[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tthe0:AAS81275.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1a8hA.bssp"
#ERROR : Can't open dsspfile "2d5bA.bssp"
#ERROR : Can't open dsspfile "2d54A.bssp"
#ERROR : Can't open dsspfile "2ct8A.bssp"
#ERROR : Can't open dsspfile "2csxA.bssp"
#ERROR : Can't open dsspfile "1rqgA.bssp"
#ERROR : Can't open dsspfile "1pfwA.bssp"
#ERROR : Can't open dsspfile "1pfuA.bssp"
#ERROR : Can't open dsspfile "1f4lA.bssp"
#ERROR : Can't open dsspfile "1qqtA.bssp"
#ERROR : Can't open dsspfile "1pybA.bssp"
#ERROR : Can't open dsspfile "1pg0A.bssp"
#ERROR : Can't open dsspfile "1pg2A.bssp"
#ERROR : Can't open dsspfile "1mkhA.bssp"
#ERROR : Can't open dsspfile "1pxfA.bssp"
#ERROR : Can't open dsspfile "3ersX.bssp"
#ERROR : Can't open dsspfile "1ntgA.bssp"
#ERROR : Can't open dsspfile "2cwpA.bssp"
#ERROR : Can't open dsspfile "1fl0A.bssp"
#ERROR : Can't open dsspfile "1eujA.bssp"
#ERROR : Can't open dsspfile "1e7zA.bssp"
#ERROR : Can't open dsspfile "1gaxA.bssp"
#ERROR : Can't open dsspfile "2v0cA.bssp"
#ERROR : Can't open dsspfile "1obcA.bssp"
#ERROR : Can't open dsspfile "1h3nA.bssp"
#ERROR : Can't open dsspfile "2bteA.bssp"
#ERROR : Can't open dsspfile "1ileA.bssp"
#ERROR : Can't open dsspfile "1qu3A.bssp"
#ERROR : Can't open dsspfile "1ffyA.bssp"
#ERROR : Can't open dsspfile "2nzoA.bssp"
#ERROR : Can't open dsspfile "2nzhB.bssp"
#ERROR : Can't open dsspfile "2nzhA.bssp"
#ERROR : Can't open dsspfile "2e8gA.bssp"
#ERROR : Can't open dsspfile "3g48B.bssp"
#ERROR : Can't open dsspfile "3g48A.bssp"
#ERROR : Can't open dsspfile "1gd7A.bssp"
#ERROR : Can't open dsspfile "1obhA.bssp"
#ERROR : Can't open dsspfile "1wz2A.bssp"
#ERROR : Can't open dsspfile "1wkbA.bssp"
#ERROR : Can't open dsspfile "2q2iA.bssp"
#ERROR : Can't open dsspfile "2q2hA.bssp"
#ERROR : Can't open dsspfile "2q2iB.bssp"
#ERROR : Can't open dsspfile "1u0bB.bssp"
#ERROR : Can't open dsspfile "2q2hB.bssp"
#ERROR : Can't open dsspfile "1li5A.bssp"

## Summary of PDB Search
:618
      0.0  97%  1a8hA  [x.x.x] METHIONYL-TRNA SYNTHETASE
      0.0  97%  2d5bA  [x.x.x] METHIONYL-TRNA SYNTHETASE
      0.0  97%  2d54A  [x.x.x] METHIONYL-TRNA SYNTHETASE
    e-109  46%  2ct8A  [x.x.x] METHIONYL-TRNA SYNTHETASE
    e-108  46%  2csxA  [x.x.x] METHIONYL-TRNA SYNTHETASE
    7e-47  31%  1rqgA  [c.26.1 - g.41.1 - a.27.1] METHIONYL-TRNA SYNTHETASE
    8e-36  26%  1pfwA  [c.26.1 - g.41.1 - a.27.1] METHIONYL-TRNA SYNTHETASE
    8e-36  26%  1pfuA  [c.26.1 - g.41.1 - a.27.1] METHIONYL-TRNA SYNTHETASE
    8e-36  26%  1f4lA  [c.26.1 - g.41.1 - a.27.1] METHIONYL-TRNA SYNTHETASE
    8e-35  26%  1qqtA  [c.26.1 - g.41.1 - a.27.1] METHIONYL-TRNA SYNTHETASE
    5e-33  66%  1pybA  [b.40.4] METHIONYL-TRNA SYNTHETASE BETA SUBUNIT
    1e-32  27%  1pg0A  [c.26.1 - a.27.1] METHIONYL-TRNA SYNTHETASE
    2e-32  27%  1pg2A  [c.26.1 - a.27.1] METHIONYL-TRNA SYNTHETASE
    6e-27  51%  1mkhA  [b.40.4] C-TERMINAL DOMAIN OF METHIONYL-TRNA SYNTHETASE
    5e-17  37%  1pxfA  [b.40.4] HYPOTHETICAL PROTEIN YGJH
    5e-17  37%  3ersX  [x.x.x] TRNA-BINDING PROTEIN YGJH
    6e-17  48%  1ntgA  [b.40.4] TYROSYL-TRNA SYNTHETASE
    1e-16  44%  2cwpA  [x.x.x] METRS RELATED PROTEIN
    4e-15  37%  1fl0A  [b.40.4] ENDOTHELIAL-MONOCYTE ACTIVATING POLYPEPTIDE II
    4e-15  37%  1eujA  [b.40.4] ENDOTHELIAL MONOCYTE ACTIVATING POLYPEPTIDE 2
    4e-15  37%  1e7zA  [b.40.4] ENDOTHELIAL-MONOCYTE ACTIVATING POLYPEPTIDE II
    6e-14  28%  1gaxA  [c.26.1 - b.51.1 - a.27.1 - a.2.7] VALYL-TRNA SYNTHETASE
    7e-13  28%  2v0cA  [x.x.x] AMINOACYL-TRNA SYNTHETASE
    7e-13  28%  1obcA  [c.26.1 - b.51.1 - a.27.1] LEUCYL-TRNA SYNTHETASE
    7e-13  28%  1h3nA  [c.26.1 - b.51.1 - a.27.1] LEUCYL-TRNA SYNTHETASE
    7e-13  28%  2bteA  [x.x.x] LEUCYL-TRNA SYNTHETASE
    6e-11  28%  1ileA  [c.26.1 - b.51.1 - a.27.1 (1jzqA)] ISOLEUCYL-TRNA SYNTHETASE
    2e-09  31%  1qu3A  [c.26.1 - b.51.1 - a.27.1] ISOLEUCYL-TRNA SYNTHETASE
    2e-09  31%  1ffyA  [c.26.1 - b.51.1 - a.27.1] ISOLEUCYL-TRNA SYNTHETASE
    5e-09  31%  2nzoA  [x.x.x] PROTEIN CSAA
    5e-09  31%  2nzhB  [x.x.x] PROTEIN CSAA
    5e-09  31%  2nzhA  [x.x.x] PROTEIN CSAA
    5e-09  47%  2e8gA  [x.x.x] HYPOTHETICAL PROTEIN PH0536
    1e-08  34%  3g48B  [x.x.x] CHAPERONE CSAA
    2e-08  32%  3g48A  [x.x.x] CHAPERONE CSAA
    7e-08  37%  1gd7A  [b.40.4] CSAA PROTEIN
    3e-07  32%  1obhA  [c.26.1 - b.51.1 - a.27.1] LEUCYL-TRNA SYNTHETASE
