRANSFERASE
    2e-13  36%  1z7dA  [x.x.x] ORNITHINE AMINOTRANSFERASE
    4e-13  34%  1z7dB  [x.x.x] ORNITHINE AMINOTRANSFERASE
    5e-13  28%  1s0aB  [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    1e-12  28%  1s08A  [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    1e-12  27%  1s06B  [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    1e-12  27%  1s09B  [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    1e-12  31%  1dtyA  [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    2e-12  29%  1s07B  [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    2e-12  29%  1s07A  [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    2e-12  29%  1qj5B  [c.67.1] 7,8-DIAMINOPELARGONIC ACID SYNTHASE
    2e-12  29%  1mlyB  [c.67.1] 7,8-DIAMINO-PELARGONIC ACID AMINOTRANSFERASE
    2e-12  29%  1mgvA  [c.67.1] 7,8-DIAMINO-PELARGONIC ACID AMINOTRANSFERASE
    2e-12  29%  2zukB  [x.x.x] ALPHA-AMINO-EPSILON-CAPROLACTAM RACEMASE
    2e-12  28%  1qj3B  [c.67.1] 7,8-DIAMINOPELARGONIC ACID SYNTHASE
    3e-12  28%  1s08B  [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    4e-12  28%  1qj3A  [c.67.1] 7,8-DIAMINOPELARGONIC ACID SYNTHASE
    5e-12  28%  1s0aA  [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    1e-11  27%  1s06A  [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    2e-11  27%  1s09A  [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    2e-11  28%  3dxvA  [x.x.x] ALPHA-AMINO-EPSILON-CAPROLACTAM RACEMASE
    2e-11  29%  1qj5A  [c.67.1] 7,8-DIAMINOPELARGONIC ACID SYNTHASE
    2e-11  29%  1mlyA  [c.67.1] 7,8-DIAMINO-PELARGONIC ACID AMINOTRANSFERASE
    3e-11  27%  3gjuA  [x.x.x] PUTATIVE AMINOTRANSFERASE
    1e-10  28%  2zukA  [x.x.x] ALPHA-AMINO-EPSILON-CAPROLACTAM RACEMASE
    2e-10  28%  3dxvB  [x.x.x] ALPHA-AMINO-EPSILON-CAPROLACTAM RACEMASE
    6e-10  41%  3i4jA  [x.x.x] AMINOTRANSFERASE, CLASS III
    8e-10  36%  3i4jB  [x.x.x] AMINOTRANSFERASE, CLASS III
    3e-09  32%  3i5tB  [x.x.x] AMINOTRANSFERASE
    3e-09  32%  3i5tA  [x.x.x] AMINOTRANSFERASE
    2e-08  33%  3bv0B  [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    2e-08  33%  3bv0A  [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    2e-08  30%  3hmuB  [x.x.x] AMINOTRANSFERASE, CLASS III
    2e-08  30%  3hmuA  [x.x.x] AMINOTRANSFERASE, CLASS III
    9e-07  38%  3fcrA  [x.x.x] PUTATIVE AMINOTRANSFERASE
    1e-05  28%  1ohvA  [c.67.1] 4-AMINOBUTYRATE AMINOTRANSFERASE
    1e-05  28%  1gtxA  [x.x.x] 4-AMINOBUTYRATE AMINOTRANSFERASE
:427

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxMERPISEAYFQEAKRHIPGGVSSPVRAFKAVGGTPPFLVRGEGAYVWDADGNRYLDYVMSWGPLILG
2e7uA           ---MERPISEAYFQEAKRHIPGGVSSPVRAFKAVGGTPPFLVRGEGAYVWDADGNRYLDYVMSWGPLILG
2gsaA           --------SDEIFAAAQKLMPGGVSSPVRAFKSVGGQPIVFDRVKDAYAWDVDGNRYIDYVGTWGPAICG
2hozA           --------SDEIFAAAQKLMPGGVSSPVRAFKSVGGQPIVFDRVKDAYAWDVDGNRYIDYVGTWGPAICG
3bs8A           --------SKTAFKEAQKLMPGGVNSPVRAFKSVDMDPIFMERGKGSKIFDIDGNEYIDYVLSWGPLILG
2hozB           --------SDEIFAAAQKLMPGGVSSPVRAFKSVGGQPIVFDRVKDAYAWDVDGNRYIDYVGTWGPAICG
2hoyA           --------SDEIFAAAQKLMPGGVSSPVRAFKSVGGQPIVFDRVKDAYAWDVDGNRYIDYVGTWGPAICG
2hp1B           --------SDEIFAAAQKLMPGGVSSPVRAFKSVGGQPIVFDRVKDAYAWDVDGNRYIDYVGTWGPAICG
2hoyB           --------SDEIFAAAQKLMPGGVSSPVRAFKSVGGQPIVFDRVKDAYAWDVDGNRYIDYVGTWGPAICG
2zsmB           --------SRMLFERTKELFPGGVNSPVRA--AVKPYPFYVKRGEGAYLYTVDGARIVDLVLAYGPLILG
2zsmA           --------SRMLFERTKELFPGGVNSPVRA--AVKPYPFYVKRGEGAYLYTVDGARIVDLVLAYGPLILG
2epjA           --------SRMLFERTKELFPGGVNSPVRA--AVKPYPFYVKRGEGAYLYTVDGARIVDLVLAYGPLILG
2cfbA           --------------------------------------------KGAHIWDVDGNQYIDYVGSWGPAIVG
2cy8A           ---------------------------------------FISDAQGVHKTDVDGNVYLDFFXXXXXXXXX
1vefA           ----------------------------------------IVRGQGARVWDAEGNEYIDCVGGYGVANLG
1szsA           -------------------------------------PIFADRAENCRVWDVEGREYLDFAGGQAVLNTG
1szkA           -------------------------------------PIFADRAENCRVWDVEGREYLDFAGGIAVLNTG
1sffA           -------------------------------------PIFADRAENCRVWDVEGREYLDFAGGIAVLNTG
1szuA           -------------------------------------PIFADRAENCRVWDVEGREYLDFAGGIAVLNTG
2eo5A           -------------------------------------PLVIDHGEGVWIYDVDGNKYLDFTSGIGVNNLG
2eh6A           -------------------------------------PVKFVRGKGVYLYDEEGKEYLDFVSGIGVNSLG
2ordA           -------------------------------------PATFVYGKGSWIYDEKGNAYLDFTSGIAVNVLG
2e54A           -------------------------------------PATFVYGKGSWIYDEKGNAYLDFTSGIAVNVLG
2oatA           -------------------------------------PVALERGKGIYLWDVEGRKYFDFLSSYSAVNQG
1gbnA           -------------------------------------PVALERGKGIYLWDVEGRKYFDFLSSYSAVNQG
2pb2B           -----------------------------------------VKGKGSRVWDQQGKEYIDFAGGIAVTALG
2pb2A           -----------------------------------------VKGKGSRVWDQQGKEYIDFAGGIAVTALG
2pb0B           -----------------------------------------VKGKGSRVWDQQGKEYIDFAGGIAVTALG
2pb0A           -----------------------------------------VKGKGSRVWDQQGKEYIDFAGGIAVTALG
2bylA           -------------------------------------PVALERGKGIYLWDVEGRKYFDFLSSISAVNQG
2byjA           -------------------------------------PVALERGKGIYLWDVEGRKYFDFLSSISAVNQG
1dgdA           ----------------------------------GGTPMIIERAKGSFVYDADGRAILDFTSGQMSAVLG
1d7uA           ----------------------------------GGTPMIIERAKGSFVYDADGRAILDFTSGQMSAVLG
