[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tthe0:AAS81141.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2oukB.bssp"
#ERROR : Can't open dsspfile "2oljA.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "2yyzA.bssp"
#ERROR : Can't open dsspfile "2it1B.bssp"
#ERROR : Can't open dsspfile "2it1A.bssp"
#ERROR : Can't open dsspfile "1g291.bssp"
#ERROR : Can't open dsspfile "1l2tB.bssp"
#ERROR : Can't open dsspfile "1l2tA.bssp"
#ERROR : Can't open dsspfile "2pcjA.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "1f3oA.bssp"
#ERROR : Can't open dsspfile "1q12A.bssp"
#ERROR : Can't open dsspfile "3fh6A.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "2r6gB.bssp"
#ERROR : Can't open dsspfile "2r6gA.bssp"
#ERROR : Can't open dsspfile "1z47B.bssp"
#ERROR : Can't open dsspfile "1z47A.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "1mt0A.bssp"
#ERROR : Can't open dsspfile "2ff7A.bssp"
#ERROR : Can't open dsspfile "2fgkA.bssp"
#ERROR : Can't open dsspfile "2ffbA.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "3g60A.bssp"
#ERROR : Can't open dsspfile "3g5uA.bssp"
#ERROR : Can't open dsspfile "1oxvA.bssp"
#ERROR : Can't open dsspfile "1oxsC.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "1v43A.bssp"
#ERROR : Can't open dsspfile "1xefA.bssp"
#ERROR : Can't open dsspfile "2ffaA.bssp"
#ERROR : Can't open dsspfile "2onkA.bssp"
#ERROR : Can't open dsspfile "3fvqB.bssp"
#ERROR : Can't open dsspfile "3fvqA.bssp"
#ERROR : Can't open dsspfile "1g9xA.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1gajA.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "2hydA.bssp"
#ERROR : Can't open dsspfile "3gfoA.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "1pf4A.bssp"
#ERROR : Can't open dsspfile "1oxxK.bssp"
#ERROR : Can't open dsspfile "1mv5D.bssp"
#ERROR : Can't open dsspfile "1mv5A.bssp"
#ERROR : Can't open dsspfile "2yz2B.bssp"
#ERROR : Can't open dsspfile "2yz2A.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "1jj7A.bssp"
#ERROR : Can't open dsspfile "2ixfC.bssp"
#ERROR : Can't open dsspfile "2ixfA.bssp"
#ERROR : Can't open dsspfile "2ixeD.bssp"
#ERROR : Can't open dsspfile "2ixfD.bssp"
#ERROR : Can't open dsspfile "2ghiA.bssp"
#ERROR : Can't open dsspfile "2ixeA.bssp"
#ERROR : Can't open dsspfile "2ghiC.bssp"
#ERROR : Can't open dsspfile "2nq2D.bssp"
#ERROR : Can't open dsspfile "2nq2C.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "2ixgA.bssp"
#ERROR : Can't open dsspfile "2ghiB.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "2zu0C.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "2ghiD.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "1z2rA.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "2ihyB.bssp"
#ERROR : Can't open dsspfile "1yqtA.bssp"
#ERROR : Can't open dsspfile "2r6fB.bssp"
#ERROR : Can't open dsspfile "2r6fA.bssp"
#ERROR : Can't open dsspfile "2ihyA.bssp"
#ERROR : Can't open dsspfile "2pjzA.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "2qi9C.bssp"
#ERROR : Can't open dsspfile "2ix3A.bssp"
#ERROR : Can't open dsspfile "2iwhB.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "1r10A.bssp"
#ERROR : Can't open dsspfile "1r0zD.bssp"
#ERROR : Can't open dsspfile "1r0zC.bssp"
#ERROR : Can't open dsspfile "1r0zB.bssp"
#ERROR : Can't open dsspfile "1r0zA.bssp"
#ERROR : Can't open dsspfile "1r0xD.bssp"
#ERROR : Can't open dsspfile "1r0xC.bssp"
#ERROR : Can't open dsspfile "1r0xB.bssp"
#ERROR : Can't open dsspfile "1r0xA.bssp"
#ERROR : Can't open dsspfile "1r0wC.bssp"
#ERROR : Can't open dsspfile "1r0wB.bssp"
#ERROR : Can't open dsspfile "1r0wA.bssp"
#ERROR : Can't open dsspfile "1q3hD.bssp"
#ERROR : Can't open dsspfile "1q3hC.bssp"
#ERROR : Can't open dsspfile "1q3hB.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "2pzfA.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "1xf9D.bssp"
#ERROR : Can't open dsspfile "1xf9C.bssp"
#ERROR : Can't open dsspfile "1xf9B.bssp"
#ERROR : Can't open dsspfile "1xf9A.bssp"
#ERROR : Can't open dsspfile "1xfaA.bssp"
#ERROR : Can't open dsspfile "2vf8B.bssp"
#ERROR : Can't open dsspfile "2vf8A.bssp"
#ERROR : Can't open dsspfile "2vf7C.bssp"
#ERROR : Can't open dsspfile "2vf7B.bssp"
#ERROR : Can't open dsspfile "2vf7A.bssp"
#ERROR : Can't open dsspfile "1xmiB.bssp"
#ERROR : Can't open dsspfile "1xmiD.bssp"
#ERROR : Can't open dsspfile "2pzfB.bssp"
#ERROR : Can't open dsspfile "2ix8A.bssp"
#ERROR : Can't open dsspfile "2iw3B.bssp"
#ERROR : Can't open dsspfile "2iw3A.bssp"
#ERROR : Can't open dsspfile "2pzgB.bssp"
#ERROR : Can't open dsspfile "1xmjA.bssp"
#ERROR : Can't open dsspfile "2pzgA.bssp"
#ERROR : Can't open dsspfile "2pzeB.bssp"
#ERROR : Can't open dsspfile "2pzeA.bssp"
#ERROR : Can't open dsspfile "1xmiE.bssp"
#ERROR : Can't open dsspfile "1xmiC.bssp"
#ERROR : Can't open dsspfile "1xmiA.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "2zyoA.bssp"
#ERROR : Can't open dsspfile "2zynA.bssp"
#ERROR : Can't open dsspfile "2zymA.bssp"
#ERROR : Can't open dsspfile "1ii8B.bssp"
#ERROR : Can't open dsspfile "1f2uD.bssp"
#ERROR : Can't open dsspfile "1f2uB.bssp"
#ERROR : Can't open dsspfile "1f2tB.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"

## Summary of PDB Search
:244
    1e-84  64%  2oukB  [x.x.x] PROTEIN ARTP
    1e-84  64%  2oljA  [x.x.x] AMINO ACID ABC TRANSPORTER
    1e-58  51%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    1e-46  41%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    3e-42  41%  2yyzA  [x.x.x] SUGAR ABC TRANSPORTER, ATP-BINDING PROTEIN
    2e-41  41%  2it1B  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    2e-41  41%  2it1A  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    1e-36  33%  1g291  [c.37.1 - b.40.6 - b.40.6] MALTOSE TRANSPORT PROTEIN MALK
    2e-36  41%  1l2tB  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-36  41%  1l2tA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-35  41%  2pcjA  [x.x.x] LIPOPROTEIN-RELEASING SYSTEM ATP-BINDING PROTEIN
    7e-35  39%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    1e-34  44%  1f3oA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-34  34%  1q12A  [c.37.1 - b.40.6] MALTOSE/MALTODEXTRIN TRANSPORT ATP-BINDING
    1e-34  34%  3fh6A  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-34  34%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-34  34%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-34  34%  2r6gB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-34  34%  2r6gA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-30  34%  1z47B  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    4e-30  34%  1z47A  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    4e-29  35%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    8e-29  39%  1mt0A  [c.37.1] HAEMOLYSIN SECRETION ATP-BINDING PROTEIN
    8e-29  39%  2ff7A  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-28  39%  2fgkA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-28  39%  2ffbA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-28  39%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-28  33%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    3e-28  41%  3g60A  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    3e-28  41%  3g5uA  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    4e-28  31%  1oxvA  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    4e-28  31%  1oxsC  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    7e-28  37%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    9e-28  33%  1v43A  [c.37.1 - b.40.6 - b.40.6] SUGAR-BINDING TRANSPORT