    6e-07  28%  1wz2A  [x.x.x] LEUCYL-TRNA SYNTHETASE
    6e-07  28%  1wkbA  [x.x.x] LEUCYL-TRNA SYNTHETASE
    1e-06  33%  2q2iA  [x.x.x] SECRETION CHAPERONE
    1e-06  33%  2q2hA  [x.x.x] SECRETION CHAPERONE, PHAGE-DISPLAY DERIVED
    5e-06  32%  2q2iB  [x.x.x] SECRETION CHAPERONE
    8e-06  30%  1u0bB  [c.26.1 - a.27.1] CYSTEINYL TRNA
    8e-06  33%  2q2hB  [x.x.x] SECRETION CHAPERONE, PHAGE-DISPLAY DERIVED
    8e-06  30%  1li5A  [c.26.1 - a.27.1] CYSTEINYL-TRNA SYNTHETASE
:618

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MEKVFYVTTPIYYVNAEPHLGHAYTTVVADFLARWHRLDGYRTFFLTGTDEHGETVYRAAQAAGEDPKAF
1a8hA           MEKVFYVTTPIYYVNAEPHLGHAYTTVVADFLARWHRLDGYRTFFLTGTDEHGETVYRAAQAAGEDPKAF
2d5bA           MEKVFYVTTPIYYVNAEPHLGHAYTTVVADFLARWHRLDGYRTFFLTGTDEHGETVYRAAQAAGEDPKAF
2d54A           MEKVFYVTTPIYYVNAEPHLGHAYTTVVADFLARWHRLDGYRTFFLTGTDEHGETVYRAAQAAGEDPKAF
2ct8A           --KKFYVTTPIYYVNDVPHLGHAYTTIAADTIARYYRLRDYDVFFLTGTDEHGLKIQKKAEELGISPKEL
2csxA           --KKFYVTTPIYYVNDVPHLGHAYTTIAADTIARYYRLRDYDVFFLTGTDEHGLKIQKKAEELGISPKEL
1rqgA           ----YMVTSALPYANGPIHAGHAGAYLPADIFVRYLRLKGEDVVFICGTDEHGTPISFRALKEGRSPREI
1pfwA           --KKILVTCALPYANGSIHLGHMLEHIQADVWVRYQRMRGHEVNFICADDAHGTPIMLKAQQLGITPEQM
1pfuA           --KKILVTCALPYANGSIHLGHMLEHIQADVWVRYQRMRGHEVNFICADDAHGTPIMLKAQQLGITPEQM
1f4lA           --KKILVTCALPYANGSIHLGHMLEHIQADVWVRYQRMRGHEVNFICADDAHGTPIMLKAQQLGITPEQM
1qqtA           --KKILVTCALPYANGSIHLGHMLEHIQADVWVRYQRMRGHEVNFICADDAHGTPIMLKAQQLGITPEQM
1pybA           ----------------------------------------------------------------------
1pg0A           --KKILVTCALPYANGSIHLGHMLEHIQADVWVRYQRMRGHEVNFICADDAHGTPIMLKAQQLGITPEQM
1pg2A           --KKILVTCALPYANGSIHLGHMLEHIQADVWVRYQRMRGHEVNFICADDAHGTPIMLKAQQLGITPEQM
1mkhA           ----------------------------------------------------------------------
1pxfA           ----------------------------------------------------------------------
3ersX           ----------------------------------------------------------------------
1ntgA           ----------------------------------------------------------------------
2cwpA           ----------------------------------------------------------------------
1fl0A           ----------------------------------------------------------------------
1eujA           ----------------------------------------------------------------------
1e7zA           ----------------------------------------------------------------------
1gaxA           ----FVIFMPPPNVTGSLHMGHALDNSLQDALIRYKRMRGFEAVWLPGTDHAG-----------------
2v0cA           -----YVLVMFPYPSGDLHMGHLKNYTMGDVLARFRRMQGYEVLHPMGWDAFGLPAENAALKFGVHPKDW
1obcA           -----YVLVMFPYPSGDLHMGHLKNYTMGDVLARFRRMQGYEVLHPMGWDAFGLPAENAALKFGVHPKDW
1h3nA           -----YVLVMFPYPSGDLHMGHLKNYTMGDVLARFRRMQGYEVLHPMGWDAFGLPAENAALKFGVHPKDW
2bteA           -----YVLVMFPYPSGDLHMGHLKNYTMGDVLARFRRMQGYEVLHPMGWDAFGLPAENAALKFGVHPKDW
1ileA           ----------------------------------------------------------------------
1qu3A           ------------YANGNLHMGHALNKILKDFIVRYKTMQGFYAPYVPGWDTHGLPIEQALTKKGVDRK--
1ffyA           ------------YANGNLHMGHALNKILKDFIVRYKTMQGFYAPYVPGWDTHGLPIEQALTKKGVDRK--
2nzoA           ----------------------------------------------------------------------
2nzhB           ----------------------------------------------------------------------
2nzhA           ----------------------------------------------------------------------
2e8gA           ----------------------------------------------------------------------
3g48B           ----------------------------------------------------------------------
3g48A           ----------------------------------------------------------------------
1gd7A           ----------------------------------------------------------------------
1obhA           -----YVLVMFPYPSGDLHMGHLKNYTMGDVLARFRRMQGYEVLHPMGWDAFGLPAENAALKFGVHPKDW
1wz2A           -EKKFYITVAFPYLSGHLHVGHARTYTIPDVIARFKRMQGYNVLFPMAWHITGSPIVGIAEIKNRDPK--
1wkbA           -EKKFYITVAFPYLSGHLHVGHARTYTIPDVIARFKRMQGYNVLFPMAWHITGSPIVGIAEIKNRDPK--
2q2iA           ----------------------------------------------------------------------
2q2hA           ----------------------------------------------------------------------
2q2iB           ----------------------------------------------------------------------
1u0bB           ------------------HIGHGRTFVAFDVVARYLRFLGYKLKYVRNITDIDDKIIKRANENGESFVAM
