[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tthe0:AAS81022.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2ffhA.bssp"
#ERROR : Can't open dsspfile "2c04A.bssp"
#ERROR : Can't open dsspfile "2c03B.bssp"
#ERROR : Can't open dsspfile "1jpnA.bssp"
#ERROR : Can't open dsspfile "1jpnB.bssp"
#ERROR : Can't open dsspfile "2c03A.bssp"
#ERROR : Can't open dsspfile "1jpjA.bssp"
#ERROR : Can't open dsspfile "2ng1A.bssp"
#ERROR : Can't open dsspfile "2j7pA.bssp"
#ERROR : Can't open dsspfile "2j7pB.bssp"
#ERROR : Can't open dsspfile "1okkA.bssp"
#ERROR : Can't open dsspfile "1ls1A.bssp"
#ERROR : Can't open dsspfile "1rj9B.bssp"
#ERROR : Can't open dsspfile "1ffhA.bssp"
#ERROR : Can't open dsspfile "2j289.bssp"
#ERROR : Can't open dsspfile "3dm5A.bssp"
#ERROR : Can't open dsspfile "3dm5B.bssp"
#ERROR : Can't open dsspfile "1qzxA.bssp"
#ERROR : Can't open dsspfile "1qzwA.bssp"
#ERROR : Can't open dsspfile "2j37W.bssp"
#ERROR : Can't open dsspfile "2v3cD.bssp"
#ERROR : Can't open dsspfile "2v3cC.bssp"
#ERROR : Can't open dsspfile "2qy9A.bssp"
#ERROR : Can't open dsspfile "1ftsA.bssp"
#ERROR : Can't open dsspfile "1vmaA.bssp"
#ERROR : Can't open dsspfile "1okkD.bssp"
#ERROR : Can't open dsspfile "2j7pE.bssp"
#ERROR : Can't open dsspfile "2cnwF.bssp"
#ERROR : Can't open dsspfile "2q9bB.bssp"
#ERROR : Can't open dsspfile "2j7pD.bssp"
#ERROR : Can't open dsspfile "2q9aB.bssp"
#ERROR : Can't open dsspfile "2q9bA.bssp"
#ERROR : Can't open dsspfile "2q9aA.bssp"
#ERROR : Can't open dsspfile "2cnwE.bssp"
#ERROR : Can't open dsspfile "2cnwD.bssp"
#ERROR : Can't open dsspfile "1j8yF.bssp"
#ERROR : Can't open dsspfile "3dmdC.bssp"
#ERROR : Can't open dsspfile "3dmdA.bssp"
#ERROR : Can't open dsspfile "3dmdB.bssp"
#ERROR : Can't open dsspfile "1rj9A.bssp"
#ERROR : Can't open dsspfile "3b9qA.bssp"
#ERROR : Can't open dsspfile "2og2A.bssp"
#ERROR : Can't open dsspfile "3e70C.bssp"
#ERROR : Can't open dsspfile "2iylD.bssp"
#ERROR : Can't open dsspfile "3dm9B.bssp"
#ERROR : Can't open dsspfile "1j8mF.bssp"
#ERROR : Can't open dsspfile "1zu5B.bssp"
#ERROR : Can't open dsspfile "1zu5A.bssp"
#ERROR : Can't open dsspfile "1zu4A.bssp"
#ERROR : Can't open dsspfile "1hq1A.bssp"
#ERROR : Can't open dsspfile "1qb2B.bssp"
#ERROR : Can't open dsspfile "1qb2A.bssp"
#ERROR : Can't open dsspfile "1mfqC.bssp"
#ERROR : Can't open dsspfile "1dulA.bssp"
#ERROR : Can't open dsspfile "2jqeA.bssp"

## Summary of PDB Search
:434
    e-177  81%  2ffhA  [a.24.13 - c.37.1 - a.36.1] PROTEIN (FFH)
    e-128  80%  2c04A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    e-128  80%  2c03B  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    e-127  80%  1jpnA  [a.24.13 - c.37.1] SIGNAL RECOGNITION PARTICLE PROTEIN
    e-127  80%  1jpnB  [a.24.13 - c.37.1] SIGNAL RECOGNITION PARTICLE PROTEIN
    e-127  80%  2c03A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    e-126  80%  1jpjA  [a.24.13 - c.37.1] SIGNAL RECOGNITION PARTICLE PROTEIN
    e-126  80%  2ng1A  [x.x.x] SIGNAL SEQUENCE RECOGNITION PROTEIN FFH
    e-125  80%  2j7pA  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    e-124  80%  2j7pB  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    e-124  80%  1okkA  [a.24.13 - c.37.1] SIGNAL RECOGNITION PARTICLE PROTEIN
    e-122  80%  1ls1A  [a.24.13 - c.37.1] SIGNAL RECOGNITION PARTICLE PROTEIN
    e-120  80%  1rj9B  [a.24.13 - c.37.1] SIGNAL RECOGNITION PARTICLE PROTEIN
    e-120  80%  1ffhA  [x.x.x] FFH
    4e-91  44%  2j289  [x.x.x] SIGNAL RECOGNITION PARTICLE 54
    2e-59  33%  3dm5A  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    2e-57  34%  3dm5B  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    1e-55  36%  1qzxA  [a.24.13 - c.37.1 - a.36.1] SIGNAL RECOGNITION 54 KDA PROTEIN
    6e-54  37%  1qzwA  [a.24.13 - c.37.1 - a.36.1] SIGNAL RECOGNITION 54 KDA PROTEIN
    1e-53  32%  2j37W  [x.x.x] SIGNAL RECOGNITION PARTICLE 54 KDA PROTEIN
    5e-53  37%  2v3cD  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    5e-53  37%  2v3cC  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    9e-36  42%  2qy9A  [x.x.x] CELL DIVISION PROTEIN FTSY
    9e-36  42%  1ftsA  [x.x.x] FTSY
    1e-34  49%  1vmaA  [a.24.13 - c.37.1] CELL DIVISION PROTEIN FTSY
    7e-34  38%  1okkD  [a.24.13 - c.37.1] CELL DIVISION PROTEIN FTSY
    7e-34  38%  2j7pE  [x.x.x] CELL DIVISION PROTEIN FTSY
    7e-34  38%  2cnwF  [x.x.x] CELL DIVISION PROTEIN FTSY
    1e-33  38%  2q9bB  [x.x.x] CELL DIVISION PROTEIN FTSY
    1e-33  40%  2j7pD  [x.x.x] CELL DIVISION PROTEIN FTSY