    1e-27  39%  1xefA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    1e-27  39%  2ffaA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    1e-26  39%  2onkA  [x.x.x] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, ATP-BINDING
    1e-26  32%  3fvqB  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    1e-26  32%  3fvqA  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    1e-25  30%  1g9xA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    2e-25  31%  1g6hA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    4e-25  30%  1gajA  [c.37.1] HIGH-AFFINITY BRANCHED CHAIN AMINO ACID
    7e-25  31%  1ji0A  [c.37.1] ABC TRANSPORTER
    3e-24  36%  2hydA  [x.x.x] ABC TRANSPORTER HOMOLOG
    4e-23  30%  3gfoA  [x.x.x] COBALT IMPORT ATP-BINDING PROTEIN CBIO 1
    1e-22  35%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-22  33%  1pf4A  [f.37.1 - c.37.1] TRANSPORT ATP-BINDING PROTEIN MSBA
    2e-20  26%  1oxxK  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    2e-20  33%  1mv5D  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    2e-20  33%  1mv5A  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    1e-19  32%  2yz2B  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-19  32%  2yz2A  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    7e-19  26%  1vplA  [c.37.1] ABC TRANSPORTER, ATP-BINDING PROTEIN
    3e-18  29%  1jj7A  [c.37.1] PEPTIDE TRANSPORTER TAP1
    1e-17  32%  2ixfC  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    1e-17  32%  2ixfA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    1e-17  32%  2ixeD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    2e-17  33%  2ixfD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    3e-17  30%  2ghiA  [x.x.x] TRANSPORT PROTEIN
    2e-16  31%  2ixeA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    4e-16  30%  2ghiC  [x.x.x] TRANSPORT PROTEIN
    2e-15  30%  2nq2D  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    3e-15  31%  2nq2C  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    3e-15  27%  2d2fA  [x.x.x] SUFC PROTEIN
    4e-15  30%  2ixgA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    4e-15  31%  2ghiB  [x.x.x] TRANSPORT PROTEIN
    5e-15  26%  2d2eA  [x.x.x] SUFC PROTEIN
    6e-15  28%  2zu0C  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    6e-15  28%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-14  28%  2ghiD  [x.x.x] TRANSPORT PROTEIN
    3e-14  31%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    9e-14  28%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-13  28%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    8e-13  32%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-12  28%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    7e-12  27%  1z2rA  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    7e-12  27%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    9e-12  28%  2ihyB  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    1e-11  33%  1yqtA  [x.x.x] RNASE L INHIBITOR
    3e-11  37%  2r6fB  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    3e-11  37%  2r6fA  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    4e-11  29%  2ihyA  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    1e-10  29%  2pjzA  [x.x.x] HYPOTHETICAL PROTEIN ST1066
    1e-10  32%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    6e-10  39%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-09  25%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-09  30%  2qi9C  [x.x.x] VITAMIN B12 IMPORT ATP-BINDING PROTEIN BTUD
    4e-09  27%  2ix3A  [x.x.x] ELONGATION FACTOR 3
    4e-09  27%  2iwhB  [x.x.x] ELONGATION FACTOR 3A
    5e-09  30%  1l7vC  [c.37.1] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
    2e-08  26%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-08  24%  1sgwA  [c.37.1] PUTATIVE ABC TRANSPORTER
    4e-08  28%  1r10A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-08  28%  1r0zD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-08  28%  1r0zC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-08  28%  1r0zB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-08  28%  1r0zA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-08  28%  1r0xD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-08  28%  1r0xC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-08  28%  1r0xB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-08  28%  1r0xA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-08  28%  1r0wC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-08  28%  1r0wB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-08  28%  1r0wA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-08  28%  1q3hD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-08  28%  1q3hC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-08  28%  1q3hB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-08  28%  1q3hA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-08  24%  2pzfA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-08  26%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-08  26%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-08  28%  1xf9D  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-08  28%  1xf9C  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-08  28%  1xf9B  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-08  28%  1xf9A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-08  28%  1xfaA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-07  34%  2vf8B  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    1e-07  34%  2vf8A  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    1e-07  34%  2vf7C  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    1e-07  34%  2vf7B  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    1e-07  34%  2vf7A  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    2e-07  26%  1xmiB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-07  24%  1xmiD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-07  24%  2pzfB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-07  27%  2ix8A  [x.x.x] ELONGATION FACTOR 3A
    3e-07  27%  2iw3B  [x.x.x] ELONGATION FACTOR 3A
    3e-07  27%  2iw3A  [x.x.x] ELONGATION FACTOR 3A
    1e-06  26%  2pzgB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-06  24%  1xmjA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-06  24%  2pzgA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-06  24%  2pzeB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-06  24%  2pzeA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-06  24%  1xmiE  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-06  24%  1xmiC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-06  24%  1xmiA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-05  24%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-04  40%  2zyoA  [x.x.x] SOLUTE-BINDING PROTEIN
    3e-04  40%  2zynA  [x.x.x] SOLUTE-BINDING PROTEIN
    3e-04  40%  2zymA  [x.x.x] SOLUTE-BINDING PROTEIN
    3e-04  31%  1ii8B  [c.37.1] RAD50 ABC-ATPASE
    3e-04  31%  1f2uD  [c.37.1] RAD50 ABC-ATPASE
    3e-04  31%  1f2uB  [c.37.1] RAD50 ABC-ATPASE
    3e-04  31%  1f2tB  [c.37.1] RAD50 ABC-ATPASE
    6e-10  39%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 5->84)
    2e-09  35%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 155->238)
:244

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MEPIIRIRNLHKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKD
2oukB           ---MIDVHQLKKSFGSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFXXXXXXXXXXNLKK
2oljA           ---MIDVHQLKKSFGSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFXXXXXXXXXXNLKK
1b0uA           ----LHVIDLHKRYGGHEVLKGVSLQARAGDVXXXXXXXXXXKSTFLRCINFLEKPSEGAIIVNGQNIND
3dhwC           ---MIKLSNITKVFHQIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGLTTLS
2yyzA           --PSIRVVNLKKYFGKVKAVDGVSFEVKDGEFVALLGPSGCGKTTTLLMLAGIYKPTSGEIYFDDVLVND
2it1B           ----IKLENIVKKFGNFTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDE---KD
2it1A           ----IKLENIVKKFGNFTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDE---KD
1g291           ----VRLVDVWKVFGEVTAVREMSLEVKDGEFMILLGPSGCGKTTTLRMIAGLEEPSRGQIYIGDKLVAD
1l2tB           ---MIKLKNVTKTYKMIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNINDLD
1l2tA           ---MIKLKNVTKTYKMIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNINDLD
2pcjA           ---ILRAENIKKVIRGYEILKGISLSVKKGEFVSIIGASGSGKSTLLYILGLLDAPTEGKVFLEGKEVDN
3d31A           -------------------LDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDSGRILLDGKDVTD
1f3oA           ----IKLKNVTKTYKGIYALKNVNLNIKEGE-FVSIGPSGSGKSTL-NIIGCLDKPTEGEVYIDNINDLD
1q12A           ----VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMND
3fh6A           ----VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMND
2awoA           ----VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMND
2awnB           ----VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMND
2r6gB           ----VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMND
2r6gA           ----VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMND
1z47B           --------------GGARSVRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGKRVTD
1z47A           --------------GGARSVRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGKRVTD
2awoC           ------------------VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMND
1mt0A           ------------------ILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDG----H
2ff7A           ------------------ILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDG----H
2fgkA           ------------------ILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDG----H
2ffbA           ------------------ILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDG----H
3b5jA           ------------------ILDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVLIDG----H
2d62A           ----VKLINIWKRFGDVTAVKDLSLEIKDGEFLVLLGPSGCGKTTTLR-IAGLEEPTRGQIYIEDNLVAD
3g60A           ----------------VQILKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDPLDGMVSIDGQDIRT
3g5uA           ----------------VQILKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDPLDGMVSIDGQDIRT
1oxvA           ----IIVKNVSKVFGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVAS
1oxsC           ----IIVKNVSKVFGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVAS
2awnC           ------------------VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLG----------------
1v43A           ----VKLENLTKRFGNFTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIY---FGDRD
1xefA           ------------------ILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDG----H
2ffaA           ------------------ILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDG----H
2onkA           ---------------------------------VLLGPTGAGKSVFLELIAGIVKPDRGEVRLNGADITP
3fvqB           ----LHIGHLSKSFQNTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTIFS
3fvqA           ----LHIGHLSKSFQNTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTIFS
1g9xA           ---ILRTENIVKYFGEFKALDGVSISVCKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITN
1g6hA           ---ILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITN
1gajA           ---ILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITN
1ji0A           ---VLEVQSLHVYYGAIHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNGQDITN
2hydA           ------------------ILKDINLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGHNIK-
3gfoA           ---ILKVEELYNYSDGTHALKGINMNIKRGEVTAILGGNGVGKSTLFQNFNGILKPSSGRILFDNKPIDY
2awnA           ----VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMND
1pf4A           -------------------LSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSICLDGHDVRD
1oxxK           ----IIVKNVSKVFGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVAS
1mv5D           ------------------ILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQPI-D
1mv5A           ------------------ILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQPI-D
2yz2B           -------------------LENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDGERKKG
2yz2A           -------------------LENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDGERKKG
1vplA           ------VKDLRKRIGKKEILKXXXXXXXXXXXXXXXXPNGAGKTTTLRIISTLIKPSSGIVTVFGKNVVE
1jj7A           ------------------VLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQ
2ixfC           ----------------VQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPVQY
2ixfA           ----------------VQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPVQY
2ixeD           ----------------VQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGLVQYD
2ixfD           ----------------VQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGLVQYD
2ghiA           -------------------LKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYD-AEGDIKIGGKNVNK
2ixeA           ----------------VQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPVQY
2ghiC           -------------------LKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYD-AEGDIKIGGKNVKY
2nq2D           MNKALSVENLGFYY---QAFQQLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGKI---------
2nq2C           ----------------------LNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGKI---------
2d2fA           ----LEIRDLWASIDGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYERGEILLDGENILE
2ixgA           ----------------VQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPVQY
2ghiB           -------------------LKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYD-AEGDIKIGGKNVNK
2d2eA           ----LEIRDLWASIDGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYERGEILLDGENILE
2zu0C           ---MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVE-FKGKD
2d3wA           ---MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVE-FKGKD
2ghiD           -------------------LKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYD-AEGDIKIGGKNVNK
2cbzA           -------------------LNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKG-----
2d3wB           ---MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVE-FKGKD
2d3wD           ---MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVE-FKGKD
3bk7A           -------------------------EIRKGEVIGIVGPNGIGKTTFVKMLAGVEEPTEGKVEWD-LTVAY
2d3wC           ---MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVE-FKGKD
1z2rA           -------------------LRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLR-
3b60A           -------------------LRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLR-
2ihyB           ------------------ILKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATSGTVNLFGKPGKV
1yqtA           -------------------------EIKKGEVIGIVGPNGIGKTTFVKLAG-VEEPTEGKIEWD-LTVAY
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2ihyA           ------------------ILKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATSGTVNLFG---KP
2pjzA           -------------------LENINLEVN-GEKVIILGPNGSGKTTLLRAISGLLPY-SGNIFINGMEV--
2awnD           ----------------------------------------------------------------------
2awoD           ----VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMND
2bbsB           ------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG-----