1zodA           ----------------------------------GGTPMIIERAKGSFVYDADGRAILDFTSGQMSAVLG
1z7dD           -------------------------------------PVVLKRAKGVFVYDVNDKRYYDFLSAYSSVNQG
1z7dC           -------------------------------------PVVLKRAKGVFVYDVNDKRYYDFLSAYSSVNQG
1z3zA           ----------------------------------GGTPMIIERAKGSFVYDADGRAILDFTSGAMSAVLG
1z7dE           -------------------------------------PVVLKRAKGVFVYDVNDKRYYDFLSAYSSVNQG
1z7dA           -------------------------------------PVVLKRAKGVFVYDVNDKRYYDFLSAYSSVNQG
1z7dB           -------------------------------------PVVLKRAKGVFVYDVNDKRYYDFLSAYSSVNQG
1s0aB           ----------------------------------------VVSAEGCELILSDGRRLVDGMSSWWAAIHG
1s08A           ----------------------------------------VVSAEGCELILSDGRRLVDGMSSWWAAIHG
1s06B           ----------------------------------------VVSAEGCELILSDGRRLVDGMSSWWAAIHG
1s09B           ----------------------------------------VVSAEGCELILSDGRRLVDGMSSWWAAIHG
1dtyA           ----------------------------------------VVSAEGCELILSDGRRLVDGMSSWWAAIHG
1s07B           ----------------------------------------VVSAEGCELILSDGRRLVDGMSSWWAAIHG
1s07A           ----------------------------------------VVSAEGCELILSDGRRLVDGMSSWWAAIHG
1qj5B           ----------------------------------------VVSAEGCELILSDGRRLVDGMSSWWAAIHG
1mlyB           ----------------------------------------VVSAEGCELILSDGRRLVDGMSSWWAAIHG
1mgvA           ----------------------------------------VVSAEGCELILSDGRRLVDGMSSWWAAIHG
2zukB           -------------------------------------------GRGARLIEENGRELIDLSGAWGAASLG
1qj3B           ----------------------------------------VVSAEGCELILSDGRRLVDGMSSWWAAIHG
1s08B           ----------------------------------------VVSAEGCELILSDGRRLVDGMSSWWAAIHG
1qj3A           ----------------------------------------VVSAEGCELILSDGRRLVDGMSSWWAAIHG
1s0aA           ----------------------------------------VVSAEGCELILSDGRRLVDGMSSWWAAIHG
1s06A           ----------------------------------------VVSAEGCELILSDGRRLVDGMSSWWAAIHG
1s09A           ----------------------------------------VVSAEGCELILSDGRRLVDGMSSWWAAIHG
3dxvA           -------------------------------------------GRGARLIEENGRELIDLSGAWGAASLG
1qj5A           ----------------------------------------VVSAEGCELILSDGRRLVDGMSSWWAAIHG
1mlyA           ----------------------------------------VVSAEGCELILSDGRRLVDGMSSWWAAIHG
3gjuA           --------------------------------ARGESPTRIAGGEGVTVWDNNGRKSIDAFAGLYCVNVG
2zukA           -------------------------------------------GRGARLIEENGRELIDLSGAWGAASLG
3dxvB           -------------------------------------------GRGARLIEENGRELIDLSGAWGAASLG
3i4jA           --------------------------------------PVAVRGEGVFLYDDAGRRYLD--GSSGALVIG
3i4jB           --------------------------------------PVAVRGEGVFLYDDAGRRYLD--GSSGALVIG
3i5tB           --------------------------------------PVLTHAEGIYVHTEDGRRLIDGPAGMWCAQVG
3i5tA           --------------------------------------PVLTHAEGIYVHTEDGRRLIDGPAGMWCAQVG
3bv0B           ----------------------------------GLTPEQIIAVDGAHLWDGQPIEVLDAMSSWWTAIHG
3bv0A           ----------------------------------GLTPEQIIAVDGAHLWDGQPIEVLDAMSSWWTAIHG
3hmuB           ------PTAELQALDAAHHL-----HPFSANNALGGTR-VITRARGVWLNDSEGEEILDAMAGLWCVNIG
3hmuA           ------PTAELQALDAAHHL-----HPFSANNALGGTR-VITRARGVWLNDSEGEEILDAMAGLWCVNIG
3fcrA           ----------------------------------------------------------------------
1ohvA           ---------------------------------------------GNYLVDVDGNRMLDLYSQISSIPIG
1gtxA           ---------------------------------------------GNYLVDVDGNRMLDLYSQISSIPIG


                         .         .         *         .         .         .         .:140
query           HAHPKVLARVRETLERGLTFGAPSPLEVALAKKVKRAYPFVDLVRFVNSGTEATMSALRLARGYTNRPYI
2e7uA           HAHPKVLARVRETLERGLTFGAPSPLEVALAKKVKRAYPFVDLVRFVNSGTEATMSALRLARGYTGRPYI
2gsaA           HAHPEVIEALKVAMEKGTSFGAPCALENVLAEMVNDAVPSIEMVRFVNSGTEACMAVLRLMRAYTGRDKI
2hozA           HAHPEVIEALKVAMEKGTSFGAPCALENVLAEMVNDAVPSIEMVRFVNSGTEACMAVLRIMRAYTGRDKI
3bs8A           HTNDRVVESLKKVAEYGTSFGAPTEVENELAKLVIDRVPSVEIVRMVSSGTEATMSALRLARGYTGRNKI
2hozB           HAHPEVIEALKVAMEKGTSFGAPCALENVLAEMVNDAVPSIEMVRFVNSGTEACMAVLRIMRAYTGRDKI
2hoyA           HAHPEVIEALKVAMEKGTSFGAPCALENVLAEMVNDAVPSIEMVRFVNSGTEACMAVLRIMRAYTGRDKI
2hp1B           HAHPEVIEALKVAMEKGTSFGAPCALENVLAEMVNDAVPSIEMVRFVNSGTEACMAVLRIMRAYTGRDKI
2hoyB           HAHPEVIEALKVAMEKGTSFGAPCALENVLAEMVNDAVPSIEMVRFVNSGTEACMAVLRIMRAYTGRDKI
2zsmB           HKHPRVLEAVEEALARGWLYGAPGEAEVLLAEKILGYVKRGGMIRFVNSGTEATMTAIRLARGYTGRDLI
2zsmA           HKHPRVLEAVEEALARGWLYGAPGEAEVLLAEKILGYVKRGGMIRFVNSGTEATMTAIRLARGYTGRDLI
2epjA           HKHPRVLEAVEEALARGWLYGAPGEAEVLLAEKILGYVKRGGMIRFVNSGTEATMTAIRLARGYTGRDLI
2cfbA           HAHPEVIDALHAALEKGTSFGAPCLLENILAEMVIAAVPSVEMVRFVNSGTEACMAVLRLMRAYTQREKV
2cy8A           XXXPRVNAAIAEALSHGVQYAASHPLEVRWAERIVAAFPSIRKLRFTGSGTETTLLALRVARAFTGRRMI
1vefA           HGNPEVVEAVKRQAETLMAMPQTLPLTAILPPELNRVFP-------VNSGTEANEAALKFARAHTGRKKF
1szsA           HLHPKVVAAVEAQLKKFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVKIARAATKRSGT
1szkA           HLHPKVVAAVEAQLKKFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVKIARAATKRSGT
1sffA           HLHPKVVAAVEAQLKKFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVKIARAATKRSGT
1szuA           HLHPKVVAAVEAQLKKFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVKIARAATKRSGT
2eo5A           PSHPEVIKIGIEQMQK-LAHAAANDFQLELAKKLVTYSPFQKKVFFSNSGTEAIEASIKVVKN-TGRKYI