    2e-33  39%  2q9aB  [x.x.x] CELL DIVISION PROTEIN FTSY
    4e-33  41%  2q9bA  [x.x.x] CELL DIVISION PROTEIN FTSY
    4e-33  41%  2q9aA  [x.x.x] CELL DIVISION PROTEIN FTSY
    4e-33  41%  2cnwE  [x.x.x] CELL DIVISION PROTEIN FTSY
    4e-33  41%  2cnwD  [x.x.x] CELL DIVISION PROTEIN FTSY
    2e-32  35%  1j8yF  [a.24.13 - c.37.1] SIGNAL RECOGNITION 54 KDA PROTEIN
    2e-32  35%  3dmdC  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    2e-32  35%  3dmdA  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    2e-32  35%  3dmdB  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    4e-32  40%  1rj9A  [a.24.13 - c.37.1] SIGNAL RECOGNITION PROTEIN
    4e-32  39%  3b9qA  [x.x.x] CHLOROPLAST SRP RECEPTOR HOMOLOG, ALPHA SUBUNIT
    5e-32  40%  2og2A  [x.x.x] PUTATIVE SIGNAL RECOGNITION PARTICLE RECEPTOR
    2e-31  38%  3e70C  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    9e-31  37%  2iylD  [x.x.x] CELL DIVISION PROTEIN FTSY
    1e-29  34%  3dm9B  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    2e-26  30%  1j8mF  [a.24.13 - c.37.1] SIGNAL RECOGNITION 54 KDA PROTEIN
    4e-25  37%  1zu5B  [x.x.x] FTSY
    4e-25  37%  1zu5A  [x.x.x] FTSY
    4e-25  37%  1zu4A  [x.x.x] FTSY
    7e-14  49%  1hq1A  [a.36.1] SIGNAL RECOGNITION PARTICLE PROTEIN
    2e-08  29%  1qb2B  [a.36.1] HUMAN SIGNAL RECOGNITION PARTICLE 54 KD PROTEIN
    1e-07  32%  1qb2A  [a.36.1] HUMAN SIGNAL RECOGNITION PARTICLE 54 KD PROTEIN
    1e-07  29%  1mfqC  [a.36.1] SIGNAL RECOGNITION PARTICLE 54KDA PROTEIN
    9e-07  56%  1dulA  [a.36.1] SIGNAL RECOGNITION PARTICLE PROTEIN (FIFTY-FOUR
    1e-05  28%  2jqeA  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
:434

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MFQQLAARLQEAIDRLRGRGRITEEDLKGTLREIRRALIEADVNLXXXXXXXXXXXXXXLGRKVLESLTP
2ffhA           MFQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVTRDFVERVREEALGKQVLESLTP
2c04A           MFQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVARDFVERVREEALGKQVLESLTP
2c03B           MFQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVTRDFVERVREEALGKQVLESLTP
1jpnA           MFQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVARDFVERVREEALGKQVLESLTP
1jpnB           MFQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVARDFVERVREEALGKQVLESLTP
2c03A           MFQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVTRDFVERVREEALGKQVLESLTP
1jpjA           MFQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVARDFVERVREEALGKQVLESLTP
2ng1A           -FQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVTRDFVERVREEALGKQVLESLTP
2j7pA           --QQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVARDFVERVREEALGKQVLESLTP
2j7pB           ---QLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVARDFVERVREEALGKQVLESLTP
1okkA           ---QLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVARDFVERVREEALGKQVLESLTP
1ls1A           MFQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVARDFVERVREEALGKQVLESLTP
1rj9B           --------------RLRGRGRITEEDLKATLREIRRALMDADVNLEVTRDFVERVREEALGKQVLESLTP
1ffhA           -FQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVTRDFVERVREEALGKQVLESLTP
2j289           -FDNLTDRLSRTLRNISGRGRLTEDNVKDTLREVRMALLEADVALPVVREFINRVKEKAVGHEVNKSLTP
3dm5A           VLDNLGKALANTLKKIARASSVDEALIKELVRDIQRALIQADVNVRLVLQLTREIQRRALEEKPPAGISK
3dm5B           VLDNLGKALANTLKKIARASSVDEALIKELVRDIQRALIQADVNVRLVLQLTREIQRRALEEKPPAGISK
1qzxA           ------------------------------IKDLQKSLISSDVNVKLVFSLTAKIKERLNKEKPPSVLER
1qzwA           ------------------------------IKDLQKSLISSDVNVKLVFSLTAKIKERLNKEKPPSVLER
2j37W           -------KITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNK
2v3cD           --------------------------IKEVIKDIQRALIQADVNVKLVLKMSKEIERRALEEKTPKGLSK
2v3cC           --------------------------IKEVIKDIQRALIQADVNVKLVLKMSKEIERRALEEKTPKGLSK
2qy9A           ----------------------------------------------------------------------
1ftsA           ----------------------------------------------------------------------
1vmaA           ----------------------------------------------------------------------
1okkD           ----------------------------------------------------------------------
2j7pE           ----------------------------------------------------------------------
2cnwF           ----------------------------------------------------------------------
2q9bB           ----------------------------------------------------------------------
2j7pD           ----------------------------------------------------------------------