2qi9C           -------------------------EVRAGEILHLVGPNGAGKSTLLA---RAGTSGKGSIQFAGQPLEA
2ix3A           -------------YGAKILLNKTQLRLKRARRYGICGPNGCGKSTLMRAIANGQ--------VDGFPTQE
2iwhB           -------------YGAKILLNKTQLRLKRARRYGICGPNGCGKSTLMRAIANGQ--------VDGFPTQE
1l7vC           -------------------------EVRAGEILHLVGPNGAGKSTLLA---RAGTSGKGSIQFAGQPLEA
2bbtA           ------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG-----
1sgwA           ------------------VLERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIYNGVPITK
1r10A           ------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLI--LGELEASEGII-------
1r0zD           ------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLI--LGELEASEGII-------
1r0zC           ------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLI--LGELEASEGII-------
1r0zB           ------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLI--LGELEASEGII-------
1r0zA           ------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLI--LGELEASEGII-------
1r0xD           ------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLI--LGELEASEGII-------
1r0xC           ------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLI--LGELEASEGII-------
1r0xB           ------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLI--LGELEASEGII-------
1r0xA           ------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLI--LGELEASEGII-------
1r0wC           ------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLI--LGELEASEGII-------
1r0wB           ------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLI--LGELEASEGII-------
1r0wA           ------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLI--LGELEASEGII-------
1q3hD           ------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLI--LGELEASEGII-------
1q3hC           ------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLI--LGELEASEGII-------
1q3hB           ------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLI--LGELEASEGII-------
1q3hA           ------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLI--LGELEASEGII-------
2pzfA           ------MENVTAFWGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI---
2bbtB           ------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG-----
2bbsA           ------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG-----
1xf9D           ------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLI--LGELEASEGII-------
1xf9C           ------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLI--LGELEASEGII-------
1xf9B           ------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLI--LGELEASEGII-------
1xf9A           ------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLI--LGELEASEGII-------
1xfaA           ------------------VLKNINLNIEKGEMLAITGSTGSGKTSLLMLI--LGELEASEGII-------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
1xmiB           ------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI---
1xmiD           ------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI---
2pzfB           --------------GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI---
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2pzgB           --------------GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI---
1xmjA           ------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI---
2pzgA           --------------GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI---
2pzeB           --------------GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI---
2pzeA           --------------GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI---
1xmiE           ------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI---
1xmiC           ------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI---
1xmiA           ------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI---
2bboA           ------------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI---
2zyoA           ----VQLNNTKKWAGEFTKKTGIQVEVVPQEKLTLDGPAGKGADLVTWPHDRL-----GEAVTKGL----
2zynA           ----VQLNNTKKWAGEFTKKTGIQVEVVPQEKLTLDGPAGKGADLVTWPHDRL-----GEAVTKGL----
2zymA           ----VQLNNTKKWAGEFTKKTGIQVEVVPQEKLTLDGPAGKGADLVTWPHDRL-----GEAVTKGL----
1ii8B           ----------------------------------------------------------------------
1f2uD           ----------------------------------------------------------------------
1f2uB           ----------------------------------------------------------------------
1f2tB           ----------------------------------------------------------------------
2awnD           ----VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMND
2awoD           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DRALREVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGILDQARKYPAQLS
2oukB           DTNLNKVREEVGMVFQRFNLFPHMTVLNNITLAPMKVRKWPREKAEAKAMELLDKVGLKDKAHAYPDSLS
2oljA           DTNLNKVREEVGMVFQRFNLFPHMTVLNNITLAPMKVRKWPREKAEAKAMELLDKVGLKDKAHAYPDSLS
1b0uA           KNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSKHDARERALKYLAKVGIDERAQKYPVHLS
3dhwC           ESELTKARRQIGMIFQHFNLLSSRTVFGNVAL-PLELDNTPKDEVKRRVTELLSLVGLGDKHDSYPSNLS
2yyzA           ---IPPKYREVGMVFQNYALYPHMTVFENIAF-PLRARRISKDEVEKRVVEIARKLLIDNLLDRKPTQLS
2it1B           VTELPPKDRNVGLVFQNWALYPHMTVYKNIAF-PLELRKAPREEIDKKVREVAKMLHIDKLLNRYPWQLS
2it1A           VTELPPKDRNVGLVFQNWALYPHMTVYKNIAF-PLELRKAPREEIDKKVREVAKMLHIDKLLNRYPWQLS
1g291           PEKVPPKDRDIAMVFQSYALYPHMTVYDNIAF-PLKLRKVPRQEIDQRVREVAELLGLTELLNRKPRELS
1l2tB           DDELTKIRRDIGFVFQQFNLIPLLTALENVELPLIKYRGAMSGEERRKRALECLKMAELEEANHKPNQLS
1l2tA           DDELTKIRRDIGFVFQQFNLIPLLTALENVELPLIKYRGAMSGEERRKRALECLKMAELEEANHKPNQLS
2pcjA           EKELSLLRRKLGFVFQFHYLIPELTALENV-IVPMLKMGKPKKEAKERGEYLLSELGLGDKLSRKPYELS
3d31A           ---LSPEKHDIAFVYQNYSLFPHMNVKKNLEFG-MRMKKIKDPKRVLDTARDLKIEHLLD---RNPLTLS
1f3oA           DDELTKIRRDIGFVFQQFNLIPLLTALENVELPLIFKYRGASGEERRKRALECLKAELEERANHKPNQLS
1q12A           ---TPPAERGVGMVFQSYALYPHLSVAENMSFG-LKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALS
3fh6A           ---TPPAERGVGMVFQSYALYPHLSVAENMSFG-LKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALS
2awoA           ---TPPAERGVGMVFQSYALYPHLSVAENMSFG-LKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALS
2awnB           ---TPPAERGVGMVFQSYALYPHLSVAENMSFG-LKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALS
2r6gB           ---TPPAERGVGMVFQSYALYPHLSVAENMSFG-LKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALS
2r6gA           ---TPPAERGVGMVFQSYALYPHLSVAENMSFG-LKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALS
1z47B           ---LPPQKRNVGLVFQNYALFQHMTVYDNVSFG-LREKRVPKDEMDARVRELLRFMRLESYANRFPHELS
1z47A           ---LPPQKRNVGLVFQNYALFQHMTVYDNVSFG-LREKRVPKDEMDARVRELLRFMRLESYANRFPHELS
2awoC           TPP---AERGVGMVA----LYPHLSVAENMSFG-LKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALS
1mt0A           DLALADLRRQVGVVLQD-NVLLNRSIIDNISLANMSVEKYAAKLAGAHDFISELREGYNTIVGEQGAGLS
2ff7A           DLALADLRRQVGVVLQD-NVLLNRSIIDNISLANMSVEKYAAKLAGAHDFISELREGYNTIVGEQGAGLS
2fgkA           DLALADLRRQVGVVLQD-NVLLNRSIIDNISLANMSVEKYAAKLAGAHDFISELREGYNTIVGEQGAGLS
2ffbA           DLALADLRRQVGVVLQD-NVLLNRSIIDNISLANMSVEKYAAKLAGAHDFISELREGYNTIVGEQGAGLS
3b5jA           DLALADLRRQVGVVLQD-NVLLNRSIIDNISLANMSVEKYAAKLAGAHDFISELREGYNTIVGEQGAGLS
2d62A           PEKVPPKERDVA-VFQSYALYPH-TVYDNIAF-PLKLRKVPK-QEIDKRVREVAELGLTELLNRKPRELS
3g60A           IN-VRYLREIIGVVSQEPVLFA-TTIAENI--------RYGREDVTMDEIEKAVKANAYDFIMKLPAQLS
3g5uA           IN-VRYLREIIGVVSQEPVLFA-TTIAENI--------RYGREDVTMDEIEKAVKANAYDFIMKLPAQLS
1oxvA           NGKLPPEDRKIGMVFQTWALYPNLTAFENIAF-PLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRELS
1oxsC           NGKLPPEDRKIGMVFQTWALYPNLTAFENIAF-PLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRELS
2awnC           ----------VGMVFQSYALYPHLSVAENMSFG-LKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALS
1v43A           VTYLPPKDRNISMVFQ------HMTVYENIAFP---LKKFPKDEIDKRVRWAAELLQIEELLNRYPAQLS
1xefA           DLALADLRRQVGVVLQD-NVLLNRSIIDNISLANMSVEKYAAKLAGAHDFISELREGYNTIVGEQGAGLS
2ffaA           DLALADLRRQVGVVLQD-NVLLNRSIIDNISLANMSVEKYAAKLAGAHDFISELREGYNTIVGEQGAGLS
2onkA           ---LPPERRGIGFVPQDYALFPHLSVYRNIAYG---LXXXXXXXXXXXXXXMAEKLGIAHLLDRKPARLS
3fvqB           KNTNLPVRRRLGYLVQEGVLFPHLTVYRNIAYG-LGNGKGRTAQERQRIEAMLELTGISELAGRYPHELS
3fvqA           KNTNLPVRRRLGYLVQEGVLFPHLTVYRNIAYG-LGNGKGRTAQERQRIEAMLELTGISELAGRYPHELS
1g9xA           KEPAELYHYGIVRTFQTPQPLKEMTVLENLLIGEINPGESPKKWIPKEEEMVEKAFKILEFLKRKAGELS
1g6hA           KEPAELYHYGIVRTFQTPQPLKEMTVLENLLISPLNYKKWPKEEEMVEKAFKILEFLKLSHLYDRKAELS
1gajA           KEPAELYHYGIVRTFQTPQPLKEMTVLENLLIGEINPGESPKKWIPKEEEMVEKAFKILEFLKRKAGELS
1ji0A           KPA-HVINRGIALVPEGRRIFPELTVYENLGAYNRKDKEGIKRDLEWIFSLFPR---LKERLKQLGGTLS
2hydA           DFLTGSLRNQIGLV-QQDNILFSDTVKENITATDEEVVEAAKMANAHDFIMNLPQ-GYDTEVGERGVKLS
3gfoA           SRGIMKLRESIGIVFQDDNQLFSASVYQDVSFGAVNMKL-PEDEIRKRVDNALKRTGIEHLKDKPTHCLS
2awnA           TPP---AERGVGMVFQSYAL------------------------------------EVINQRVNQVAEV-
1pf4A           YK-LTNLRRHFALVSQNVHLF-NDTIANNIAYAAEQIEQAARQAHAMEFIENMPQ-GLDTVIGENGTSLS
1oxxK           NGKLPPEDRKIGMVFQTWALYPNLTAFENIAF-PLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRELS
1mv5D           NISLENWRSQIGFVSQDSAIMAG-TIRENLTLWQVLDLAFARSFVENMPDQLNTEVG------ERGVKIS
1mv5A           NISLENWRSQIGFVSQDSAIMAG-TIRENLTLWQVLDLAFARSFVENMPDQLNTEVG------ERGVKIS
2yz2B           ----YEIRRNIGIAFQYEDQFFAERVFDEVAFAVKNF--YPDRDPVPLVKKAMEFVGLFDSFKRVPFFLS
2yz2A           ----YEIRRNIGIAFQYEDQFFAERVFDEVAFAVKNF--YPDRDPVPLVKKAMEFVGLFDSFKRVPFFLS
1vplA           EP--HEVRKLISYLPEEAGAYRNMQGIEYLRFVAGFYASSSSEIEEMVERATEI-AGLGEKIKDRVSTYS
1jj7A           YEH-RYLHRQVAAVGQEPQVFGR-SLQENIAYGLTQKPTMEEITAAAVKSGAHSFISGLPQGYEAGSQLS
2ixfC           DH--HYLHTQVAAVGQEPLLFGR-SFRENIAYGLTRTPTMEEITAVAMESGAHDFIGYDTEVGETGNQLS
2ixfA           DH--HYLHTQVAAVGQEPLLFGR-SFRENIAYGLTRTPTMEEITAVAMESGAHDFIGYDTEVGETGNQLS
2ixeD           HHYLHTQVAAVGPL-----LFGR-SFRENIAYGLTRTPTMEEITAVAMESGAHDFISGFPQGYDTEVQLS
2ixfD           HHYLHTQVAAVGQLLRSFNIAYGLTTMEEITAVAME--------SGAHDFISGFPQGYDTEVGETGNQLS
2ghiA           YNR-NSIRSIIGIVPQDTILF-NETIKYNILYGKLDAT-------DEEVIKATKSAQLYDFIEALPKKLS
2ixeA           DH--HYLHTQVAAVGQEPLLFGR-SFRENIAYGLTRTPTMEEITAVAMESGAHDFIGYDTEVGETGNQLS
2ghiC           NR--NSIRSIIGIVPQDTILF-NETIKYNILYGKLDATE----EVIKATKSAQLYDFIEALPKKWDTIVG
2nq2D           -----EVYQSIGFVPQFFSSPFAYSVLDIVLMGRINTFAKPKSHDYQVAMQALDYLNLTHLAKREFTSLS
2nq2C           -----EVYQSIGFVPQFFSSPFAYSVLDIVLMGRINTFAKPKSHDYQVAMQALDYLNLTHLAKREFTSLS
2d2fA           LSPDERARKGLFLAFQYPVEVPGVTIANFLRLA-LQAKLGREVGVAEFWTKVKKALELLDWDESYLSRFS
2ixgA           DH--HYLHTQVAAVGQEPLLFGR-SFRENIAYGLTRTPTMEEITAVAMESGAHDFIGYDTEVGETGNQLA
2ghiB           YNR-NSIRSIIGIVPQDTILF-NETIKYNILYGKLDAT-------DEEVIKATKSAQLYDFIEALPKKLS
2d2eA           LSPDERARKGLFLAF-QYPVVPGVTIANFLRLA-LQAKLGREVGVAEFWTKVKKALELLDWDESYLSRLN
2zu0C           LLALSPEDRAGEGIFMAFQYVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMTRSVNVGFS
2d3wA           LLALSPEDRAGEGIFMAFQYVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMTRSVNVGFS
2ghiD           YNR-NSIRSIIGIVPQDTILF-NETIKYNILYGKLDAT-------DEEVIKATKSAQLYDFIEALPKKLS
2cbzA           ---------SVAYVPQQAWI-QNDSLRENILFGCQLEEPYYRSVIQACALLPDLEIGDRTEIGEKGVNLS
2d3wB           LLALSPEDRAGEGIFMAFQYVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMTRSVNVGFS
2d3wD           LLALSPEDRAGEGIFMAFQYVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMTRSVNVGFS
3bk7A           KPQYIKAEYE-GTVYELLSKIDSSKLNSNFYKTEL-----------------LKPLGIIDLYDRNVEDLS
2d3wC           LLALSPEDRAGEGIFMAFQYVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMTRSVNVGFS
1z2rA           EYTLASLRNQVALVSQNVHLF-NDTVANNIAYARTEEYSREQIEEAARMAYAMDFINKMDNGGENGVLLS
3b60A           EYTLASLRNQVALVSQNVHLF-NDTVANNIAYARTEEYSREQIEEAARMAYAMDFINKMDNGGENGVLLS
2ihyB           GYSAETVRQHIGFVFQEGERV--IDVVISGAFKSIGVYQDIDDEIRNEAHQLLKLVGSA-KAQQYIGYLS
1yqtA           KPQYIKADYE-GTVYELLSKIDASKLNSNFYKTEL-----------------LKPLGIIDLYDREVNELS
2r6fB           --------------------------------------------------------------------LS
2r6fA           --------------------------------------------------------------------LS
2ihyA           GYSAETVRQHIGFV--SHSLLEKFQEGERVI--DVVISGAIDDEIRNEAHQLLKLVGSA-KAQQYIGYLS
2pjzA           ----RKIRNYIRYSTNLPEAYEIGVTVNDIVYLYEELKGLDRDLFLEMLKALKLGEEIL---RRKLYKLS
2awnD           ----------------------------------------------------------------------
2awoD           ---TPPAERGVGMV--------------------------------------------------------
2bbsB           ---------RISFCSQNSWIMPG-TIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGGITLS
2qi9C           WSATKLALHRAYLSQQQTPPFA-TPVWHYLTLHQHDKTR------TELLNDVAGALALDDKLGRSTNQLS
2ix3A           ECRTVYVEHDIDGTHSD------TSVLDFVFESGVGTKE--------AIKDKLIEFGFTDEMIAMPSALS
2iwhB           ECRTVYVEHDIDGTHSD------TSVLDFVFESGVGTKE--------AIKDKLIEFGFTDEMIAMPSALS
1l7vC           WSATKLALHRAYLSQQQTPPFA-TPVWHYLTLHQHDKTR------TELLNDVAGALALDDKLGRSTNQLS
2bbtA           ---------RISFCSQNSWIMPG-TIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGGITLS
1sgwA           VKGKIFFLPEEIIVPRKISVEDYLKAV--ASLYGVKVNK-------NEIMDALESVEVLDLKKKL-GELS
1r10A           --------KHSGRVSSQFSWIMPGTIKENIIFGVSYDERYKSVVKACQLQQDITKFAEQDNTGEGGVTLS
1r0zD           --------KHSGRVSSQFSWIMPGTIKENIIFGVSYDERYKSVVKACQLQQDITKFAEQDNTGEGGVTLS
1r0zC           --------KHSGRVSSQFSWIMPGTIKENIIFGVSYDERYKSVVKACQLQQDITKFAEQDNTGEGGVTLS
1r0zB           --------KHSGRVSSQFSWIMPGTIKENIIFGVSYDERYKSVVKACQLQQDITKFAEQDNTGEGGVTLS
1r0zA           --------KHSGRVSSQFSWIMPGTIKENIIFGVSYDERYKSVVKACQLQQDITKFAEQDNTGEGGVTLS
1r0xD           --------KHSGRVSSQFSWIMPGTIKENIIFGVSYDERYKSVVKACQLQQDITKFAEQDNTGEGGVTLS
1r0xC           --------KHSGRVSSQFSWIMPGTIKENIIFGVSYDERYKSVVKACQLQQDITKFAEQDNTGEGGVTLS
1r0xB           --------KHSGRVSSQFSWIMPGTIKENIIFGVSYDERYKSVVKACQLQQDITKFAEQDNTGEGGVTLS
1r0xA           --------KHSGRVSSQFSWIMPGTIKENIIFGVSYDERYKSVVKACQLQQDITKFAEQDNTGEGGVTLS
1r0wC           --------KHSGRVSSQFSWIMPGTIKENIIFGVSYDERYKSVVKACQLQQDITKFAEQDNTGEGGVTLS
1r0wB           --------KHSGRVSSQFSWIMPGTIKENIIFGVSYDERYKSVVKACQLQQDITKFAEQDNTGEGGVTLS
1r0wA           --------KHSGRVSSQFSWIMPGTIKENIIFGVSYDERYKSVVKACQLQQDITKFAEQDNTGEGGVTLS
1q3hD           --------KHSGRVSSQFSWIMPGTIKENIIFGVSYDERYKSVVKACQLQQDITKFAEQDNTGEGGVTLS
1q3hC           --------KHSGRVSSQFSWIMPGTIKENIIFGVSYDERYKSVVKACQLQQDITKFAEQDNTGEGGVTLS
1q3hB           --------KHSGRVSSQFSWIMPGTIKENIIFGVSYDERYKSVVKACQLQQDITKFAEQDNTGEGGVTLS
1q3hA           --------KHSGRVSSQFSWIMPGTIKENIIFGVSYDERYKSVVKACQLQQDITKFAEQDNTGEGGVTLS
2pzfA           ------------SFCSQFSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIGEGGITLS
2bbtB           ---------RISFCSQNSWIMPG-TIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNI-VLGITLS
2bbsA           ---------RISFCSQNSWIMPG-TIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNI--VLITLS
1xf9D           --------KHSGRVSSQFSWIMPGTIKENI-ISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGELS
1xf9C           --------KHSGRVSSQFSWIMPGTIKENI-ISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGELS
1xf9B           --------KHSGRVSSQFSWIMPGTIKENI-ISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGELS
1xf9A           --------KHSGRVSSQFSWIMPGTIKENI-ISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGELS
1xfaA           --------KHSGRVSSQFSWIMPGTIKENIIRGVSYDERYKSVVKACQLQQDITKFAEQDNTGEGGVTLS