2eh6A           HAYPKLTEALKEQVEKLLHVSYENPWQEELAHKLVKHFWTEGKVFFANSGTESVEAAIKLARKYKNKWKF
2ordA           HSHPRLVEAIKDQAEKNLFWNRPQELAELLSKNT-----FGGKVFFANTGTEANEAAIKIARXXXXXXXX
2e54A           HSHPRLVEAIKDQAEKNLFWNRP---QMELAELLSK-NTFGGKVFFANTGTEANEAAIKIARXXXXXXXX
2oatA           HCHPKIVNALKSQVDK-LTLTSRAFYNNVLGEYEEYITKLFNYVLPMNTGVEAGETACKLARGYTYKAKI
1gbnA           HCHPKIVNALKSQVDK-LTLTSRAFYNNVLGEYEEYITKLFNYVLPMNTGVEAGETACKLARGYTYKAKI
2pb2B           HCHPALVEALKETLWHTSNVFTNEP-ALRLGRKLIDA-TFAERVLFMNSGTEANETAFKLARHYAHSPFI
2pb2A           HCHPALVEALKETLWHTSNVFTNEP-ALRLGRKLIDA-TFAERVLFMNSGTEANETAFKLARHYAHSPFI
2pb0B           HCHPALVEALKETLWHTSNVFTNEP-ALRLGRKLIDA-TFAERVLFMNSGTEANETAFKLARHYAHSPFI
2pb0A           HCHPALVEALKETLWHTSNVFTNEP-ALRLGRKLIDA-TFAERVLFMNSGTEANETAFKLARHYAHSPFI
2bylA           HCHPKIVNALKSQVDK-LTLTSRAFYNNVLGEYEEYITKLFNYVLPMNTGVEAGETACKLARGYTYKAKI
2byjA           HCHPKIVNALKSQVDK-LTLTSRAFYNNVLGEYEEYITKLFNYVLPMNTGVEAGETACKLARGYTYKAKI
1dgdA           HCHPEIVSVIGEYAGKHLFSGMLSRPVVDLATRLANTPPGLDRALLLSTGAESNEAAIRMAKLVTGKYEI
1d7uA           HCHPEIVSVIGEYAGKHLFSGMLSRPVVDLATRLANTPPGLDRALLLSTGAESNEAAIRMAKLVTGKYEI
1zodA           HCHPEIVSVIGEKLDHLFSEMLSRPVVDLATRLANITPPGLDRALLLSTGAESNEAAIRMAKLVTGKYEI
1z7dD           HCHPNILAMINQAKNLTICSRAFFSVPLGICERYLTNLLGYDKVLMMNTGAEANETAYKLCRKWG---YE
1z7dC           HCHPNILAMINQAKNLTICSRAFFSVPLGICERYLTNLLGYDKVLMMNTGAEANETAYKLCRKWG---YE
1z3zA           HCHPEIVSVIGEKLDHLFSEMLSRPVVDLATRLANITPPGLDRALLLSTGAESNEAAIRMAKLVTGKYEI
1z7dE           HCHPNILAMINQAKNLTICSRAFFSVPLGICERYLTNLLGYDKVLMMNTGAEANETAYKLCRKWG---YE
1z7dA           HCHPNILAMINQAKNLTICSRAFFSVPLGICERYLTNLLGYDKVLMMNTGAEANETAYKLCRKWG---YE
1z7dB           HCHPNILAMINQAKNLTICSRAFFSVPLGICERYLTNLLGYDKVLMMNTGAEANETAYKLCRKWG---YE
1s0aB           YNHPQLNAAMKDAMSHVMFGGITHAPAIELCRKLVAMTPQLECVFLADSGSVAVEVAMKMALQYWQRQRF
1s08A           YNHPQLNAAMKDAMSHVMFGGITHAPAIELCRKLVAMTPQLECVFLADSGSVAVEVAMKMALQYWQRQRF
1s06B           YNHPQLNAAMKDAMSHVMFGGITHAPAIELCRKLVAMTPQLECVFLADSGSVAVEVAMKMALQYWQRQRF
1s09B           YNHPQLNAAMKDAMSHVMFGGITHAPAIELCRKLVAMTPQLECVFLADSGSVAVEVAMKMALQYWQRQRF
1dtyA           YNHPQLNAAMKSQIDSHVMFGAPA---IELCRKLVAMTPQLECVFLADSGSVAVEVAMKMALQYWDRDRF
1s07B           YNHPQLNAAMKDAMSHVMFGGITHAPAIELCRKLVAMTPQLECVFLADSGSVAVEVAMKMALQYWQRQRF
1s07A           YNHPQLNAAMKDAMSHVMFGGITHAPAIELCRKLVAMTPQLECVFLADSGSVAVEVAMKMALQYWQRQRF
1qj5B           YNHPQLNAAMKDAMSHVMFGGITHAPAIELCRKLVAMTPQLECVFLADSGSVAVEVAMKMALQYWQRQRF
1mlyB           YNHPQLNAAMKDAMSHVMFGGITHAPAIELCRKLVAMTPQLECVFLADSGSVAVEVAMKMALQYWQRQRF
1mgvA           YNHPQLNAAMKDAMSHVMFGGITHAPAIELCRKLVAMTPQLECVFLADSGSVAVEVAMKMALQYWQRQRF
2zukB           YGHPXXXXXXXXXXXXXXXLSASNAPAVTLAERLLASFPGTHKIWFGHSGSDANEAAYRAIVKATGRSGV
1qj3B           YNHPQLNAAMKDAMSHVMFGGITHAPAIELCRKLVAMTPQLECVFLADSGSVAVEVAMKMALQYWQRQRF
1s08B           YNHPQLNAAMKDAMSHVMFGGITHAPAIELCRKLVAMTPQLECVFLADSGSVAVEVAMKMALQYWQRQRF
1qj3A           YNHPQLNAAMKDAMSHVMFGGITHAPAIELCRKLVAMTPQLECVFLADSGSVAVEVAMKMALQYWQRQRF
1s0aA           YNHPQLNAAMKDAMSHVMFGGITHAPAIELCRKLVAMTPQLECVFLADSGSVAVEVAMKMALQYWQRQRF
1s06A           YNHPQLNAAMKDAMSHVMFGGITHAPAIELCRKLVAMTPQLECVFLADSGSVAVEVAMKMALQYWQRQRF
1s09A           YNHPQLNAAMKDAMSHVMFGGITHAPAIELCRKLVAMTPQLECVFLADSGSVAVEVAMKMALQYWQRQRF
3dxvA           YGHPXXXXXXXXXXXXXXXLSASNAPAVTLAERLLASFPGTHKIWFGHSGSDANEAAYRAIVKATGRSGV
1qj5A           YNHPQLNAAMKDAMSHVMFGGITHAPAIELCRKLVAMTPQLECVFLADSGSVAVEVAMKMALQYWQRQRF
1mlyA           YNHPQLNAAMKDAMSHVMFGGITHAPAIELCRKLVAMTPQLECVFLADSGSVAVEVAMKMALQYWQRQRF
3gjuA           YGRQKIADAIA-TQAKNLAYGHGTEASITLAKIIDRA-PKGSRVYFGLSGSDANETNIKLIWYYNNKKII
2zukA           YGHPXXXXXXXXXXXXXTILSASNAPAVTLAERLLASFPGTHKIWFGHSGSDANEAAYRAIVKATGRSGV
3dxvB           YGHPXXXXXXXXXXXXXXXLSASNAPAVTLAERLLASFPGTHKIWFGHSGSDANEAAYRAIVKATGRSGV
3i4jA           HGRAEVGERMAAQAARPFVHGSQFSSDV-LEEYAGRLARFVGLPTFVSGGSEATESAVKLARQYHVE---
3i4jB           HGRAEVGERMAAQAARPFVHGSQFSSDV-LEEYAGRLARFVGLPTFVSGGSEATESAVKLARQYRGEPFK
3i5tB           YGRREI---VDAMAHQAMVLPYASPWYMALAEKIATLTPDLNRIFFTTGGSTAVDSALRFSEFYNNRPQK
3i5tA           YGRREI---VDAMAHQAMVLPYASPWYMALAEKIATLTPDLNRIFFTTGGSTAVDSALRFSEFYNNRPQK
3bv0B           HGHPQALTTQLRVMNHVMFGGLTHEPAARLAKLLVDITPALDTVFFSDSGSVSVEVAAKMARGLPGKRRL
3bv0A           HGHPQALTTQLRVMNHVMFGGLTHEPAARLAKLLVDITPALDTVFFSDSGSVSVEVAAKMARGLPGKRRL
3hmuB           YGRDEVAARQMRELPYYNTFFKTTHVPIALAQKLAELAPGLNHVFFAGGGSEANDTNIRMVRTYPEKTVI
3hmuA           YGRDEVAARQMRELPYYNTFFKTTHVPIALAQKLAELAPGLNHVFFAGGGSEANDTNIRMVRTYPEKTVI
3fcrA           ----------------------------------------------------------------------
1ohvA           YSHPALVKLVQEKLRESLLSVAPKGMSQLITKTIFMWYRSKERGQSAFSKEELETCMINQAPGCPDYS-I
1gtxA           YSHPALVKLVQEKLRESLLSVAPKGMSQLITKTIFMWYRSKERGQSAFSKEELETCMINQAPGCPDYS-I


                         +         .         .         .         .         *         .:210
query           VKFRGNYHGHADGLLVEAGSGALTLGVPSSAGVPEEYAKLTLVLEYNDPXXXXXXXXXXXXXIAAIIFEP
2e7uA           VKFRGNYHGHADGLLVEAGSGALTLGVPSSAGVPEEYAKLTLVLEYNDPEGLREVLKRRGEEIAAIIFEP
2gsaA           IKFEGCYHGHADMFLVKAGSGVATLGLPSSPGVPKKTTANTLTTPYNDLEAVKALFAENPGEIAGVILEP
2hozA           IKFEGCYHGHADMFLVKAGSGVATLGLPSSPGVPKKTTANTLTTPYNDLEAVKALFAENPGEIAGVILEP
3bs8A           LKFEGCYHGHGDSLLIKAGSGVATLGLPDSPGVPEGIAKNTITVPYNDLESVKLAFQQFGEDIAGVIVEP
2hozB           IKFEGCYHGHADMFLVKA-------GLPSSPGVPKKTTANTLTTPYNDLEAVKALFAENPGEIAGVILEP
2hoyA           IKFEGCYHGHAD-------------------------MANTLTTPYNDLEAVKALFAENPGEIAGVILEP