2q9aB           ----------------------------------------------------------------------
2q9bA           ----------------------------------------------------------------------
2q9aA           ----------------------------------------------------------------------
2cnwE           ----------------------------------------------------------------------
2cnwD           ----------------------------------------------------------------------
1j8yF           ------------------------------IKELQKSLISADVNVKLVFSLTNKIKERLKNEKPPTYIER
3dmdC           -----------------------------------------------------------VGKKVRIGTDK
3dmdA           -----------------------------------------------------------VGKKVRIGTDK
3dmdB           -----------------------------------------------------------VGKKVRIGTDK
1rj9A           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
2og2A           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
2iylD           ------------------------------------------------------------GRKDLKEAVK
3dm9B           -----------------------------------------------------------VGKKVRIGTDK
1j8mF           ------------------------------IKELQKSLISADVNVKLVFSLTNKIKERLKNEKPPTYIER
1zu5B           ----------------------------------------------------------------------
1zu5A           ----------------------------------------------------------------------
1zu4A           ----------------------------------------------------------------------
1hq1A           ----------------------------------------------------------------------
1qb2B           ----------------------------------------------------------------------
1qb2A           ----------------------------------------------------------------------
1mfqC           ----------------------------------------------------------------------
1dulA           ----------------------------------------------------------------------
2jqeA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           AEVVLATVYEALKEALGGEPKHPQLKDRNVWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPA
2ffhA           AEVILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPA
2c04A           AEVILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPA
2c03B           AEVILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPA
1jpnA           AEVILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPA
1jpnB           AEVILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPA
2c03A           AEVILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPA
1jpjA           AEVILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPA
2ng1A           AEVILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPA
2j7pA           AEVILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPA
2j7pB           AEVILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPA
1okkA           AEVILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPA
1ls1A           AEVILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPA
1rj9B           AEVILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPA
1ffhA           AEVILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPA
2j289           GQEFVKIVRNELVAAMGEENQTLNLAAQPVVLMAGLQGAGKTTSVGKLGKFLREKHKKKVLVSADVYRPA
3dm5A           KEHIIKIVYEELTKFLGTEAKPIEIKEKTILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVVCSDTWRPG
3dm5B           KEHIIKIVYEELTKFLGTEAKPIEIKEKTILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVVCSDTWRPG
1qzxA           KEWFISIVYDELSKLFGGD-KEPNVNPTKLPFLVGVQGSGKTTTAGKLAYFYKKRGYKVGLVAADVYRPA
1qzwA           KEWFISIVYDELSKLFGGD-KEPNVNPTKLPFLVGVQGSGKTTTAGKLAYFYKKRGYKVGLVAADVYRPA
2j37W           RKMIQHAVFKELVKLVDPGVKAWTPTKGNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTFRAG
2v3cD           KEHIIKIVYXXXXXXXXXXXXXXXXKKQNVILLVGIQGSGKTTTAAKLARYIQKRGLKPALIAADTYRPA
2v3cC           KEHIIKIVYXXXXXXXXXXXXXXXXKKQNVILLVGIQGSGKTTTAAKLARYIQKRGLKPALIAADTYRPA
2qy9A           -------LYGLLKEEMGDEPLNVEGKAPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAA
1ftsA           -------LYGLLKEEMGDEPLNVEGKAPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAA
1vmaA           -----------------------------VIMVVGVNGTGKTTSCGKLAKMFVDEGKSVVLAAADTFRAA
1okkD           ---------EAVKEKLVGMLEPPVEPKXXXXXXXXXXXXXKTTTIAKLGRYYQNLGKKVMFCAGDTFRAA
2j7pE           ---------EAVKEKLVGMLEPPVEPKXXXXXXXXXXXXXKTTTIAKLGRYYQNLGKKVMFCAGDTFRAA
2cnwF           ---------EAVKEKLVGMLEPPVEPKXXXXXXXXXXXXXKTTTIAKLGRYYQNLGKKVMFCAGDTFRAA
2q9bB           -EVRASGLKEAVKEKLVGEPDKPKPVEPKXXXXXXXXXXXKTTTIAKLGRYYQNLGKKVMFCAGDTFRAA