2vf8B           -------------------------------------------------------------------ELS
2vf8A           -------------------------------------------------------------------ELS
2vf7C           -------------------------------------------------------------------ELS
2vf7B           -------------------------------------------------------------------ELS
2vf7A           -------------------------------------------------------------------ELS
1xmiB           ------------SFCSQFSWIMPGTIKENI-IAGVSYDEY-------RYRSVIKACQLEEDISKIVLTLS
1xmiD           ------------SFCSQFSWIMPGTIKENIIAGVSYDERYRSVIKACQLEEDISKFAEKDNIVLGEITLS
2pzfB           ------------SFCSQFSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIGEGGITLS
2ix8A           --------------------------------------------------------------------LS
2iw3B           --------------------------------------------------------------------LS
2iw3A           --------------------------------------------------------------------LS
2pzgB           ------------SFCSQFSWIMPGTIKENIIFGVS----YDEYRYRSVIKACQLEEDISKFAEKLGITLS
1xmjA           ------------SFCSQFSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIGEGGITLS
2pzgA           ------------SFCSQFSWIMPGTIKENIIFGVSYDERYRSVIKACQLEEDISKFAEKDNIGEGGITLS
2pzeB           ------------SFCSQFSWIMPGTIKENIIFGVSYDERYRSVIKACQLEEDISKFAEKDNIGEGGITLS
2pzeA           ------------SFCSQFSWIMPGTIKENIIFGVSYDERYRSVIKACQLEEDISKFAEKDNIGEGGITLS
1xmiE           ------------SFCSQFSWIMPGTIKENIIAGVSYDERYRSVIKACQLEEDISKFAEKDNIGEGGITLS
1xmiC           ------------SFCSQFSWIMPGTIKENIIAGVSYDERYRSVIKACQLEEDISKFAEKDNIGEGGITLS
1xmiA           ------------SFCSQFSWIMPGTIKENIIAGVSYDERYRSVIKACQLEEDISKFAEKDNIGEGGITLS
2bboA           ------------SFCSQFSWIMPGTIKENIIFGVSYDERYRSVIKACQLEEDISKFAEKDNIGEGGITLS
2zyoA           ----------------------------------------------------------------------
2zynA           ----------------------------------------------------------------------
2zymA           ----------------------------------------------------------------------
1ii8B           --------------------------------------------------------------------LS
1f2uD           --------------------------------------------------------------------LS
1f2uB           --------------------------------------------------------------------LS
1f2tB           --------------------------------------------------------------------LS
2awnD           ---TPPAERGVGMV--------------------------------------------------------
2awoD           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVVTHEMGFAREVADRVVF
2oukB           GGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANEGMTMVVVTHEMGFAREVGDRVLF
2oljA           GGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANEGMTMVVVTHEMGFAREVGDRVLF
1b0uA           GGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSHVIF
3dhwC           GGQKQRVAIARALASNPKVLLCDEATSALDPATTRSILELLKDINRRGLTILLITHEMDVVKRICDCVAV
2yyzA           GGQQQRVALARALVKQPKVLLFDEPLSNLDANMRAEIKHLQQEL---GITSVYVTHDQAEAMTMASRIAV
2it1B           GGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKEGITTVYVTHDQAEALAMADRIAV
2it1A           GGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKEGITTVYVTHDQAEALAMADRIAV
1g291           GGQRQRVALGRAIVRKPQVFLMDEPLSNLDAKLRVRMRAELKKLRQLGVTTIYVTHDQVEAMTMGDRIAV
1l2tB           GGQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLEEDGKTVVVVTHDINVAR-FGERIIY
1l2tA           GGQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLEEDGKTVVVVTHDINVAR-FGERIIY
2pcjA           GGEQQRVAIARALANEPILLFADEPTGNLDSANTKRVMDIFLKINEGGTSIVMVTHERELA-ELTHRTLE
3d31A           GGEQQRVALARALVTNPKILLLDEPLSALDPENAREMLSVLH--KKNKLTVLHITHDQTEARIMADRIAV
1f3oA           GGQQQRVAIARALANNPPIILADEPTGALDSK-TGEKIQLLKKLEEDGKTVVVVTHDINVAR-FGERIIY
1q12A           GGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVV
3fh6A           GGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVV
2awoA           GGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVV
2awnB           GGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVV
2r6gB           GGQRQRVAIGRTLVAEPSVFLLDQPLSNLDAALVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVV
2r6gA           GGQRQRVAIGRTLVAEPSVFLLDQPLSNLDAALVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVV
1z47B           GGXXXXXXXXXXXXXXXXXXXFDEPFAAIDTQIRRELRTFVRQVDEMGVTSVFVTHDQEEALEVADRVLV
1z47A           GGXXXXXXXXXXXXXXXXXXXFDEPFAAIDTQIRRELRTFVRQVDEMGVTSVFVTHDQEEALEVADRVLV
2awoC           GGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVV
1mt0A           GGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICK-GRTVIIIAHRLSTVKN-ADRIIV
2ff7A           GGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICK-GRTVIIIAHRLSTVKN-ADRIIV
2fgkA           GGQRQRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKICK-GRTVIIIAHRLSTVKN-ADRIIV
2ffbA           GGQRQRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKICK-GRTVIIIAHRLSTVKN-ADRIIV
3b5jA           GGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICK-GRTVIIIAHRLSTVKN-ADRIIV
2d62A           GGQRQRVALGRAIIRRPKVFL-DEPLSNLDAKLRVKRAELKKLQRQLGVTTIYVTHDQ--VEATGDRIA-
3g60A           GGQKQRIAIARALVRNPKILLLDEATSALDTESEA-VVQAALDKAREGRTTIVIAHRLSTVRN-ADVIAG
3g5uA           GGQKQRIAIARALVRNPKILLLDEATSALDTESEA-VVQAALDKAREGRTTIVIAHRLSTVRN-ADVIAG
1oxvA           GGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVSRLGVTLLVVSHDPADIFAIADRXXX
1oxsC           GGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVSRLGVTLLVVSHDPADIFAIADRXXX
2awnC           GGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVV
1v43A           GGXXXXXXXXXXXXXEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKKVTTIYVTHDQVEAMTMGDRIAV
1xefA           GGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICK-GRTVIIIAARLSTVKN-ADRIIV
2ffaA           GGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICK-GRTVIIIAARLSTVKN-ADRIIV
2onkA           GGERQRVALARALVIQPRLLLLDEPLSAVDLKTKGVLMEELRFVREFDVPILHVTHDLIEAAMLADEVAV
3fvqB           GGXXXXXXXXXXXXPDPELILLDEPFSALDEQLRRQIRDMIAALRANGKSAVFVSHDREEALQYADRIAV
3fvqA           GGXXXXXXXXXXXXPDPELILLDEPFSALDEQLRRQIRDMIAALRANGKSAVFVSHDREEALQYADRIAV
1g9xA           GGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHLYV
1g6hA           GGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHLYV
1gajA           GGQMKLVEIGRALMTNPKMIVMDQPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHLYV
1ji0A           GGEQQ-LAIGRALS-RPK--LLDEPSLGLAPILVSEVFEVIQKINQEGTTILLVEQNALGALKVAHYGYV
2hydA           GGQKQRLSIARIFLNNPPILILDEATSALDLEIIQEALDVL----SKDRTTLIVAHRLSTITH-ADKIVV
3gfoA           FGQKKRVAIAGVLVMEPKVLILDEPTAGLDPMGVSEIMKLLVEMQKEGXXXXXXXXXXXXVPLYCDNVFV
2awnA           ------LAIGRTLVAEPSVFLLDEPLSNLDAALRVQMIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVV
1pf4A           GGQRQRVAIARALLRDAPVLILDEATSALDTESERAIQAALDEL-QKNKTVLVIAHRLS-TIEQADEILV
1oxxK           GXXXXXXXXXXXXXKDPSLLLLDEPFSNLDARMRDSARALVKEVSRLGVTLLVVSHDPADIFAIADRXXX
1mv5D           GGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLMK-GRTTLVIAHRLSTIVD-ADKIYF
1mv5A           GGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLMK-GRTTLVIAHRLSTIVD-ADKIYF
2yz2B           GGEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKWKTLGKTVILISHDIETVINHVDRVVV
2yz2A           GGEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKWKTLGKTVILISHDIETVINHVDRVVV
1vplA           KGMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQEGLTILVSSHNMLEVEFLCDRIAL
1jj7A           GGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERSRSVLLITQHLSLV-EQADHILF
2ixfC           GGQRQAVALARALIRKPRLLILDQATSALD---AGNQLRVQRLLYEASRTVLLITHQLSLA-ERAHHILF
2ixfA           GGQRQAVALARALIRKPRLLILDQATSALD---AGNQLRVQRLLYEASRTVLLITHQLSLA-ERAHHILF