2q2hB           ----------------------------------------------------------------------
1li5A           ------------------HIGHGRTFVAFDVVARYLRFLGYKLKYVRNITDIDDKIIKRANENGESFVAM


                         .         .         *         .         .         .         .:140
query           VDRVSGRFKRAWDLLGIAYDDFIRTTEERHXXXXXXXXXXXYEAGDIYYGEYEGLYCVSCERFYTEKELV
1a8hA           VDRVSGRFKRAWDLLGIAYDDFIRTTEERHXXXXXXXXXXXYEAGDIYYGEYEGLYCVSCERFYTEKELV
2d5bA           VDRVSGRFKRAWDLLGIAYDDFIRTTEERHXXXXXXXXXXXYEAGDIYYGEYEGLYCVSCERFYTEKELV
2d54A           VDRVSGRFKRAWDLLGIAYDDFIRTTEERHXXXXXXXXXXXYEAGDIYYGEYEGLYCVSCERFYTEKELV
2ct8A           VDRNAERFKKLWEFLKIEYTKFIRTTDPYHVKFVQKVFEECYKRGDIYLGEYE-----------------
2csxA           VDRNAERFKKLWEFLKIEYTKFIRTTDPYHVKFVQKVFEECYKRGDIYLGEY------------------
1rqgA           VDEFHEQIKITFQRAKISFDFFGRTELPIHYKLSQEFFLKAYENGHLVYCEHDKMFCEVCGRPLTPEILI
1pfwA           IGEMSQEHQTDFAGFNISYDNYHSTHSEENRQLSELIYSRLKENGFILYDPEKGMFCEVCGATYSPTELI
1pfuA           IGEMSQEHQTDFAGFNISYDNYHSTHSEENRQLSELIYSRLKENGFILYDPEKGMFCEVCGATYSPTELI
1f4lA           IGEMSQEHQTDFAGFNISYDNYHSTHSEENRQLSELIYSRLKENGFILYDPEKGMFCEVCGATYSPTELI
1qqtA           IGEMSQEHQTDFAGFNISYDNYHSTHSEENRQLSELIYSRLKENGFILYDPEKGMFCEVCGATYSPTELI
1pybA           ----------------------------------------------------------------------
1pg0A           IGEMSQEHQTDFAGFNISYDNYHSTHSEENRQLSELIYSRLKENGFIKNRTISQLYDRDSEHF-------
1pg2A           IGEMSQEHQTDFAGFNISYDNYHSTHSEENRQLSELIYSRLKENGFI-----------------------
1mkhA           ----------------------------------------------------------------------
1pxfA           ----------------------------------------------------------------------
3ersX           ----------------------------------------------------------------------
1ntgA           ----------------------------------------------------------------------
2cwpA           ----------------------------------------------------------------------
1fl0A           ----------------------------------------------------------------------
1eujA           ----------------------------------------------------------------------
1e7zA           ----------------------------------------------------------------------
1gaxA           ----------------------------------------------------------------------
2v0cA           TYANIRQAKESLRLMGILYDREVTTCEPEYYRWNQWIFLKMWEKGLAYRAKGLVNWCPKCQTVLANEQVV
1obcA           TYANIRQAKESLRLMGILYDREVTTCEPEYYRWNQWIFLKMWEKGLAYRAKGLVNWCPKCQTVLANEQVV
1h3nA           TYANIRQAKESLRLMGILYDREVTTCEPEYYRWNQWIFLKMWEKGLAYRAKGLVNWCPKCQTVLANEQVV
2bteA           TYANIRQAKESLRLMGILYDREVTTCEPEYYRWNQWIFLKMWEKGLAYRAKGLVNWCPKCQTVLANEQVV
1ileA           ----------------------------------------------------------------------
1qu3A           ----------------------------------------------------------------------
1ffyA           ----------------------------------------------------------------------
2nzoA           ----------------------------------------------------------------------
2nzhB           ----------------------------------------------------------------------
2nzhA           ----------------------------------------------------------------------
2e8gA           ----------------------------------------------------------------------
3g48B           ----------------------------------------------------------------------
3g48A           ----------------------------------------------------------------------
1gd7A           ----------------------------------------------------------------------
1obhA           TYANIRQAKESLRLMGILYD--------------------------------------------------
1wz2A           ----------------------------------------------------------------------
1wkbA           ----------------------------------------------------------------------
2q2iA           ----------------------------------------------------------------------
2q2hA           ----------------------------------------------------------------------
2q2iB           ----------------------------------------------------------------------
1u0bB           VDRMIAEMHKDFDALNILRPD-------------------------------------------------
2q2hB           ----------------------------------------------------------------------
1li5A           VDRMIAEMHKDFDALNILRPD-------------------------------------------------


                         +         .         .         .         .         *         .:210
query           EGLCPIHGRPVERRKEGNYFFRMEKYRPWLQEYIQENPDLIRPEGYRNEVLAMLAEPIGDLSISRPKSRV