2j7pD           ---------EAVKEKLVGEPKPVEPKXXXXXXXXXXXXX-KTTTIAKLGRYYQNLGKKVMFCAGDTFRAA
2q9aB           ---------EAVKEKLVGEPDKPKPVEPKXXXXXXXXXXXKTTTIAKLGRYYQNLGKKVMFCAGDTFRAA
2q9bA           ----------------------------------------KTTTIAKLGRYYQNLGKKVMFCAGDTFRAA
2q9aA           ----------------------------------------KTTTIAKLGRYYQNLGKKVMFCAGDTFRAA
2cnwE           ----------------------------------------KTTTIAKLGRYYQNLGKKVMFCAGDTFRAA
2cnwD           ----------------------------------------KTTTIAKLGRYYQNLGKKVMFCAGDTFRAA
1j8yF           REWFIKIVYDELSNLFGGDKEPKVIPDKYVIMLVGVQG----TTAGKLAYFYKKKGFKVGLVGADVYRPA
3dmdC           GKIIEEAVKEAVSEILETSRRIDLIEEIRVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAG
3dmdA           GKIIEEAVKEAVSEILETSRRIDLIEEIRVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAG
3dmdB           GKIIEEAVKEAVSEILETSRRIDLIEEIRVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAG
1rj9A           ----------------------------------------KTTTIAKLGRYYQNLGKKVMFCAGDTFRAA
3b9qA           ---------ESVLEMLAKSKTELQLGFRKVIMIVGVNGGGKTTSLGKLAHRLKNEGTKVLMAAGDTFRAA
2og2A           -----------------------------VIMIVGVNGGGKTTSLGKLAHRLKNEGTKVLMAAGDTFRAA
3e70C           -----------------------------VIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAG
2iylD           EKLVGMLEPDATLRKLGFNPQKPVEPKXXXXXXXXXXXXXKTTTIAKLGRYYQNLGKKVMFCAGDTT---
3dm9B           GKIIEEAVKEAVSEILETSRRIDLIEEKPYVIFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAG
1j8mF           REWFIKIVYDELSNLFGGDKEPKVIPDKIPYVIMXXXXXXXXXXXXXXXXFYKKKGFKVGLVGADVYRPA
1zu5B           ----------------------------NIFMLVGVNGTGKTTSLAKMANYYAELGYKVLIAAADTFRAG
1zu5A           ----------------------------NIFMLVGVNGTGKTTSLAKMANYYAELGYKVLIAAADTFRAG
1zu4A           ----------------------------NIFMLVGVNGTGKTTSLAKMANYYAELGYKVLIAAADTFRAG
1hq1A           ----------------------------------------------------------------------
1qb2B           ----------------------------------------------------------------------
1qb2A           ----------------------------------------------------------------------
1mfqC           ----------------------------------------------------------------------
1dulA           ----------------------------------------------------------------------
2jqeA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AREQLRVLGEKVGVPVLEVQDGESPESIXXXXXXXXXXXXXXXXXXXTAGRLQIDERLMEELVRLKAALR
2ffhA           AREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVLG
2c04A           AREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVLG
2c03B           AREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVLG
1jpnA           AREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVLG
1jpnB           AREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVLG
2c03A           AREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVLG
1jpjA           AREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVLG
2ng1A           AREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVLG
2j7pA           AREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVLG
2j7pB           AREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVLG
1okkA           AREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVLG
1ls1A           AREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVLG
1rj9B           AREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVLG
1ffhA           AREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVLG
2j289           AIKQLETLAEQVGVDFFPSDVGQKPVDIVNAALKEAKLKFYDVLLVDTAGRLHVDEAMMDEIKQVHASIN
3dm5A           AYHQLRQLLDRYHIEVFGNPQEKDAIKLAKEGVDYFKSKGVDIIIVDTAGRHKEDKALIEEMKQISNVIH
3dm5B           AYHQLRQLLDRYHIEVFGNPQEKDAIKLAKEGVDYFKSKGVDIIIVDTAGRHKEDKALIE-MKQISNVIH
1qzxA           AYDQLLQLGNQIGVQVYGEPNNQNPIEIAKKGVDIFVKNKMDIIIVDTAGRHGYGXXXXXXXXXXXXVLK
1qzwA           AYDQLLQLGNQIGVQVYGEPNNQNPIEIAKKGVDIFVKNKMDIIIVDTAGRHGYGXXXXXXXXXXXXVLK
2j37W           AFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQ
2v3cD           AYEQLKQLAEKIHVPIYG-DETRTKSPVDIVKEGMEKFKKADVLIIDTAGRHKEEKGLLEEMKQIKEITN
2v3cC           AYEQLKQLAEKIHVPIYG-DETRTKSPVDIVKEGMEKFKKADVLIIDTAGRHKEEKGLLEEMKQIKEITN
2qy9A           AVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKARNIDVLIADTAGRLQNKSHLMEELKKIVRVMK
1ftsA           AVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKARNIDVLIADTAGRLQNKSHLMEELKKIVRVMK
1vmaA           AIEQLKIWGERVGATVISHSEGXXXXXXXXXXXXXXXXRNKDVVIIDTAGRLHTKKNLMEELVKKKIPDA
1okkD           GGTQLSEWGKRLSIPVIQGPEGTDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAIE
2j7pE           GGTQLSEWGKRLSIPVIQGPEGTDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAIE
2cnwF           GGTQLSEWGKRLSIPVIQGPEGTDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAIE
2q9bB           GGTQLSEWGKRLSIPVIQGPEGTDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAIE
2j7pD           GGTQLSEWGKRLSIPVIQGPEGTDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAIE
2q9aB           GGTQLSEWGKRLSIPVIQGPEGTDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAIE
2q9bA           GGTQLSEWGKRLSIPVIQGPEGTDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAIE
2q9aA           GGTQLSEWGKRLSIPVIQGPEGTDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAIE
2cnwE           GGTQLSEWGKRLSIPVIQGPEGTDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAIE
2cnwD           GGTQLSEWGKRLSIPVIQGPEGTDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAIE
1j8yF           AXXXXXXXXXXIGVPVYGEPGEKDVVGIAKRGVEKFLSEKMEIIIVDTAGRHGYGEELLEEMKNIYEAIK
3dmdC           AIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVTK
3dmdA           AIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVTK
3dmdB           AIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVTK
1rj9A           GGTQLSEWGKRLSIPVIQGPEGTDSAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAIE
3b9qA           ASDQLEIWAERTGCEIVVAEKAKAA-TVLSKAVKRGKEEGYDVVLCDTSGRLHTNYSLMEELIACKKAVA
2og2A           ASDQLEIWAERTGCEIVVAEDKAKAATVLSKAVKRGKEEGYDVVLCDTSGRLHTNYSLMEELIACKKAVA
3e70C           AIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVTK
2iylD           ---QLSEWGKRLSIPVIQGPEGTDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAIE
3dm9B           AIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNLDEK--KIARVTK
1j8mF           AXXXXXXXXXXIGVPVYGEPGEKDVVGIAKRGVEKFLSEKMEIIIVDTAGRHGYGEELLEEMKNIYEAIK
1zu5B           ATQQLEELNNKVDLVKANKLNAD-PASVVFDAIKKAKEQNYDLLLIDTAGRLQNKTNLMAELEKMNKIIQ
1zu5A           ATQQLEELNNKVDLVKANKLNAD-PASVVFDAIKKAKEQNYDLLLIDTAGRLQNKTNLMAELEKMNKIIQ
1zu4A           ATQQLEELNNKVDLVKANKLNAD-PASVVFDAIKKAKEQNYDLLLIDTAGRLQNKTNLMAELEKMNKIIQ
1hq1A           ----------------------------------------------------------------------
1qb2B           ----------------------------------------------------------------------
1qb2A           ----------------------------------------------------------------------
1mfqC           ----------------------------------------------------------------------
1dulA           ----------------------------------------------------------------------
2jqeA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           PDEVLLVLDAMTGQEALSVAQAFDERVGVTGLVLTKLDGDARGGAALSARRVTGKPIYFAGVSERPEGLE
2ffhA           PDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGLE
2c04A           PDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGLE
2c03B           PDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGLE
1jpnA           PDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGLE
1jpnB           PDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGLE
2c03A           PDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGLE
1jpjA           PDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGLE
2ng1A           PDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGLE
2j7pA           PDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGLE
2j7pB           PDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGLE
1okkA           PDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGLE
1ls1A           PDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAG------GLE
1rj9B           PDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGLE
1ffhA           PDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFA-------GLE
2j289           PVETLFVVDAMTGQDAANTAKAFNEALPLTGVVLTKVDGDARGGAALSIRHITGKPIKFLGVGEKTEALE
3dm5A           PHEVILVIDGTIGQQAYNQALAFKEATPIGSIIVTKLDGSAKGGGALSAVAATGAPIKFIGTGEKIDDIE
3dm5B           PHEVILVIDGTIGQQAYNQALAFKEATPIGSIIVTKLDGSAKGGGALSAVAATGAPIKFIGTGEKIDDIE
1qzxA           PDDVILVIDASIGQKAYDLASRFHQASPIGSVIITKMDGTAKGGGALSAVVATGATIKFIGTGEKIDELE
1qzwA           PDDVILVIDASIGQKAYDLASRFHQASPIGSVIITKMDGTAKGGGALSAVVATGATIKFIGTGEKIDELE
2j37W           PDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFE
2v3cD           PDEIILVIDGTIGQQAGIQAKAFKEAVGEIGIIVTKLDGSAKGGGALSAVAETKAPIKFIGIGEGIDDLE
2v3cC           PDEIILVIDGTIGQQAGIQAKAFKEAVGEIGIIVTKLDGSAKGGGALSAVAETKAPIKFIGIGEGIDDLE
2qy9A           PHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLR
1ftsA           PHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLR
1vmaA           PHETLLVIDATTGQNGLVQAKIFKEAVNVTGIILTKLDGTAKGGITLAIARELGIPIKFIGVGEKAEDLR
1okkD           PKEVWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDLQ
2j7pE           PKEVWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDLQ
2cnwF           PKEVWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDLQ
2q9bB           PKEVWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDLQ
2j7pD           PKEVWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDLQ
2q9aB           PKEVWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDLQ
2q9bA           PKEVWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDLQ
2q9aA           PKEVWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDLQ
2cnwE           PKEVWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDLQ
2cnwD           PKEVWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDLQ
1j8yF           PDEVTLVIDASIGQKAYDLASKFNQASKIGTIIITKMDGTAKGGGALSAVAATGATIKFIGTGEKIDELE
3dmdC           PNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGYDDLR
3dmdA           PNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGYDDLR
3dmdB           PNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGYDDLR
1rj9A           PKEVWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDLQ
3b9qA           PNEILLVLDGNTGLNMLPQAREFNEVVGITGLILTKLDGSARGGCVVSVVEELGIPVKFIGVGEAVEDLQ
2og2A           PNEILLVLDGNTGLNMLPQAREFNEVVGITGLILTKLDGSARGGCVVSVVEELGIPVKFIGVGEAVEDLQ
3e70C           PNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGYDDLR
2iylD           PKEVWLVLDAVTGQ--LEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDLQ
3dm9B           PNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGYDDLR
1j8mF           PDEVTLVIDASIGQKAYDLASKFNQASKIGTIIITKMDGTAKGGGALSAVAATGATIKFIGTGEKIDELE
1zu5B           PHEVLLVIDATTGQNGVIQAEEFSKVADVSGIILTKMDSTSKGGIGLAIKELLNIPIKMIGVGEKVDDLL
1zu5A           PHEVLLVIDATTGQNGVIQAEEFSKVADVSGIILTKMDSTSKGGIGLAIKELLNIPIKMIGVGEKVDDLL
1zu4A           PHEVLLVIDATTGQNGVIQAEEFSKVADVSGIILTKMDSTSKGGIGLAIKELLNIPIKMIGVGEKVDDLL
1hq1A           ----------------------------------------------------------------------
1qb2B           ----------------------------------------------------------------------
1qb2A           ----------------------------------------------------------------------
1mfqC           ----------------------------------------------------------------------
1dulA           ----------------------------------------------------------------------
2jqeA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           PFYPDRLAGRILGMGDVATLAEKVRQAGLEAEAPKSAKELTLEDFLKQMQNLKRLGSFSELLKLLPGVGR
2ffhA           PFYPERLAGRILGMGDVASLAEKVR-----------AAELSLEDFLKQMQNLKRLGPFSEILGLLPGV--
2c04A           PFYPERLAGRILGMGDV-----------------------------------------------------
2c03B           PFYPERLAGRILGMGDV-----------------------------------------------------
1jpnA           PFYPERLAGRILGMGD------------------------------------------------------
1jpnB           PFYPERLAGRILGMG-------------------------------------------------------
2c03A           PFYPERLAGRILGMG-------------------------------------------------------
1jpjA           PFYPERLAGRILGM--------------------------------------------------------
2ng1A           PFYPERLAGRILGM--------------------------------------------------------
2j7pA           PFYPERLAGRILGM--------------------------------------------------------
2j7pB           PFYPERLAGRILGM--------------------------------------------------------
1okkA           PFYPERLAGRILG---------------------------------------------------------
1ls1A           PFYPERLAGRILGMG-------------------------------------------------------
1rj9B           PFYPERLAGRILGMG-------------------------------------------------------
1ffhA           PFYPERLAGRILGMG-------------------------------------------------------
2j289           PFHPDRIASRILGMGDVLSLIEDIESKVDRAQAEKLASKLDLNDFLEQLRQMKNMGGMASLMGKLPGMGQ
3dm5A           PFDPPRFVSRLLGLGDIQGXXXXXXXXXXXXXXXXXXXKFTLKDMYAQLEAMRKMGPIS-----------
3dm5B           PFDPPRFVSRLLGLGDIQGXXXXXXXXXXXXXXXXXXXKFTLKDMYAQLEAMRKMG---------PSIG-
1qzxA           TFNAKRFVSRILGMGDIESILEKVKGLEEYDKIQKKMEDLTLRDVYAQIIALRKMGPLSKVLQHIPGLGI
1qzwA           TFNAKRFVSRILGMGDIESILEKVK--GLEEDVMEGKGKLTLRDVYAQIIALRKMGPLSKVLQHIPGLGI
2j37W           PFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEALIEKQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGT
2v3cD           PFDPKKFISRLLGMGDLESLLEK-------------AEDMVDEKTEESIDAIMR-GKFNELMTQL-----