2hp1B           IKFEGCYHGHN-----------------------------TLTTPYNDLEAVKALFAENPGEIAGVILEP
2hoyB           IKFEGN----------------------------------TLTTPYNDLEAVKALFAENPGEIAGVILEP
2zsmB           LKFDGCYHGSHDAVLVAAG------GVPTSAGVPEAVARLTLVTPYNDVEALERVFAEYGDRIAGVIVEP
2zsmA           LKFDGCYHGSHDAVLVAAG------GVPTSAGVPEAVARLTLVTPYNDVEALERVFAEYGDRIAGVIVEP
2epjA           LKFDGCYHGSHDAVLVAAG------GVPTSAGVPEAVARLTLVTPYNDVEALERVFAEYGDRIAGVIVEP
2cfbA           IKFEGCYHGHA----------------------------ATLTAPYNDLEAVSRLFEQYPNDIAGVILEP
2cy8A           LRFEGT-------------------------------TANTLLIRPDDIEGMREVFANHGSDIAAFIAEP
1vefA           VAAMRGFSGRTMG----------SLSVTWEPKYREPFLPLVEPVEFIPYNDVEALKRAVDEETAAVILEP
1szsA           IAFSGAYHGRTHYTLASAGMGLMPGHVYRALGISEDDAIASIHRIFKN--------DAAPEDIAAIVIEP
1szkA           IAFSGAYHGRTHYTLASAGMGLMPGHVYRALGISEDDAIASIHRIFKN--------DAAPEDIAAIVIEP
1sffA           IAFSGAYHGRTHYTLASAGMGLMPGHVYRALGISEDDAIASIHRIFKN--------DAAPEDIAAIVIEP
1szuA           IAFSGAYHGRTHYTLASAGMGLMPGHVYRALGISEDDAIASIHRIFKN--------DAAPEDIAAIVIEP
2eo5A           IAFLGGFHGRTFGSISLTASKAVQRSIPFMPGVPNPYRNPWHINGYENPEDYIFVNLVPPEEVAGIFFEP
2eh6A           ISFENSFHGRTYGSLSATGQPKFHKGFPLVPGF--SYAKL------ND---IDSVYKLLDEETAXXXXXX
2ordA           XXYRNSFHGRTLGSLTATGQPKYQ--KPFEPLVPGEY------FEFNN----VEDLRRKSEDVCAVFLEP
2e54A           XXYRNSFHGR-------------TLGSLTATGQPKPFEPLVPGFEYFEFNNVEDLRRKMSEDVCAVFLEP
2oatA           VFAAGNFWGR-------------TLSAISSSTDPTSYDGFGPIIPYND--LPALERALQDPNVAAFMVEP
1gbnA           VFAAGNFWGR-------------TLSAISSSTDPTSYDGFGPIIPYND--LPALERALQDPNVAAFMVEP
2pb2B           IAFHNAFHGRSLFTVSVGGQPKYSDGFPKPADI--------IHVPFND---LHAVKAVMDDHTCAVVVEP
2pb2A           IAFHNAFHGRSLFTVSVGGQPKYSDGFPKPADI--------IHVPFND---LHAVKAVMDDHTCAVVVEP
2pb0B           IAFHNAFHGRSLFTVSVGGQPKYSDGFPKPADI--------IHVPFND---LHAVKAVMDDHTCAVVVEP
2pb0A           IAFHNAFHGRSLFTVSVGGQPKYSDGFPKPADI--------IHVPFND---LHAVKAVMDDHTCAVVVEP
2bylA           VFAAGNFWGR-------------TLSAISSSTDPTSYDGFGPIIPYND--LPALERALQDPNVAAFMVEP
2byjA           VFAAGNFWGR-------------TLSAISSSTDPTSYDGFGPIIPYND--LPALERALQDPNVAAFMVEP
1dgdA           VGFAQSWHGMXXXXVGPAAVGSFAIPAPERNGAYDYLAELDYAFDLID--------RQSSGNLAAFIAEP
1d7uA           VGFAQSWHGMXXXXVGPAAVGSFAIPAPERNGAYDYLAELDYAFDLID--------RQSSGNLAAFIAEP
1zodA           VGFAQSWHGMXXXXVGPAAVGSFAIPAPERNGAYDYLAELDYAFDLID--------RQSSGNLAAFIAEP
1z7dD           VK-----------------------------KIPENMAKIVVCKFSKVPYXXXXXXXXXXXXVCAFIVEP
1z7dC           VK-----------------------------KIPENMAKIVVCYXXXXXXXXXXXXPN----VCAFIVEP
1z3zA           VGFAQSWHGMXXXXVGPAAVGSFAIPAPERNGAYDYLAELDYAFDLID--------RQSSGNLAAFIAEP
1z7dE           VK-----------------------------KIPENMAKIVVCFKVPYXXXXXXXXXXXXPNVCAFIVEP
1z7dA           VK-----------------------------KIPENMAKI-VVCKNNQXXXXXXXXXXXXPNVCAFIVEP
1z7dB           VK-----------------------------KIPENMAKIVVCKNNFSKVPYXXXXXXXXXXVCAFIVEP
1s0aB           LTFRNGYHGDTFGAMPDNSMHSLWKGLPENLFAPAPQSRMDGEWDERDMVGFARLMAAHRHEIAAVIIEP
1s08A           LTFRNGYHGNT--------FGAMSVCDPENLFAPAPQSRMG-EWDERDMVGFARLMAAHRHEIAAVIIEP
1s06B           LTFRNGYHGDTFGAMPDNSMHSLWKGLPENLFAPAPQSRMDGEWDERDMVGFARLMAAHRHEIAAVIIEP
1s09B           LTFRNGFHGDTFGAMPDNSMHSLWKGLPENLFAPAPQSRMDGEWDERDMVGFARLMAAHRHEIAAVIIEP
1dtyA           LTFRNGYHGDTFGAMPDNSMHSLWKGLPENLFAPAPQSRMDGEWDERDMVGFARLMAAHRHEIAAVIIEP
1s07B           LTFRNGYHGDTFGAMPDNSMHSLWKGLPENLFAPAPQSRMDGEWDERDMVGFARLMAAHRHEIAAVIIEP
1s07A           LTFRNGYHGDTFGAMPDNSMHSLWKGLPENLFAPAPQSRMDGEWDERDMVGFARLMAAHRHEIAAVIIEP
1qj5B           LTFRNGYHGDTFGAMPDNSMHSLWKGLPENLFAPAPQSRMDGEWDERDMVGFARLMAAHRHEIAAVIIEP
1mlyB           LTFRNGYHGDTFGAMPDNSMHSLWKGLPENLFAPAPQSRMDGEWDERDMVGFARLMAAHRHEIAAVIIEP
1mgvA           LTFRNGYHGDTFGAMPDNSMHSLWKGLPENLFAPAPQSRMDGEWDERDMVGFARLMAAHRHEIAAVIIEP
2zukB           IAFAGAYHGHADGLILLXXXXXXXXXXXXXTG----DAILTLLTE--------KLAAVPAGSIGAAFIEP
1qj3B           LTFRNGYHGDTFGAMSVCDPDNL----PENLFAPAPQSRME--WDERDMVGFARLMAAHRHEIAAVIIEP
1s08B           LTFRNGYHGNT--------FGAMSVCDP-NLFAPAPQSRMDGEWDERDMVGFARLMAAHRHEIAAVIIEP
1qj3A           LTFRNGYHGDTFGAMSVCDPDNL----PENLFAPAPQSRMG-EWDERDMVGFARLMAAHRHEIAAVIIEP
1s0aA           LTFRNGYHGDTFGAMPDNSMHSLWKGLPENLFAPAPQSRMG-EWDERDMVGFARLMAAHRHEIAAVIIEP
1s06A           LTFRNGYHGDTFGAMPDNSMHSLWKGLPENLFAPAPQSRMG-EWDERDMVGFARLMAAHRHEIAAVIIEP
1s09A           LTFRNGFHGDTFGAMPDNSMHSLWKGLPENLFAPAPQSRMG-EWDERDMVGFARLMAAHRHEIAAVIIEP
3dxvA           IAFAGAYHGCTVGSM--AFSGLILLXXXXXXXXXXXXAILTLLTE--------KLAAVPAGSIGAAFIEP
1qj5A           LTFRNGYHGDTFGAMPDNSMHSLWKGLPENLFAPAPQSRMG-EWDERDMVGFARLMAAHRHEIAAVIIEP
1mlyA           LTFRNGYHGDTFGAMPDNSMHSLWKGLPENLFAPAPQSRMG-EWDERDMVGFARLMAAHRHEIAAVIIEP
3gjuA           SRWRGYHGSGVTGSLTGLDLFHNAFDLPRAPVLHTEYFRRTEQFSQHCADKLEEILAEGPETIAAFIGEP
2zukA           IAFAGAYHGMAFGLILLXXXXXXXXXXXXXTG----DAILTLLTE--------KLAAVPAGSIGAAFIEP
3dxvB           IAFAGAYHGCTVGSMAFSGDGLILLXXXXXXXXXXXXAILTLLTE--------KLAAVPAGSIGAAFIEP
3i4jA           ---RG-----------EPGRFKVITRVPSR---PEAWPKLRALLEREGP-----------ETVAAFMAEP
3i4jB           VITRVPSRELYTPLMRPEAWPKLPKPDPARNGA-EDAEGLRALLEREGP-----------ETVAAFMAEP
3i5tB           KRIIVRYDGHGSTALTAACTGRLSSPNPRHAGNRSQEAFLDLVQEFED-----RIESLGPDTIAAFLAEP
3i5tA           KRIIVRYDGHGSTALTAACTGRLSSPNPRHAGNRSQEAFLDLVQEFED-----RIESLGPDTIAAFLAEP
3bv0B           MTWRGGYHG--DTFLAHGGMHSLWTDVLAAPQVPRDY----------DPAAFEAQLAQHAGELAAVVVEP
3bv0A           MTWRGGYHG--DTFLAHGGMHSLWTDVLAAPQVPRDY----------DPAAFEAQLAQHAGELAAVVVEP
3hmuB           ISRKNAYHG----------STVASSALGGMAGMHAQSGLIPDVHHINQPNWWAEGGDMDPXXVAAFIAEP
