[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tthe0:AAS81035.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3bppA.bssp"
#ERROR : Can't open dsspfile "2deoB.bssp"
#ERROR : Can't open dsspfile "2deoA.bssp"

## Summary of PDB Search
:433
    7e-15  32%  3bppA  [x.x.x] 1510-N MEMBRANE PROTEASE
    2e-08  38%  2deoB  [x.x.x] 441AA LONG HYPOTHETICAL NFED PROTEIN
    2e-08  38%  2deoA  [x.x.x] 441AA LONG HYPOTHETICAL NFED PROTEIN
:433

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxYLVPIEGEIDPALAVFVEQALARAEREGASGVAFLIDT
3bppA           --------------------------------YVAQIKGQITSYTYDQFDRYITIAEQDNAEAIIIELDT
2deoB           --------------------------------YVAQIKGQITSYTYDQFDRYITIAEQDNAEAIIIELDT
2deoA           --------------------------------YVAQIKGQITSYTYDQFDRYITIAEQDNAEAIIIELDT


                         .         .         *         .         .         .         .:140
query           PGGRVDAAIRISDRILQTPLPTLAVVQNAFSAGALIALSCRQIVMLPGSEIGAALPVVALPLQEPQAADQ
3bppA           PGGRADAMMNIVQRIQQSKIPVIIYVASAASAGTYIALGSHLIAMAPGTSIGACRPILGYSIEAPPAITN
2deoB           PGGRADA--NIVQRIQQSKIPVIIYVASAASAGTYIALG-SHLIAAPGTSIGA-----------------
2deoA           PGGRADA--NIVQRIQQSKIPVIIYVASAASAGTYIALG-SHLIAAPGTSIGA-----------------


                         +         .         .         .         .         *         .:210
query           KVISALKGKFRAVAEARGRPVELAEAMVDPNLEVPGLSAKGEPLTLSADKAVELKVADLKAASLYEALQx
3bppA           YFIAYIK----SLAQESGRNATIAEEFIT------------KDLSLTPEEALKYGVIEVVARDINELLK-
2deoB           ----------------------------------------------------------------------
2deoA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3bppA           ----------------------------------------------------------------------
2deoB           ----------------------------------------------------------------------
2deoA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3bppA           ----------------------------------------------------------------------
2deoB           ----------------------------------------------------------------------
2deoA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3bppA           ----------------------------------------------------------------------
2deoB           ----------------------------------------------------------------------
2deoA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxx
3bppA           -------------
2deoB           -------------
2deoA           -------------