1a8hA           EGLCPIHGRPVERRKEGNYFFRMEKYRPWLQEYIQENPDLIRPEGYRNEVLAMLAEPIGDLSISRPKSRV
2d5bA           EGLCPIHGRPVERRKEGNYFFRMEKYRPWLQEYIQENPDLIRPEGYRNEVLAMLAEPIGDLSISRPKSRV
2d54A           EGLCPIHGRPVERRKEGNYFFRMEKYRPWLQEYIQENPDLIRPEGYRNEVLAMLAEPIGDLSISRPKSRV
2ct8A           --------------KEPSYFFRLSKYQDKLLELYEKNPEFIQPDYRRNEIISFVKQGLKDLSVTRPRSRV
2csxA           --------------KEPSYFFRLSKYQDKLLELYEKNPEFIQPDYRRNEIISFVKQGLKDLSVTRPRSRV
1rqgA           NPRCAICGRPISFRDSAHYYIKMQDFAERLKRWIEKQP---WKPNVKNMVLSWIEEGLEERAITRD---L
1pfwA           EPKSVVSGATPVMRDSEHFFFDLPSFSEMLQAWTRSG---ALQEQVANKMQEWFESGLQQWDISRDAPY-
1pfuA           EPKSVVSGATPVMRDSEHFFFDLPSFSEMLQAWTRSG---ALQEQVANKMQEWFESGLQQWDISRDAPY-
1f4lA           EPKSVVSGATPVMRDSEHFFFDLPSFSEMLQAWTRSG---ALQEQVANKMQEWFESGLQQWDISRDAPY-
1qqtA           EPKSVVSGATPVMRDSEHFFFDLPSFSEMLQAWTRSG---ALQEQVANKMQEWFESGLQQWDISRDAPY-
1pybA           ----------------------------------------------------------------------
1pg0A           -------------------FFDLPSFSEMLQAWTRSGA---LQEQVANKMQEWFESGLQQWDISRDAPY-
1pg2A           ------KNRTISRDSE-HFFFDLPSFSEMLQAWTRSGA---LQEQVANKMQEWFESGLQQWDISRDAPY-
1mkhA           ----------------------------------------------------------------------
1pxfA           ----------------------------------------------------------------------
3ersX           ----------------------------------------------------------------------
1ntgA           ----------------------------------------------------------------------
2cwpA           ----------------------------------------------------------------------
1fl0A           ----------------------------------------------------------------------
1eujA           ----------------------------------------------------------------------
1e7zA           ----------------------------------------------------------------------
1gaxA           ----PLAEEVLKGLRRGDIAFVPERWKKVNMDWLENVKDISRQLWWGHQIPAWYCEDCQAVNVPRPESCE
2v0cA           EGRCWRHDTPVEKRELEQWYLRITAY--------------------------------------------
1obcA           EGRCWRHDTPVEKRELEQWYLRITAY--------------------------------------------
1h3nA           EGRCWRHDTPVEKRELEQWYLRITAY--------------------------------------------
2bteA           EGRCWRHDTPVEKRELEQWYLRITAY--------------------------------------------
1ileA           ----------------------------------------------------------------------
1qu3A           ----------------------ISRQRVWLPVFYAENGEIIMTKETVNHVADLFAEHGSNIWFEREKDLL
1ffyA           ----------------------ISRQRVWLPVFYAENGEIIMTKETVNHVADLFAEHGSNIWFEREKDLL
2nzoA           ----------------------------------------------------------------------
2nzhB           ----------------------------------------------------------------------
2nzhA           ----------------------------------------------------------------------
2e8gA           ----------------------------------------------------------------------
3g48B           ----------------------------------------------------------------------
3g48A           ----------------------------------------------------------------------
1gd7A           ----------------------------------------------------------------------
1obhA           ----------------------------------------------------------------------
1wz2A           ----------------------------------------------------------------------
1wkbA           ----------------------------------------------------------------------
2q2iA           ----------------------------------------------------------------------
2q2hA           ----------------------------------------------------------------------
2q2iB           ----------------------------------------------------------------------
1u0bB           ----------------------------------------------------------------------
2q2hB           ----------------------------------------------------------------------
1li5A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           PWGIPLPWDENHVTYVWFDALLNYVSALDYPEGEAYRTFWPHAWHLIGKDILKPHAVFWPTMLKAAGIPM
1a8hA           PWGIPLPWDENHVTYVWFDALLNYVSALDYPEGEAYRTFWPHAWHLIGKDILKPHAVFWPTMLKAAGIPM
2d5bA           PWGIPLPWDENHVTFVWFDALLNYVSALDYPEGEAYRTFWPHAWHLIGKDILKPHAVFWPTMLKAAGIPM
2d54A           PWGIPLPWDENHVTAVWFDALLNYVSALDYPEGEAYRTFWPHAWHLIGKDILKPHAVFWPTMLKAAGIPM
2ct8A           KWGIPVPFDPEHTIYVWFDALFNYISALE----DKVEIYWPADLHLVGKDILRFHTVYWPAFLMSLGYEL
2csxA           KWGIPVPFDPEHTIYVWFDALFNYISALE----DKVEIYWPADLHLVGKDILRFHTVYWPAFLMSLGYEL