3hmuA           ISRKNAYHG----------STVASSALGGMAGMHAQSGLIPDVHHINQPNWWAEGGDMDPXXVAAFIAEP
3fcrA           --------------------------------------------------------------IAAFIGEP
1ohvA           LSFMGAFHGRTMGCLATTHSKAIKIDIPSFDWPIAPFPRLKYPLELEEVEDLIVKYRKKKKTVAGIIVEP
1gtxA           LSFMGAFHGRTMGCLATTHSKAIKIDIPSFDWPIAPFPRLKYPLELEEVEDLIVKYRKKKKTVAGIIVEP


                         .         .         .         +         .         .         .:280
query           VVGNAGVLVPTEDFLKALHEAREFGVLLIADEVMTGFRLAFGGATELLGLKPDXXXXXXXXXXXXXXXXX
2e7uA           VVGNAGVLVPTEDFLKALHEAKAYGVLLIADEVMTGFRLAFGGATELLGLKPDLVTLGKIXXXXXXXXXX
2gsaA           IVGNSGFIVPDAGFLEGLRETLEHDALLVFDEVMTGFRIAYGGVQEKFGVTPDXXXXXXXXXXXXPVGAY
2hozA           IVGNSGFIVPDAGFLEGLRETLEHDALLVFDEVMTGFRIAYGGVQEKFGVTPDXXXXXXXXXXXXPVGAY
3bs8A           VAGNMGVVPPQEGFLQGLRDITEYGSLLIFDEVMTGFRVDYNCAQGYFGVTPDLTCLGKVIGGGLPVGAY
2hozB           IVGNSGFIVPDAGFLEGLRETLEHDALLVFDEVMTGFRIAYGGVQEKFGVTPDXXXXXXXXXXXXPVGAY
2hoyA           IVGNSGFIVPDAGFLEGLRETLEHDALLVFDEVMTGFRIAYGGVQEKFGVTPDXXXXXXXXXXXXPVGAY
2hp1B           IVGNSGFIVPDAGFLEGLREITEHDALLVFDEVMTGFRIAYGGVQEKFGVTPDXXXXXXXXXXXXPVGAY
2hoyB           IVGNSGFIVPDAGFLEGLREITEHDALLVFDEVMTGFRIAYGGVQEKFGVTPDXXXXXXXXXXXXPVGAY
2zsmB           VIANAGVIPPRREFLAALQRSRESGALLILDEVVTGFRLGLEGAQGYFNIEGDIIVLGKIIGGGFPVGAV
2zsmA           VIANAGVIPPRREFLAALQRSRESGALLILDEVVTGFRLGLEGAQGYFNIEGDIIVLGKIIGGGFPVGAV
2epjA           VIANAGVIPPRREFLAALQRSRESGALLILDEVVTGFRLGLEGAQGYFNIEGDIIVLGKIIGGGFPVGAV
2cfbA           VVGNAGFIPPDAGFLEGLRETKQYGALLVFDEVMTGFRIAYGGAQEKFGVTPDLTTLGKVIGGGLPVGAY
2cy8A           VGSHFGVTPVSDSFLREGAEARQYGALFILDEVISGFRVGNHGMQALLDVQPDLTCLAKASAXXXXXXXX
1vefA           VQGEGGVRPATPEFLRAARETQEKGALLILDEIQTGMRTGKRFAFEHFGIVPDILTXXXXXXXXXXXXXX
1szsA           VQGEGGFYASSPAFMQRLRACDEHGIMLIADEVQSGARTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGV
1szkA           VQGSGGFYASSPAFMQRLRACDEHGIMLIADEVQSGARTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGV
1sffA           VQGEGGFYASSPAFMQRLRACDEHGIMLIADEVQSGARTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGV
1szuA           VQGEGGFYASSPAFMQRLRACDEHGIMLIADEAQSGARTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGV
2eo5A           IQGEGGYVIPPKNFFAELQKAKKYGILLVDDEVQMG----------------------------------
2eh6A           XXXXXXXNEASEDFLSKLQECKEKDVLLIIDEVQTGIRTGEFYAYQHFNLKPDVIALAKGLGGGVPIGAI
2ordA           IQGESGIVPATKEFLEEARKCDEYDALLVFDEVQCGGRTGKLFAYQKYGVVPD-----------------
2e54A           IQGESGIVPATKEFLEEARKCDEYDALLVFDEVQCGMRTGKLFAYQKYGVVPDVLTTAKGLGGGVPIGAV
2oatA           IQGEAGVVVPDPGYLMGVRECTRHQVLFIADEIQTGLRTGRWLAVDYENVRPD-----------------
1gbnA           IQGEAGVVVPDPGYLMGVRECTRHQVLFIADEIQTGLRTGRWLAVDYENVRPD-----------------
2pb2B           IQGEGGVQAATPEFLKGLRDCDEHQALLVFDEVQCG----------------------------------
2pb2A           IQGEGGVQAATPEFLKGLRDCDEHQALLVFDEVQCG----------------------------------
2pb0B           IQGEGGVQAATPEFLKGLRDCDEHQALLVFDEVQCG----------------------------------
2pb0A           IQGEGGVQAATPEFLKGLRDCDEHQALLVFDEVQCG----------------------------------
2bylA           IQGEAGVVVPDPGYLMGVRECTRHQVLFIADEIQTGLRTGRWLAVDYENVRPD-----------------
2byjA           IQGEAGVVVPDPGYLMGVRECTRHQVLFIADEIQTGLRTGRWLAVDYENVRPD-----------------
1dgdA           ILSSGGIIELPDGYMAALKEAR--GMLLILDEAQTGVRTGTMFACQRDGVTPD-----------------
1d7uA           ILSSGGIIELPDGYMAALKEAR--GMLLILDEAQTGVRTGTMFACQRDGVTPD-----------------
1zodA           ILSSGGIIELPDGYMAALKEAR--GMLLILDEAQTGVRTGTMFACQRDGVTPD-----------------
1z7dD           IQGEAGVIVPSDNYLQGVYDCKKYNVLFVADEVQTG----------------------------------
1z7dC           IQGEAGVIVPSDNYLQGVYDCKKYNVLFVADEVQTG----------------------------------
1z3zA           ILSSGGIIELPDGYMAALKEAR--GMLLILDEAQTGVRTGTMFACQRDGVTPD-----------------
1z7dE           IQGEAGVIVPSDNYLQGVYDCKKYNVLFVADEVQTG----------------------------------
1z7dA           IQGEAGVIVPSDNYLQGVYDCKKYNVLFVADEVQTG----------------------------------
1z7dB           IQGEAGVIVPSDNYLQGVYDCKKYNVLFVADEVQTG----------------------------------
1s0aB           IVGAGGMRMYHPEWLKRIRKIRE-GILLIADEIATGFRTGKLFACEHAEIAPDILCLGALTGGTMTLSAT
1s08A           IVGAGGMRMYHPEWLKRIRKIRE-GILLIADEIATGFRTGKLFACEHAEIAPDILCLGALTGGTMTLSAT
1s06B           IVGAGGMRMYHPEWLKRIRKIRE-GILLIADEIATGFKTGKLFACEHAEIAPDILCLGALTGGTMTLSAT
1s09B           IVGAGGMRMYHPEWLKRIRKIRE-GILLIADEIATGFRTGKLFACEHAEIAPDILCLGALTGGTMTLSAT
1dtyA           IVGAGGMRMYHPEWLKRIRKIRE-GILLIADEIATGF---------------------------------
1s07B           IVGAGGMRMYHPEWLKRIRKIRE-GILLIADEIATGF---------------------------------
1s07A           IVGAGGMRMYHPEWLKRIRKIRE-GILLIADEIATGF---------------------------------
1qj5B           IVGAGGMRMYHPEWLKRIRKIRE-GILLIADEIATGF---------------------------------
1mlyB           IVGAGGMRMYHPEWLKRIRKIRE-GILLIADEIATGF---------------------------------
1mgvA           IVGAGGMRMYHPEWLKRIRKIRE-GILLIADEIATGF---------------------------------
2zukB           IQSDGGLIVPPDGFLRKFADCRAHGILVVCDEVKVG----------------------------------
1qj3B           IVGAGGMRMYHPEWLKRIRKIRE-GILLIADEIATGFRTGKLFACEHAEIAPDLCLGKALTGGTMTLSAT
1s08B           IVGAGGMRMYHPEWLKRIRKIRE-GILLIADEIATGFRTGKLFACEHAEIAPDILCLGALTGGTMTLSAT
1qj3A           IVGAGGMRMYHPEWLKRIRKIRE-GILLIADEIATGFRTGKLFACEHAEIAPDLCLGKALTGGTMTLSAT
1s0aA           IVGAGGMRMYHPEWLKRIRKIRE-GILLIADEIATGFRTGKLFACEHAEIAPDILCLGALTGGTMTLSAT
1s06A           IVGAGGMRMYHPEWLKRIRKIRE-GILLIADEIATGFKTGKLFACEHAEIAPDILCLGALTGGTMTLSAT