2v3cC           PFDPKKFISRLLGMGDLESLLEK-------------AEDMVDEKTEESIDAIMR-GKFNELMTQLEAIEN
2qy9A           PFKAD-----------------------------------------------------------------
1ftsA           PFKAD-----------------------------------------------------------------
1vmaA           PFDPE-----------------------------------------------------------------
1okkD           PFDPEAFVEALL----------------------------------------------------------
2j7pE           PFDPEAFVEALL----------------------------------------------------------
2cnwF           PFDPEAFVEALL----------------------------------------------------------
2q9bB           PFDPEAFVEALL----------------------------------------------------------
2j7pD           PFDPEAFVEALL----------------------------------------------------------
2q9aB           PFDPEAFVEALL----------------------------------------------------------
2q9bA           PFDPEAFVEALL----------------------------------------------------------
2q9aA           PFDPEAFVEALL----------------------------------------------------------
2cnwE           PFDPEAFVEALL----------------------------------------------------------
2cnwD           PFDPEAFVEALL----------------------------------------------------------
1j8yF           VFNPRRFVARL-----------------------------------------------------------
3dmdC           PFEKEWFLERIFG---------------------------------------------------------
3dmdA           PFEKEWFLERIFG---------------------------------------------------------
3dmdB           PFEKEWFLERIFG---------------------------------------------------------
1rj9A           PFDPEAFVEALL----------------------------------------------------------
3b9qA           PFDPEAFVNAI-----------------------------------------------------------
2og2A           PFDPEAFVNAI-----------------------------------------------------------
3e70C           PFEKEWFLERIFG---------------------------------------------------------
2iylD           PFDPEAFVEALL----------------------------------------------------------
3dm9B           PFEKEWFLERIFG---------------------------------------------------------
1j8mF           VFNPRRFVARL-----------------------------------------------------------
1zu5B           AFDIDQ----------------------------------------------------------------
1zu5A           AFDIDQ----------------------------------------------------------------
1zu4A           AFDIDQ----------------------------------------------------------------
1hq1A           ----------------------------------------------------------------------
1qb2B           --------------------------------------QFTLRDMYEQFQNIMKMGPFSQILGMIPGFGT
1qb2A           --------------------------------------QFTLRDMYEQFQNIMKMGPFSQILGMIPGFGT
1mfqC           --------------------------------------QFTLRDMYEQFQNIMKMGPFSQILGMIPGFNE
1dulA           ----------------------------------------------------------------------
2jqeA           ----------------------------------------TLKDIYKQIEAMNKMGPVRKIFEMLPGLGL


                         .         .         .         .         *         .         .:420
query           ALPQGFQVDERAFKRLEAIVLSMTPEERKDPRILNASRRRRIAKGSGTTVQEVNRLVKAFEETKALMKSL
2ffhA           --PQGLKVDEKAIKRLEAIVLSMTPEERKDPRILNGSRRKRIAKGSGTSVQEVNRFIKAFEEMKALMKSL
2c04A           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
1jpnA           ----------------------------------------------------------------------
1jpnB           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
1jpjA           ----------------------------------------------------------------------
2ng1A           ----------------------------------------------------------------------
2j7pA           ----------------------------------------------------------------------
2j7pB           ----------------------------------------------------------------------
1okkA           ----------------------------------------------------------------------
1ls1A           ----------------------------------------------------------------------
1rj9B           ----------------------------------------------------------------------
1ffhA           ----------------------------------------------------------------------
2j289           -IPDNVQMDDKVLVRMEAIINSMTMKERAKPEIIKGSRKRRIAAGCGMQVQDVNRLLKQFDDMQRMMKKM
3dm5A           -------IGEERLKKFKVIMDSMTEEELLNPEIINYSRIKRIARGSGTSTKDVKELLDQYRQMKKLFKSM
3dm5B           ---------EERLKKFKVIMDSMTEEELLNPEIINYSRIKRIARGSGTSTKDVKELLDQYRQMKKLFKSM
1qzxA           MLPDQLKIGEEKIRRWLAALNSMTYKELENPNIIDKSRMRRIAEGSG-----------------------