1rqgA           NWGIPVPLDEGKVLYVWFEAPIGYISTIEHFKRIGKPNEWKKYWHFIGKDNIPFHAIFWPAFLMAYGIPA
1pfwA           -FGFEIPNAPGKYFYVWLDAPIGYMGSFKRGDSVSFDEYWAELYHFIGKDIVYFHSLFWPAMLEGSNFRK
1pfuA           -FGFEIPNAPGKYFYVWLDAPIGYMGSFKRGDSVSFDEYWAELYHFIGKDIVYFHSLFWPAMLEGSNFRK
1f4lA           -FGFEIPNAPGKYFYVWLDAPIGYMGSFKRGDSVSFDEYWAELYHFIGKDIVYFHSLFWPAMLEGSNFRK
1qqtA           -FGFEIPNAPGKYFYVWLDAPIGYMGSFKRGDSVSFDEYWAELYHFIGKDIVYFHSLFWPAMLEGSNFRK
1pybA           ----------------------------------------------------------------------
1pg0A           -FGFEIPNAPGKYFYVWLDAPIGYMGSFKNGDSVSFDEYWKELYHFIGKDIVYFHSLFWPAMLEGSNFRK
1pg2A           -FGFEIPNAPGKYFYVWLDAPIGYMGSFKNGDSVSFDEYWKELYHFIGKDIVYFHSLFWPAMLEGSNFRK
1mkhA           ----------------------------------------------------------------------
1pxfA           ----------------------------------------------------------------------
3ersX           ----------------------------------------------------------------------
1ntgA           ----------------------------------------------------------------------
2cwpA           ----------------------------------------------------------------------
1fl0A           ----------------------------------------------------------------------
1eujA           ----------------------------------------------------------------------
1e7zA           ----------------------------------------------------------------------
1gaxA           ACGSPRLKRDEDVFDTWFSSALWPLSTLGWPEEEDLKAFYPGDVLVTGYDIL----FLWVSRMEVSGYHF
2v0cA           ----------------------------------------------------------------------
1obcA           ----------------------------------------------------------------------
1h3nA           ----------------------------------------------------------------------
2bteA           ----------------------------------------------------------------------
1ileA           -----------YVIDVWYDSGAMPFASLHYPHEEVFRESFPADFIAEGIDQTRG----WFNSLHQLGVML
1qu3A           PEGFTHPGSPNDIMDVWFDSGSSHRGVLETPE-----LSFPADMYLEGSDQYRG----WTTSVATRGVSP
1ffyA           PEGFTHPGSPNDIMDVWFDSGSSHRGVLETPE-----LSFPADMYLEGSDQYRG----WTTSVATRGVSP
2nzoA           ----------------------------------------------------------------------
2nzhB           ----------------------------------------------------------------------
2nzhA           ----------------------------------------------------------------------
2e8gA           ----------------------------------------------------------------------
3g48B           ----------------------------------------------------------------------
3g48A           ----------------------------------------------------------------------
1gd7A           ----------------------------------------------------------------------
1obhA           ----------------------------------------------------------------------
1wz2A           ---------------------------------EEFEYWYPLDWRCSGKDLIPNHLTFF--IFNHVAIFR
1wkbA           ---------------------------------EEFEYWYPLDWRCSGKDLIPNHLTFF--IFNHVAIFR
2q2iA           ----------------------------------------------------------------------
2q2hA           ----------------------------------------------------------------------
2q2iB           ----------------------------------------------------------------------
1u0bB           ----------------------------------------------------------------------
2q2hB           ----------------------------------------------------------------------
1li5A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           YRHLNVGGFLLGPDGRKMSKTLGNVVDPFALLEKYGRDALRYYLLREIPYGQDTPVSEEALRTRYEADLA
1a8hA           YRHLNVGGFLLGPDGRKMSKTLGNVVDPFALLEKYGRDALRYYLLREIPYGQDTPVSEEALRTRYEADLA
2d5bA           YRHLNVGGFLLGPDGRKMSKTLGNVVDPFALLEKYGRDALRYYLLREIPYGQDTPVSEEALRTRYEADLA
2d54A           YRHLNVGGFLLGPDGRKMSKTLGNVVDPFALLEKYGRDALRYYLLREIPYGQDTPVSEEALRTRYEADLA
2ct8A           PKKVFAHGWWT-VEGKKMSKTLGNVVDPYEVVQEYGLDEVRYFLLREVPFGQDGDFSKKAILNRINGELA
2csxA           PKKVFAHGWWT-VEGKKMSKTLGNVVDPYEVVQEYGLDEVRYFLLREVPFGQDGDFSKKAILNRINGELA
1rqgA           NEYLTL-------EGKKFSTSRNWAIWVHEFLDVFPADYLRYYLTTIMPETRDSDFSFSDFKVRINEELV
1pfwA           PSNLFVHGYVT-VNGAKMSKSRGTFIKASTWLNHFDADSLRYYYTAKLSSRDDIDLNLEDFVQRVNADIV
1pfuA           PSNLFVHGYVT-VNGAKMSKSRGTFIKASTWLNHFDADSLRYYYTAKLSSRDDIDLNLEDFVQRVNADIV
1f4lA           PSNLFVHGYVT-VNGAKMSKSRGTFIKASTWLNHFDADSLRYYYTAKLSSRDDIDLNLEDFVQRVNADIV
1qqtA           PSNLFVHGYVT-VNGAKMSKSRGTFIKASTWLNHFDADSLRYYYTAKLSSRDDIDLNLEDFVQRVNADIV