1s09A           IVGAGGMRMYHPEWLKRIRKIRE-GILLIADEIATGFRTGKLFACEHAEIAPDILCLGALTGGTMTLSAT
3dxvA           IQSDGGLIVPPDGFLRKFADCRAHGILVVCDEVKVG----------------------------------
1qj5A           IVGAGGMRMYHPEWLKRIRKIRE-GILLIADEIATGF---------------------------------
1mlyA           IVGAGGMRMYHPEWLKRIRKIRE-GILLIADEIATGF---------------------------------
3gjuA           ILGTGGIVPPPAGYWEKIQAVKKYDVLLVADEVVTGFGRLGTFGSDHYGIKPD-----------------
2zukA           IQSDGGLIVPPDGFLRKFADCRAHGILVVCDEVKVG----------------------------------
3dxvB           IQSDGGLIVPPDGFLRKFADCRAHGILVVCDEVKVG----------------------------------
3i4jA           VVGSDAALAPAPGYYERVRDCDEAGIIFIADEVMSG----------------------------------
3i4jB           VVGSDAALAPAPGYYERVRDCDEAGIIFIADEVMSG----------------------------------
3i5tB           ILASGGVIIPPAGYFKAICEKHD--ILYISDEVVTGFGRCWFASEKVFGVVPD-----------------
3i5tA           ILASGGVIIPPAGYFKAICEKHD--ILYISDEVVTGFGRCWFASEKVFGVVPD-----------------
3bv0B           VVGAGGMRFHDPRYLHDLRDCRRYEVLLIFDEIATGFRTGALFAADHAGVSPD-----------------
3bv0A           VVGAGGMRFHDPRYLHDLRDCRRYEVLLIFDEIATGFRTGALFAADHAGVSPD-----------------
3hmuB           VQGAGGVIVAPDSYWPEIQRCDKYDILLIADEVICGFRTGNWFGTQTMGIRP------------------
3hmuA           VQGAGGVIVAPDSYWPEIQRCDKYDILLIADEVICGFRTGNWFGTQTMGIRP------------------
3fcrA           ILGTGGIVPPPAGYWEAIQTVNKHDILLVADEVVTGFGRLGTFGSDHYGLEPD-----------------
1ohvA           IQSEGGDNHASDDFFRKLRDSRKHGCAFLVDEVQTG-----GGST-------------------------
1gtxA           IQSEGGDNHASDDFFRKLRDSRKHGCAFLVDEVQTG-----GGST-------------------------


                         .         *         .         .         .         .         +:350
query           XXRREIMEKVAPLGPVYQAGTLSGNPXXXXXXXXXXXXXXXNPGYYRYLEDLGARLERGLKEVLAQKGIP
2e7uA           XXRREIMEKVAPLGPVYQAGTLSGNPXXXXXXXXXXXXXXXNPGYYAYLEDLGARLEAGLKEVLKEKGLP
2gsaA           GGKREIMQLVAPAGPMYQAGTLSGNP-LAMTAGIKTLELLRQPGTYEYLDQITKRLSDGLLAIAQETGHA
2hozA           GGKREIMQLVAPAGPMYQAGTLSGNP-LAMTAGIKTLELLRQPGTYEYLDQITKRLSDGLLAIAQETGHA
3bs8A           GGKAEIMEQIAPSGPIYQAGTLSGNP--LAMTAGLETLKQLTPDSYKNFIKKGDRLEEGISKAAEAHGIP
2hozB           GGKREIMQLVAPAGPMYQAGTLSGNP-LAMTAGIKTLELLRQPGTYEYLDQITKRLSDGLLAIAQETGHA
2hoyA           GGKREIMQLVAPAGPMYQAGTLSGNP-LAMTAGIKTLELLRQPGTYEYLDQITKRLSDGLLAIAQETGHA
2hp1B           GGKREIMQLVAPAGPMYQAGTLSGNPLAMTAGIKTLELLR-QPGTYEYLDQITKRLSDGLLAIAQETGHA
2hoyB           GGKREIMQLVAPAGPMYQAGTLSGNPLAMTAGIKTLELLR-QPGTYEYLDQITKRLSDGLLAIAQETGHA
2zsmB           AGSREVMSLLTPQGKVFNAGTFNAHPITMAAGLATLKALEEEP-VYSVSRXXXXXXXXXXXXVLDRTGLP
2zsmA           AGSREVMSLLTPQGKVFNAGTFNAHPITMAAGLATLKALEEEP-VYSVSRXXXXXXXXXXXXVLDRTGLP
2epjA           AGSREVMSLLTPQGKVFNAGTFNAHPITMAAGLATLKALEEEP-VYSVSRXXXXXXXXXXXXVLDRTGLP
2cfbA           GGRAEIMKMVAPAGP-----TLSGNP-LAMTAGIKTLEILSRPGSYEHLDRITGKLVQGLLDAAREFGHE
2cy8A           XXREDVM-------GVLSRGSFTGNPXXXXXXXXXXXXXLEDDVCAK-INDLGQFAREAMNHLFARKGLN
1vefA           XMREEVARSMPKGG---HGTTFGGNP--------------------------------------------
1szsA           TGRAEVMDAVAPGG---LGGTYAGNP-IACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEI
1szkA           TGRAEVMDAVAPGG---LGGTYAGNP-IACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEI
1sffA           TGRAEVMDAVAPGG---LGGTYAGNP-IACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEI
1szuA           TGRAEVMDAVAPGG---LGGTYAGNP-IACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEI
2eo5A           ----------------------------------------------------------------------
2eh6A           LAREEVAQSFTPGS---HGSTFGGNP--------------------------------------------
2ordA           ----------------------------------------------------------------------
2e54A           I----VNERANVLEPGDHGTTFGGNP-LACRAGVTVIKELTKEGFLEEVEEKGNYLMKKLQEMKEEYDVV
2oatA           ----------------------------------------------------------------------
1gbnA           ----------------------------------------------------------------------
2pb2B           ----------------------------------------------------------------------
2pb2A           ----------------------------------------------------------------------
2pb0B           ----------------------------------------------------------------------
2pb0A           ----------------------------------------------------------------------
2bylA           ----------------------------------------------------------------------
2byjA           ----------------------------------------------------------------------
1dgdA           ----------------------------------------------------------------------
1d7uA           ----------------------------------------------------------------------
1zodA           ----------------------------------------------------------------------
1z7dD           ----------------------------------------------------------------------
1z7dC           ----------------------------------------------------------------------
1z3zA           ----------------------------------------------------------------------
1z7dE           ----------------------------------------------------------------------
1z7dA           ----------------------------------------------------------------------
1z7dB           ----------------------------------------------------------------------
1s0aB           LTTREVAETISEAGCFMHGPTFMGNP--------------------------------------------
1s08A           LTTREVAETIS--NGFMHGPTFMGNP--------------------------------------------
1s06B           LTTREVAETISEAGCFMHGPTFMGNP--------------------------------------------