1qzwA           MLPDQLKIGEEKIRRWLAALNSMTYKELENPNIIDKSRMRRIAEGSG-----------------------
2j37W           FMSKGNEQESMALKKLMTIMDSMNDQETDGAKVFSPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVK--
2v3cD           ---EAIELTEAKIKKYKVIISSMTKEERENPXXXXXXXXXXXXXXXXTTENDVREVLRYYETTKNAIDKL
2v3cC           ML------TEAKIKKYKVIISSMTKEERENPXXXXXXXXXXXXXXXXTTENDVREVLRYYETTKNAIDKL
2qy9A           ----------------------------------------------------------------------
1ftsA           ----------------------------------------------------------------------
1vmaA           ----------------------------------------------------------------------
1okkD           ----------------------------------------------------------------------
2j7pE           ----------------------------------------------------------------------
2cnwF           ----------------------------------------------------------------------
2q9bB           ----------------------------------------------------------------------
2j7pD           ----------------------------------------------------------------------
2q9aB           ----------------------------------------------------------------------
2q9bA           ----------------------------------------------------------------------
2q9aA           ----------------------------------------------------------------------
2cnwE           ----------------------------------------------------------------------
2cnwD           ----------------------------------------------------------------------
1j8yF           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
1rj9A           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
2og2A           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
2iylD           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
1j8mF           ----------------------------------------------------------------------
1zu5B           ----------------------------------------------------------------------
1zu5A           ----------------------------------------------------------------------
1zu4A           ----------------------------------------------------------------------
1hq1A           --------DDKVLVRMEAIINSMTMKERAKPEIIKGSRKRRIAAGSGMQVQDVNRLLKQFDDMQRMMKKM
1qb2B           FMSKGNEQESMALKKLMTIMDSMNDQETDGAKVFSPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKM
1qb2A           FMSKGNEQESMALKKLMTIMDSMNDQETDGAKVFSPGRIQRVARGSGVSTRDVQELLTQY----------
1mfqC           ------QESMARLKKLMTIMDSMNDQETDGAKVFSPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKM
1dulA           ----------------EAIINST--KERAKPEIIKGSRKRRIAAGSG-QVQDVNRLLKQFDDQR------
2jqeA           KVDNDMEMTQEKMKKFRVIMDSMTEEELLNPKXXXXXXXXXXXXXXGTSPQEVKELL-------------


                         .         .         +         .         .         .         .:490
query           ERRKGRGLMGMFRx
2ffhA           EK------------
2c04A           --------------
2c03B           --------------
1jpnA           --------------
1jpnB           --------------
2c03A           --------------
1jpjA           --------------
2ng1A           --------------
2j7pA           --------------
2j7pB           --------------
1okkA           --------------
1ls1A           --------------
1rj9B           --------------
1ffhA           --------------
2j289           K-------------
3dm5A           NKRQ----------
3dm5B           NKRQ----------
1qzxA           --------------
1qzwA           --------------
2j37W           ---KMGGIKGLFK-
2v3cD           --------------
2v3cC           --------------
2qy9A           --------------
1ftsA           --------------
1vmaA           --------------
1okkD           --------------
2j7pE           --------------
2cnwF           --------------
2q9bB           --------------
2j7pD           --------------
2q9aB           --------------
2q9bA           --------------
2q9aA           --------------
2cnwE           --------------
2cnwD           --------------
1j8yF           --------------
3dmdC           --------------
3dmdA           --------------
3dmdB           --------------
1rj9A           --------------
3b9qA           --------------
2og2A           --------------
3e70C           --------------
2iylD           --------------
3dm9B           --------------
1j8mF           --------------
1zu5B           --------------
1zu5A           --------------
1zu4A           --------------
1hq1A           K-------------
1qb2B           --------------
1qb2A           --------------
1mfqC           --------------
1dulA           --------------
2jqeA           --------------