1pybA           ----------------------------------------------------------------------
1pg0A           PSNLFVHGYVT-VNGAKMSKSRGTFIKASTWLNHFDADSLRYYYTAKLSSRDDIDLNLEDFVQRVNADIV
1pg2A           PSNLFVHGYVT-VNGAKMSKSRGTFIKASTWLNHFDADSLRYYYTAKLSSRDDIDLNLEDFVQRVNADIV
1mkhA           ----------------------------------------------------------------------
1pxfA           ----------------------------------------------------------------------
3ersX           ----------------------------------------------------------------------
1ntgA           ----------------------------------------------------------------------
2cwpA           ----------------------------------------------------------------------
1fl0A           ----------------------------------------------------------------------
1eujA           ----------------------------------------------------------------------
1e7zA           ----------------------------------------------------------------------
1gaxA           FKTVLLHGLVLDEKGQKMSKSKGNVIDPLEMVERYGADALRFALIYLATGGQDIRLDLRWL------EMA
2v0cA           ----------------------------------------------------------------------
1obcA           ----------------------------------------------------------------------
1h3nA           ----------------------------------------------------------------------
2bteA           ----------------------------------------------------------------------
1ileA           FKNVICHGLILDEKGQKMSKSKGNVVDPWDIIRKFGADALRWYIYVSAPPEADRRFGPNLVRETVR-DYF
1qu3A           YKFLLSHGFVMDGEGKKMSKSLGNVIVPDQVVKQKGADIARLW-VSSTDYLADVRISDEILK-----QTS
1ffyA           YKFLLSHGFVMDGEGKKMSKSLGNVIVPDQVVKQKGADIARLW-VSSTDYLADVRISDEILK-----QTS
2nzoA           ----------------------------------------------------------------------
2nzhB           ----------------------------------------------------------------------
2nzhA           ----------------------------------------------------------------------
2e8gA           ----------------------------------------------------------------------
3g48B           ----------------------------------------------------------------------
3g48A           ----------------------------------------------------------------------
1gd7A           ----------------------------------------------------------------------
1obhA           ----------------------------------------------------------------------
1wz2A           EEHWPKGIAVNGLEGQKMSKSKGNVLNFIDAIEENGADVVRLYIMSLAEHDSDFD---------WRRKEV
1wkbA           EEHWPKGIAVNGLEGQKMSKSKGNVLNFIDAIEENGADVVRLYIMSLAEHDSDFD---------WRRKEV
2q2iA           ----------------------------------------------------------------------
2q2hA           ----------------------------------------------------------------------
2q2iB           ----------------------------------------------------------------------
1u0bB           ----------------------------------------------------------------------
2q2hB           ----------------------------------------------------------------------
1li5A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           DDLGNLVQRTRAMLFRFAEGRIPEPVAGEELAEGTGLAKRLRPLVRELKFHVALEEAMAYVKALNRYINE
1a8hA           DDLGNLVQRTRAMLFRFAEGRIPEPVXXXXXXXXXXXXXXXXPLVRELKFHVALEEAMAYVKALNRYINE
2d5bA           DDLGNLVQRTRAMLFRFAEGRIPEPVXXXXXXXXXXXXXXXXPLVRELKFHVALEEAMAYVKALNRYINE
2d54A           DDLGNLVQRTRAMLFRFAEGRIPEPVXXXXXXXXXXXXXXXXPLVRELKFHVALEEAMAYVKALNRYINE
2ct8A           NEIGNLYSRVVNMAHKFLGGEVSGARDEEYAKIAQESIKNYENYMEKVNFYKAIEEILKFTSYLNKYVDE
2csxA           NEIGNLYSRVVNMAHKFLGGEVSGARDEEYAKIAQESIKNYENYMEKVNFYKAIEEILKFTSYLNKYVDE
1rqgA           NNLGNFVHRALTFVNRYFDGVVPXXXXXXXXXXXXXXXKEVGELIMNYRFKDALKRVMSLASFGNRYFDH
1pfwA           NKVVNLASRNAGFINKRFDGVLASELADPQLYKTTDAAEVIGEAWESREFGKAVREIMALADLANRYVDE
1pfuA           NKVVNLASRNAGFINKRFDGVLASELADPQLYKTTDAAEVIGEAWESREFGKAVREIMALADLANRYVDE
1f4lA           NKVVNLASRNAGFINKRFDGVLASELADPQLYKTTDAAEVIGEAWESREFGKAVREIMALADLANRYVDE
1qqtA           NKVVNLASRNAGFINKRFDGVLASELADPALYKTTDAAEVIGEAWESREFGKAVREIMALADLANRYVDE
1pybA           ----------------------------------------------------------------------
1pg0A           NKVVNLASRNAGFINKRFDGVLASELADPQLYKTTDAAEVIGEAWESREFGKAVREIMALADLANRYVDE
1pg2A           NKVVNLASRNAGFINKRFDGVLASELADPQLYKTTDAAEVIGEAWESREFGKAVREIMALADLANRYVDE
1mkhA           ----------------------------------------------------------------------
