[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tthe0:degV.2

[Show Plain Result]

#ERROR : Can't open dsspfile "2dt8A.bssp"
#ERROR : Can't open dsspfile "1pzxB.bssp"
#ERROR : Can't open dsspfile "3fysA.bssp"
#ERROR : Can't open dsspfile "1vpvA.bssp"
#ERROR : Can't open dsspfile "1pzxA.bssp"
#ERROR : Can't open dsspfile "1vpvB.bssp"
#ERROR : Can't open dsspfile "1mgpA.bssp"

## Summary of PDB Search
:283
    4e-18  29%  2dt8A  [x.x.x] DEGV FAMILY PROTEIN
    5e-11  23%  1pzxB  [c.119.1] HYPOTHETICAL PROTEIN APC36103
    1e-08  22%  3fysA  [x.x.x] PROTEIN DEGV
    2e-08  32%  1vpvA  [c.119.1] UPF0230 PROTEIN TM1468
    4e-07  22%  1pzxA  [c.119.1] HYPOTHETICAL PROTEIN APC36103
    5e-06  30%  1vpvB  [c.119.1] UPF0230 PROTEIN TM1468
    5e-06  30%  1mgpA  [c.119.1] HYPOTHETICAL PROTEIN TM841
:283

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxASSVAFVADSTLGLSPEEAKSLGIHVVPQQVLHRGRSFRDLVEIAPGEVLRLLCSGERLTTSQV
2dt8A           ---------ITLVTDSTSDLPQDLRGRLGVRVVPLYVNLSGAIYRDWEEITPTEIFQKVREGAAFTTSQP
1pzxB           ------AMPIEIITDSGADLPQSYIREHRIAFLPLVVHWNGQDYKDGITIEPKQVYDAMRQGHTVKTAQP
3fysA           --------NIAVVTDSTAYIPKEMREQHQIHMIPLQVVFREETYREEIELDWKSFYEEVKKHNELPTTSQ
1vpvA           ----------------------------------------------------------------------
1pzxA           ---------IEIITDSGADLPQSYIREHRIAFLPLVVHWNGQDYKDGITIEPKQVYDAMRQGHTVKTAQP
1vpvB           ----------------------------------------------------------------------
1mgpA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           APEDLRKLYEALLXXXXXXXXXXXXXXXXXXXDTAKKVAQAFGERVKXXXXXXXXXXXXXXXXXXXXXXX
2dt8A           SPEDFARVYREALEEADHVLSLHISGKLSGTVQSAELAAQEFPGRVTVVDTQAASLGVGVLRAKELLEEG
1pzxB           SPLAMKELFLPYAKENRPCLYIAFSSKLSGTYQTAMAVRSELLDRLTIIDSKCASLGQGLAVMKAVELAK
3fysA           PPEELGKSYDAVISIHLSSGISGTFSSAAAADSMVDNIVYPFDSEISCLAQGFYALKAAELIKNGASSP-
1vpvA           ----------------------------------------------------------------------
1pzxA           SPLAMKELFLPYAKENRPCLYIAFSSKLSGTYQTAMAVRSELLDRLTIIDSKCASLGQGLAVMKAVELAK
1vpvB           ----------------------------------------------------------------------
1mgpA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           XXXXWEHLEEALAPYRERVRGYVLPATLDYLHRSGRIGGLQRFVGGLLRILPVLEVREGRVHPGPRVRGF
2dt8A           QSXXXXXXXXXXXXXDHFVRFSV--ATLEFLKRGGRIGGAQAFLGTLLNLKPVLTLKEGRVXXXXXXXXX
1pzxB           QNTPYNLLCETIESYCRHMEHIFTVDNLDYLARGGRISKTAAAFGGLLNIKPLLHVEDGALIPLEKWRGR
3fysA           -----EDIIKELEEMKKTVRAYFMVDDLAHLQRGGRLSSAQAFIGSLLKVKPILHFDNKVIVPFEKIRTR
1vpvA           -------IEEVLKKLDERFKAIFYVSNFDYLVKGGRV-----FVGNLLKIRVCLHIENGELIPYRKVRGD
1pzxA           QNTPYNLLCETIESYCRHMEHIFTVDNLDYLARGGRISNIK----------PLLHVEDGALIPLEKWRGR
1vpvB           -------IEEVLKKLDERFKAIFYVSNFDYLVKGGRV---------LLKIRVCLHIENGELIPYRKVRGD
1mgpA           -------IEEVLKKLDERFKAIFYVSNFDYLVKGGRV---------LLKIRVCLHIENGELIPYRKVRGD


                         .         .         .         +         .         .         .:280
query           AEGIRKVAALFRRDFLEEARVYLAHAENPXXXXXXXXXXXXXXVEVLGALPAGAAVSVHTGPGTVAAFAx
2dt8A           XXXXXXILKAFRAEGRKRIRAYFLYSGDEDAVAALRQEVLASGLPVEEALELGAVIASHTGPGTYGFYA-
1pzxB           KKVLKRMVELMRGDDLQKQTIGISHADDEETALELKQMIE----ETHGCTDIGSAIGAHAGPGTIALF--
3fysA           KKAISRIYELLDEDASKRAAVIHANREEEAAKIIEELSAKYPHVEFYNSY-FGAVIGTHLGEGAL-----
1vpvA           KKAIEALIEKLREDTPEKLRVIGVHADNEAGVVELLNTLRKSYEVVDEIISPGKVITTHVGPGTV-----
1pzxA           KKVLKRMVELMRGDDLQKQTIGISHADDEETALELKQMIE----ETHGCTDIGSAIGAHAGPGTIALF--
1vpvB           KKAIEALIEKLREDTPEKLRVIGVHADNEAGVVELLNTLRKSYEVVDEIISPGKVITTHVGPGTV-----
1mgpA           KKAIEALIEKLREDTPEKLRVIGVHADNEAGVVELLNTLRKSYEVVDEIISPGKVITTHVGPGTV-----


                         .         *         .         .         .         .         +:350
query           xxx
2dt8A           ---
1pzxB           ---
3fysA           ---
1vpvA           ---
1pzxA           ---
1vpvB           ---
1mgpA           ---