2ixeD           GGQRQAVALARALIRKPRLLILDNATSALD---AGNQLRVQRLLYEASRTVLLITQQLSLA-ERAHHILF
2ixfD           GGQRQAVALARALIRKPRLLILDQATSALD---AGNQLRVQRLLYEASRTVLLITHQLSLA-ERAHHILF
2ghiA           GGERQRIAIARCLLKDPKIVIFDEATSSLDSKTEYLFQKAVEDLRK-NRTLIIIAHRLSTISS-AESIIL
2ixeA           GGQRQAVALARALIRKPRLLILDNATSALD---AGNQLRVQRLLYEASRTVLLITQQLSLA-ERAHHILF
2ghiC           GGERQRIAIARCLLKDPKIVIFDEATSSLDSKTEYLFQKAVEDLRK-NRTLIIIAHRLSTISS-AESIIL
2nq2D           GGQRQLILIARAIASECKLILLDEPTSALDLANQDIVLSLLIDLAQSNMTVVFTTHQPNQVVAIANKTLL
2nq2C           GGQRQLILIARAIASECKLILLDEPTSALDLANQDIVLSLLIDLAQSNMTVVFTTHQPNQVVAIANKTLL
2d2fA           GGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPNFGALVITHYQRILNYIPDKVHV
2ixgA           VGQRQAVALARALIRKPRLLILDNATSALD---AGNQLRVQRLLYEASRTVLLITQQLSLA-ERAHHILF
2ghiB           GGERQRIAIARCLLKDPKIVIFDEATSDSKTEYLFQ--KAVEDLRK-NRTLIIIAHR---TISSAESIIL
2d2eA           EGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPNFGALVITHYQRILNYIPDKVHV
2zu0C           GGEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIPDYVHV
2d3wA           GGEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIPDYVHV
2ghiD           GGERQRIAIARCLLKDPKIVIFDDSKTEY----------LFQKAVEDNRTLIIIAHRLSTISS-AESIIL
2cbzA           GGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENV--IGPKGMTRILVTHSMSYLPQV-DVIIV
2d3wB           GGEKKRNDILQMAVLEPELCILDE-SDSLDIDALKVVADGVNSLRDGKRSFIIVTHYRILDYIKPDYVHV
2d3wD           GGEKKRNDILQMAVLEPELCILDE-SDGLDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIPDYVHV
3bk7A           GGELQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLMENEKTALVVEHDVLMIDYVSDRLIV
2d3wC           GGEKKRNDILQMAVLEPELCILDESD---DIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIPDYVHV
1z2rA           XXXXXXXXXXXXXXXDSPILILDEATSALDTESERAIQAALDEL-QKNRTSLVIAHRL------------
3b60A           XXXXXXXXXXXXXXXDSPILILDEATSALDTESERAIQAALDEL-QKNRTSLVIAHRL------------
2ihyB           TGEKQRV-IARALG-QPQVLILDEPAAGLDFIAREXXXXXXXXXXXXYPTLAIVTHFIEEITANFSKILL
1yqtA           GGELQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLEKNEKTALVVEHDV-LIDYVSDRLVF
2r6fB           GGEAQRVKLAAELHRRSNLYILDEPTTGLHVDDIARLLDVLHRLVDNGDTVLVIEHNLDVIK-TADYIID
2r6fA           GGEAQRVKLAAELHRRSNLYILDEPTTGLHVDDIARLLDVLHRLVDNGDTVLVIEHNLDVIK-TADYIID
2ihyA           TGEKQRV-IARALG-QPQVLILDEPAAGLDFIAREXXXXXXXXXXXXYPTLAIVTHFIEEITANFSKILL
2pjzA           AGQSVLVRTSLALASQPEIVGLDEPFENVDAARRHVISRYIKEYGKEG---ILVTHEL------------
2awnD           --------------VEPSVFLLDEPLSNLDAALRVQMIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVV
2awoD           ----------------------------------------------------------------------
2bbsB           GGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADKILI
2qi9C           GGEWQRVRLAAVLQITPQLLLLDEPNS-LDVAQQSALDKILSALSQQGLA-IVSSHDLNHTLRHAHRAWL
2ix3A           GGWKMKLALARAVLRNADILLLDEPTNHLDTVNVAWLVNYLNTC---GITSITISHDSVFLDNVCEYIIN
2iwhB           GGWKMKLALARAVLRNADILLLDEPTNHLDTVNVAWLVNYLNTC---GITSITISHDSVFLDNVCEYIIN
1l7vC           GGEWQRVRLAAVLQITPQLLLLDEPNS-LDVAQQSALDKILSALCQQGLA-IVSSHDLNHTLRHAHRAWL
2bbtA           GGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADKILI
1sgwA           QGTIRRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLSILEILKEKGIVIISSREELSY----------
1r10A           GGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADKILI
1r0zD           GGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADKILI
1r0zC           GGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADKILI
1r0zB           GGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADKILI
1r0zA           GGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADKILI
1r0xD           GGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADKILI
1r0xC           GGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADKILI
1r0xB           GGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADKILI
1r0xA           GGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADKILI
1r0wC           GGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADKILI
1r0wB           GGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADKILI
1r0wA           GGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADKILI
1q3hD           GGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADKILI
1q3hC           GGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADKILI
1q3hB           GGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADKILI
1q3hA           GGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADKILI
2pzfA           GGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADKILI
2bbtB           GGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADKILI
2bbsA           GGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADKILI
1xf9D           GGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADKILI
1xf9C           GGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADKILI
1xf9B           GGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADKILI
1xf9A           GGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADKILI
1xfaA           GGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRK-ADKILI
2vf8B           GGEAQRIKLATELRRSGRVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAVEHKMQVV-AASDWVLD
2vf8A           GGEAQRIKLATELRRSGRVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAVEHKMQVV-AASDWVLD
2vf7C           GGEAQRIKLATELRRSGRVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAVEHKMQVV-AASDWVLD
2vf7B           GGEAQRIKLATELRRSGRVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAVEHKMQVV-AASDWVLD
2vf7A           GGEAQRIKLATELRRSGRVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAVEHKMQVV-AASDWVLD
1xmiB           GGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADKILI
1xmiD           GGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADKILI
2pzfB           GGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADKILI
2ix8A           GGQKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALSKALKEFEGG---VIIITHSAEFTKNLTEEVWA
2iw3B           GGQKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALSKALKEFEGG---VIIITHSAEFTKNLTEEVWA
2iw3A           GGQKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALSKALKEFEGG---VIIITHSAEFTKNLTEEVWA
2pzgB           GGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADKILI
1xmjA           EGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADKILI
2pzgA           GGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADKILI
2pzeB           GGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADKILI
2pzeA           GGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADKILI
1xmiE           GGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADKILI
1xmiC           GGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADKILI
1xmiA           GGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADKILI
2bboA           EGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKK-ADKILI
2zyoA           ----------------------------------------------------------------------
2zynA           ----------------------------------------------------------------------
2zymA           ----------------------------------------------------------------------
1ii8B           GGERIALGLAFRLAMEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEEL-KDAADHVI-
1f2uD           GGERIALGLAFRLAMEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEEL-KDAADHVI-
1f2uB           GGERIALGLAFRLAMEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEEL-KDAADHVI-
1f2tB           GGERIALGLAFRLAMEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEEL-KDAADHVI-
2awnD           ----------------------------------------------------------------------