1pxfA           ----------------------------------------------------------------------
3ersX           ----------------------------------------------------------------------
1ntgA           ----------------------------------------------------------------------
2cwpA           ----------------------------------------------------------------------
1fl0A           ----------------------------------------------------------------------
1eujA           ----------------------------------------------------------------------
1e7zA           ----------------------------------------------------------------------
1gaxA           RNFANKLYNAARFVLLSREGKEDTPTLADRF-----MRSRLSRGVEEIALYEALDLAQAAREVYELVWSE
2v0cA           ----------------------------------------------------------------------
1obcA           ----------------------------------------------------------------------
1h3nA           ----------------------------------------------------------------------
2bteA           ----------------------------------------------------------------------
1ileA           LTLWNVYSVTYANLDRPDLKNPPPPEKRPEM--DRWLLARMQDLIQRVTEALEAYDPTTSARALRDFVNR
1qu3A           DDYRKIRNTLRFML--------------------------------------------------------
1ffyA           DDYRKIRNTLRFML--------------------------------------------------------
2nzoA           ----------------------------------------------------------------------
2nzhB           ----------------------------------------------------------------------
2nzhA           ----------------------------------------------------------------------
2e8gA           ----------------------------------------------------------------------
3g48B           ----------------------------------------------------------------------
3g48A           ----------------------------------------------------------------------
1gd7A           ----------------------------------------------------------------------
1obhA           ----------------------------------------------------------------------
1wz2A           GKLRKQIERFYELISQFAEYEVKGNVELKDI--DRWMLHRLNKAIKETT--NALEERTAVQWAFYSIMND
1wkbA           GKLRKQIERFYELISQFAEYEVKGNVELKDI--DRWMLHRLNKAIKETT--NALEERTAVQWAFYSIMND
2q2iA           ----------------------------------------------------------------------
2q2hA           ----------------------------------------------------------------------
2q2iB           ----------------------------------------------------------------------
1u0bB           ----------------------------------------------------------------------
2q2hB           ----------------------------------------------------------------------
1li5A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           KKPWELFKKEPEEARAVLYRVVEGLRIASILLTPAMPDKMAELRRALGLKEEVRLEEAERWGLAEPRPIP
1a8hA           KKPWELFKKEPEEARAVLYRVVEGLRIASILLTPAMPDKMAELRRALGLKEEVRLEEAERWGLAEPRPIP
2d5bA           KKPWELFKKEPEEARAVLYRVVEGLRIASILLTPAMPDKMAELRRALGLKEEVRLEEAERWGLAEPRPIP
2d54A           KKPWELFKKEPEEARAVLYRVVEGLRIASILLTPAMPDKMAELRRALGLKEEVRLEEAERWGLAEPRPIP
2ct8A           KQPWALNKRKKEELQKVLYALVDGLFVLTHLLYPITPNKMKEALQMLGEKE-------------------
2csxA           KQPWALNKRKKEELQKVLYALVDGLFVLTHLLYPITPNKMKEALQMLGEKE-------------------
1rqgA           KQPWKTAKEDKVRTGTTVNISLQIVKALGILLEPFLPDASEKIWHLLNLDEVKRWEFRE-----------
1pfwA           QAPWVVAKQEGRDAQAICSMGINLFRVLMTYLKPVLP-KLTERAEA------------------------
1pfuA           QAPWVVAKQEGRDAQAICSMGINLFRVLMTYLKPVLP-KLTERAEA------------------------
1f4lA           QAPWVVAKQEGRDAQAICSMGINLFRVLMTYLKPVLP-KLTERAEA------------------------
1qqtA           QAPWVVAKQAGRDAQAICSMGINLFRVLMTYLKPVLP-KLTERAEA------------------------
1pybA           ----------------------------------------------------------------------
1pg0A           QAPWVVAKQEGRDAQAICSMGINLFRVLMTYLKPVLP-KLTERAEA------------------------
1pg2A           QAPWVVAKQEGRDAQAICSMGINLFRVLMTYLKPVLP-KLTERAEA------------------------
1mkhA           ----------------------------------------------------------------------
1pxfA           ----------------------------------------------------------------------
3ersX           ----------------------------------------------------------------------
1ntgA           ----------------------------------------------------------------------
2cwpA           ----------------------------------------------------------------------
1fl0A           ----------------------------------------------------------------------