1s09B           LTTREVAETISEAGCFMHGPTFMGNP--------------------------------------------
1dtyA           ----------------------------------------------------------------------
1s07B           ----------------------------------------------------------------------
1s07A           ----------------------------------------------------------------------
1qj5B           ----------------------------------------------------------------------
1mlyB           ----------------------------------------------------------------------
1mgvA           ----------------------------------------------------------------------
2zukB           ----------------------------------------------------------------------
1qj3B           LTTREVAETISNGGCFMHGPTFMGNP--------------------------------------------
1s08B           LTTREVAETIS--NCFMHGPTFMGNP--------------------------------------------
1qj3A           LTTREVAETISNGGCFMHGPTFMGNP--------------------------------------------
1s0aA           LTTREVAETISEAGCFMHGPTFMGNP--------------------------------------------
1s06A           LTTREVAETISEAGCFMHGPTFMGNP--------------------------------------------
1s09A           LTTREVAETISEAGCFMHGPTFMGNP--------------------------------------------
3dxvA           ----------------------------------------------------------------------
1qj5A           ----------------------------------------------------------------------
1mlyA           ----------------------------------------------------------------------
3gjuA           ----------------------------------------------------------------------
2zukA           ----------------------------------------------------------------------
3dxvB           ----------------------------------------------------------------------
3i4jA           ----------------------------------------------------------------------
3i4jB           ----------------------------------------------------------------------
3i5tB           ----------------------------------------------------------------------
3i5tA           ----------------------------------------------------------------------
3bv0B           ----------------------------------------------------------------------
3bv0A           ----------------------------------------------------------------------
3hmuB           ----------------------------------------------------------------------
3hmuA           ----------------------------------------------------------------------
3fcrA           ----------------------------------------------------------------------
1ohvA           ----------------------------------------------------------------------
1gtxA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           HAVNRVGSMVTVFFTEGPVVTFQDAKRTDTELFKRFFHGLLDRGIYWPPSNFEAAFLSVAHTEEDVEKTL
2e7uA           HTVNRVGSMITVFFTEGPVVTFQDARRTDTELFKRFFHGLLDRGIYWPPSNFEAAFLSVAHREEDVEKTL
2gsaA           ACGGQVSGMFGFFFTEGPVHNYEDAKKSDLQKFSRFHRGMLEQGIYLAPSQFEAGFTSLAHTEEDIDATL
2hozA           ACGGQVSGMFGFFFTEGPVHNYEDAKKSDLQKFSRFHRGMLEQGIYLAPSQFEAGFTSLAHTEEDIDATL
3bs8A           HTFNRAGSMIGFFFTNEPVINYETAKASDLKLFASYYKGMANEGVFLPPSQFEGLFLSTAHTDEDIENTI
2hozB           ACGGQVSGMFGFFFTEGPVHNYEDAKKSDLQKFSRFHRGMLEQGIYLAPSQFEAGFTSLAHTEEDIDATL
2hoyA           ACGGQVSGMFGFFFTEGPVHNYEDAKKSDLQKFSRFHRGMLEQGIYLAPSQFEAGFTSLAHTEEDIDATL
2hp1B           ACGGQVSGMFGFFFTEGPVHNYEDAKKSDLQKFSRFHRGMLEQGIYLAPSQFEAGFTSLAHTEEDIDATL
2hoyB           ACGGQVSGMFGFFFTEGPVHNYEDAKKSDLQKFSRFHRGMLEQGIYLAPSQFEAGFTSLAHTEEDIDATL
2zsmB           YTINRVESMMQLFIGVEEVSNAAQARKADKKFYVKLHEEMLRRGVFIAPSNLEAVFTGLPHQGEALEIAV
2zsmA           YTINRVESMMQLFIGVEEVSNAAQARKADKKFYVKLHEEMLRRGVFIAPSNLEAVFTGLPHQGEALEIAV
2epjA           YTINRVESMMQLFIGVEEVSNAAQARKADKKFYVKLHEEMLRRGVFIAPSNLEAVFTGLPHQGEALEIAV
2cfbA           VCGGHISGMFGLFFTAGPVTNYEQAKQSDLKKFAAFHRGMLEQGIYLAPSQFEAGFTSLAHTEADIERTI
2cy8A           WAYGRFSGFLPPNTTDTGSITRAEVARPDVKMIAAMRMALILEGV--DIGGRGSVFLSAQHEREHVEHLV
1vefA           ----------------------------------------------------------------------
1szsA           GDVRGLGAMIAIELFEDGDHNKPDAKLT------------------------------------------
1szkA           GDVRGLGAMIAIELFEDGDHNKPDAKLT------------------------------------------
1sffA           GDVRGLGAMIAIELFEDGDHNKPDAKLT------------------------------------------
1szuA           GDVRGLGAMIAIELFEDGDHNKPDAKLT------------------------------------------
2eo5A           ----------------------------------------------------------------------
2eh6A           ----------------------------------------------------------------------
2ordA           ----------------------------------------------------------------------
2e54A           ADVRGMGLMIGIQFRE------------------------------------------------------
2oatA           ----------------------------------------------------------------------
1gbnA           ----------------------------------------------------------------------
2pb2B           ----------------------------------------------------------------------
2pb2A           ----------------------------------------------------------------------
2pb0B           ----------------------------------------------------------------------
2pb0A           ----------------------------------------------------------------------
2bylA           ----------------------------------------------------------------------
2byjA           ----------------------------------------------------------------------
1dgdA           ----------------------------------------------------------------------