2awoD           --------------VEPSVFLLDEPLAALRVQMRIEISRLHKRL---GRTMIYVTHDQVEAMTLADKIVV


                         .         .         .         +         .         .         .:280
query           MDGGQIVEEGRPEEIFTRPKEERTRSFLQRVLHx
2oukB           MDGGYIIEEGKPEDLFDRPQHERTKAFLSKV---
2oljA           MDGGYIIEEGKPEDLFDRPQHERTKAFLSKV---
1b0uA           LHQGKIEEEGDPEQVFGNPQSPRLQQFLK-----
3dhwC           ISNGELIEQDTVSEVFSHPKTPLAQKFIQSTLH-
2yyzA           FNQGKLVQYGTPDEVYDSPKNMFVASFI------
2it1B           IREGEILQVGTPDEVYYKPKYKFVGGFL------
2it1A           IREGEILQVGTPDEVYYKPKYKFVGGFL------
1g291           MNRGVLQQVGSPDEVYDKPANTFVAGFI------
1l2tB           LKDGEVERE-------------------------
1l2tA           LKDGEVERE-------------------------
2pcjA           MKDGKVVGE-------------------------
3d31A           VMDGKLIQVGKPEEIFEKPVEGRVASFV------
1f3oA           LKDGEVERE-------------------------
1q12A           LDAGRVAQVGKPLELYHYPADRFVAGFI------
3fh6A           LDAGRVAQVGKPLELYHYPADRFVAGFI------
2awoA           LDAGRVAQVGKPLELYHYPADRFVAGFI------
2awnB           LDAGRVAQVGKPLELYHYPADRFVAGFI------
2r6gB           LDAGRVAQVGKPLELYHYPADRFVAGFI------
2r6gA           LDAGRVAQVGKPLELYHYPADRFVAGFI------
1z47B           LHEGNVEQFGTPEEVYEKPGTLFVASFI------
1z47A           LHEGNVEQFGTPEEVYEKPGTLFVASFI------
2awoC           LDAGRVAQVGKPLELYHYPADRFVAGFI------
1mt0A           MEKGKIVEQGK-----------------------
2ff7A           MEKGKIVEQGK-----------------------
2fgkA           MEKGKIVEQGK-----------------------
2ffbA           MEKGKIVEQGK-----------------------
3b5jA           MEKGKIVEQGK-----------------------
2d62A           VNKGELQQVGTPDEVYYKPVNTFVAGFI------
3g60A           FDGGVIVEQGNHDEL-------------------
3g5uA           FDGGVIVEQGNHDEL-------------------
1oxvA           XXXXXXXXXXXPEDLYDNPVSIQVASLIGEI---
1oxsC           XXXXXXXXXXXPEDLYDNPVSIQVASLIGEI---
2awnC           LDAGRVAQVGKPLELYHYPADRFVAGFI------
1v43A           MNRGQLLQIGSPTEVYLRPNSVFVATFI------
1xefA           MEKGKIVEQGK-----------------------
2ffaA           MEKGKIVEQGK-----------------------
2onkA           MLNGRIVEKGKLKELFSAKNGE------------
3fvqB           MKQGRILQTASPHELYRQPAD-------------
3fvqA           MKQGRILQTASPHELYRQPAD-------------
1g9xA           MFNGQIIAEGRGEE--------------------
1g6hA           MFNGQIIAEGRGEE--------------------
1gajA           MFNGQIIAEGRGEE--------------------
1ji0A           LETGQIVLEGKASEL-------------------
2hydA           IENGHIVETGTHRELIAK----------------
3gfoA           MKEGRVILQGNPKEVF------------------
2awnA           LDAGRVAQVGKPLELYHYPADRFVAGFI------
1pf4A           VDEGEIIERGR-----------------------
1oxxK           XXXXXXXXXXXPEDLYDNPVSIQVASLIGEI---
1mv5D           IEKGQITGSGKHNEL-------------------
1mv5A           IEKGQITGSGKHNEL-------------------
2yz2B           LEKGKKVFDGTRMEFLEK----------------
2yz2A           LEKGKKVFDGTRMEFLEK----------------
1vplA           IHNGTIVETGTVEELKERYKAQNIEEVFEEVV--
1jj7A           LEGGAIREGGTHQQLMEK----------------
2ixfC           LKEGSVCEQGTHLQLMER----------------
2ixfA           LKEGSVCEQGTHLQLMER----------------
2ixeD           LKEGSVCEQGTHLQLMER----------------
2ixfD           LKEGSVCEQGTHLQLMER----------------
2ghiA           LNKGKIVEKGTHKDL-------------------
2ixeA           LKEGSVCEQGTHLQLMER----------------
2ghiC           LNKGKIVEKGTHKDL-------------------
2nq2D           LN--------------------------------
2nq2C           LN--------------------------------
2d2fA           MMDGRVVATGGPE---------------------
2ixgA           LKEGSVCEQGTHLQLMER----------------
2ghiB           LNKGKIVEKGTHKDL-------------------
2d2eA           MMDGRVVATGGPE---------------------
2zu0C           LYQGRIVKSG------------------------
2d3wA           LYQGRIVKSG------------------------
2ghiD           LNKGKIVEKGTHKDL-------------------
2cbzA           MSGGKISEMGSYQELLAR----------------
2d3wB           LYQGRIVKSG------------------------
2d3wD           LYQGRIVKSG------------------------
3bk7A           FEG-------------------------------
2d3wC           LYQGRIVKSG------------------------
1z2rA           ----------------------------------
3b60A           ----------------------------------
2ihyB           LKDGQSIQQGAVEDILT---SENSRFFQKNV---
1yqtA           ----------------------------------
2r6fB           LGGGQIVAVGTPEEV-AEVKESHTGRYLKPIL--
2r6fA           LGGGQIVAVGTPEEV-AEVKESHTGRYLKPIL--
2ihyA           LKDGQSIQQGAVEDILT---SENSRFFQKNV---
2pjzA           ----------------------------------
2awnD           LDAGRVAQVGKPLELYHYPADRFVAGFI------
2awoD           ----------------------------------
2bbsB           LHEGSSYFYGTFSELFDQFSAERRNSILTETLH-
2qi9C           LKGGKLA-SGRREEVLTPP---------------
2ix3A           YEG-------------------------------
2iwhB           YEG-------------------------------
1l7vC           LKGGKLA-SGRREEVLTPP---------------
2bbtA           LHEGSSYFYGTFSELQNRPXAERRNSILTETLH-
1sgwA           ----------------------------------
1r10A           LHQG------------------------------
1r0zD           LHQG------------------------------
1r0zC           LHQG------------------------------
1r0zB           LHQG------------------------------
1r0zA           LHQG------------------------------
1r0xD           LHQG------------------------------
1r0xC           LHQG------------------------------
1r0xB           LHQG------------------------------
1r0xA           LHQG------------------------------
1r0wC           LHQG------------------------------
1r0wB           LHQG------------------------------
1r0wA           LHQG------------------------------
1q3hD           LHQG------------------------------
1q3hC           LHQG------------------------------
1q3hB           LHQG------------------------------
1q3hA           LHQG------------------------------
2pzfA           LHEG------------------------------
2bbtB           LHEGSSYFYGRPDDSFDQFSAERRNSILTETLH-
2bbsA           LHEGSSYFYGTFSELFDQFSAERRNSILTETLH-
1xf9D           LHQG------------------------------
1xf9C           LHQG------------------------------
1xf9B           LHQG------------------------------
1xf9A           LHQG------------------------------
1xfaA           LHQG------------------------------
2vf8B           IDGGRLVAQGTPAEV-------------------
2vf8A           IDGGRLVAQGTPAEV-------------------
2vf7C           IDGGRLVAQGTPAEV-------------------
2vf7B           IDGGRLVAQGTPAEV-------------------
2vf7A           IDGGRLVAQGTPAEV-------------------
1xmiB           LHEG------------------------------
1xmiD           LHEG------------------------------
2pzfB           LHEG------------------------------
2ix8A           VKDGR-----------------------------
2iw3B           VKDGR-----------------------------
2iw3A           VKDGR-----------------------------
2pzgB           LHEG------------------------------
1xmjA           LHEG------------------------------
2pzgA           LHEG------------------------------
2pzeB           LHEG------------------------------
2pzeA           LHEG------------------------------
1xmiE           LHEG------------------------------
1xmiC           LHEG------------------------------
1xmiA           LHEG------------------------------
2bboA           LHEG------------------------------
2zyoA           ----------------------------------
2zynA           ----------------------------------
2zymA           ----------------------------------
1ii8B           ----------------------------------
1f2uD           ----------------------------------
1f2uB           ----------------------------------
1f2tB           ----------------------------------
2awnD           ----------------------------------
2awoD           LDAGRVAQVGKPLELYHYPADRFVAGFI------