1d7uA           ----------------------------------------------------------------------
1zodA           ----------------------------------------------------------------------
1z7dD           ----------------------------------------------------------------------
1z7dC           ----------------------------------------------------------------------
1z3zA           ----------------------------------------------------------------------
1z7dE           ----------------------------------------------------------------------
1z7dA           ----------------------------------------------------------------------
1z7dB           ----------------------------------------------------------------------
1s0aB           ----------------------------------------------------------------------
1s08A           ----------------------------------------------------------------------
1s06B           ----------------------------------------------------------------------
1s09B           ----------------------------------------------------------------------
1dtyA           ----------------------------------------------------------------------
1s07B           ----------------------------------------------------------------------
1s07A           ----------------------------------------------------------------------
1qj5B           ----------------------------------------------------------------------
1mlyB           ----------------------------------------------------------------------
1mgvA           ----------------------------------------------------------------------
2zukB           ----------------------------------------------------------------------
1qj3B           ----------------------------------------------------------------------
1s08B           ----------------------------------------------------------------------
1qj3A           ----------------------------------------------------------------------
1s0aA           ----------------------------------------------------------------------
1s06A           ----------------------------------------------------------------------
1s09A           ----------------------------------------------------------------------
3dxvA           ----------------------------------------------------------------------
1qj5A           ----------------------------------------------------------------------
1mlyA           ----------------------------------------------------------------------
3gjuA           ----------------------------------------------------------------------
2zukA           ----------------------------------------------------------------------
3dxvB           ----------------------------------------------------------------------
3i4jA           ----------------------------------------------------------------------
3i4jB           ----------------------------------------------------------------------
3i5tB           ----------------------------------------------------------------------
3i5tA           ----------------------------------------------------------------------
3bv0B           ----------------------------------------------------------------------
3bv0A           ----------------------------------------------------------------------
3hmuB           ----------------------------------------------------------------------
3hmuA           ----------------------------------------------------------------------
3fcrA           ----------------------------------------------------------------------
1ohvA           ----------------------------------------------------------------------
1gtxA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           EALGEAL
2e7uA           EALRKAL
2gsaA           AA-----
2hozA           AA-----
3bs8A           QA-----
2hozB           AA-----
2hoyA           AA-----
2hp1B           AA-----
2hoyB           AA-----
2zsmB           EGLRSSL
2zsmA           EGLRSSL
2epjA           EGLRSSL
2cfbA           AA-----
2cy8A           TTFDRVL
1vefA           -------
1szsA           -------
1szkA           -------
1sffA           -------
1szuA           -------
2eo5A           -------
2eh6A           -------
2ordA           -------
2e54A           -------
2oatA           -------
1gbnA           -------
2pb2B           -------
2pb2A           -------
2pb0B           -------
2pb0A           -------
2bylA           -------
2byjA           -------
1dgdA           -------
1d7uA           -------
1zodA           -------
1z7dD           -------
1z7dC           -------
1z3zA           -------
1z7dE           -------
1z7dA           -------
1z7dB           -------
1s0aB           -------
1s08A           -------
1s06B           -------
1s09B           -------
1dtyA           -------
1s07B           -------
1s07A           -------
1qj5B           -------
1mlyB           -------
1mgvA           -------
2zukB           -------
1qj3B           -------
1s08B           -------
1qj3A           -------
1s0aA           -------
1s06A           -------
1s09A           -------
3dxvA           -------
1qj5A           -------
1mlyA           -------
3gjuA           -------
2zukA           -------
3dxvB           -------
3i4jA           -------
3i4jB           -------
3i5tB           -------
3i5tA           -------
3bv0B           -------
3bv0A           -------
3hmuB           -------
3hmuA           -------
3fcrA           -------
1ohvA           -------
1gtxA           -------