1eujA           ----------------------------------------------------------------------
1e7zA           ----------------------------------------------------------------------
1gaxA           FCDWYLEAAKPALKAGTLRTXXXXXXXXXXXXHPMMPFLTSELYQALTGKEELAL---EAW--PEPGGRD
2v0cA           ----------------------------------------------------------------------
1obcA           ----------------------------------------------------------------------
1h3nA           ----------------------------------------------------------------------
2bteA           ----------------------------------------------------------------------
1ileA           RRFWK--NEDALDREAAYATLYEALVLVATLAAPFTPFLAEVLWQ--NLVRSVRLEAKESVHLAD---WP
1qu3A           ----------------------------------------------------------------------
1ffyA           ----------------------------------------------------------------------
2nzoA           ----------------------------------------------------------------------
2nzhB           ----------------------------------------------------------------------
2nzhA           ----------------------------------------------------------------------
2e8gA           ----------------------------------------------------------------------
3g48B           ----------------------------------------------------------------------
3g48A           ----------------------------------------------------------------------
1gd7A           ----------------------------------------------------------------------
1obhA           ----------------------------------------------------------------------
1wz2A           LR-WYLRRTEDDEAKRYVLRTLADVWVR--LMAPFTPHICEELWEKLG----------------------
1wkbA           LR-WYLRRTEDDEAKRYVLRTLADVWVR--LMAPFTPHICEELWEKLG----------------------
2q2iA           ----------------------------------------------------------------------
2q2hA           ----------------------------------------------------------------------
2q2iB           ----------------------------------------------------------------------
1u0bB           ----------------------------------------------------------------------
2q2hB           ----------------------------------------------------------------------
1li5A           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           EEAPVLFxxxxxxxxxxxxxxxWIGIEDFAKVELRVAEVLAAEKHPNADRLLVLRLSLGNEERTVVSGIA
1a8hA           EEAPVLF---------------------------------------------------------------
2d5bA           EEAPVLF---------------------------------------------------------------
2d54A           EEAPVLF---------------------------------------------------------------
2ct8A           ----------------------------------------------------------------------
2csxA           ----------------------------------------------------------------------
1rqgA           ----------------------------------------------------------------------
1pfwA           ----------------------------------------------------------------------
1pfuA           ----------------------------------------------------------------------
1f4lA           ----------------------------------------------------------------------
1qqtA           ----------------------------------------------------------------------
1pybA           -----------------------IGIEDFLKVDLRVAKVLSAERVEGSEKLLKLTLSLGDEERTVVAGIA
1pg0A           ----------------------------------------------------------------------
1pg2A           ----------------------------------------------------------------------
1mkhA           ----------------------YVKFDDFAKLDLRVGKIIEVKDHPNADKLYVVKVDLGDEVRTLVAGLK
1pxfA           -----------------------VAYADFARLEMRVGKIVEVKRHENADKLYIVQVDVGQKTLQTVTSLV
3ersX           -----------------------VAYADFARLEMRVGKIVEVKRHENADKLYIVQVDVGQKTLQTVTSLV
1ntgA           -----------------------------SRLDIRVGKIITVEKHPDADSLYVEKIDVGEAERTVVSGLV
2cwpA           -------------------------VDEFWKFQMKVGLVXXXXXXXXXXXXXXXXVDFGNEERTIVTGIA
1fl0A           ---------------------------DVSRLDLRIGCIITARKHPDADSLYVEEVDVGEAPRTVVSGLV
1eujA           ---------------------------DVSRLDLRIGCIITARKHPDADSLYVEEVDVGEAPRTVVSGLV
1e7zA           ---------------------------DVSRLDLRIGCIITARKHPDADSLYVEEVDVGEAPRTVVSGLV
1gaxA           EEAERAF---------------------------------------------------------------
2v0cA           ----------------------------------------------------------------------
1obcA           ----------------------------------------------------------------------
1h3nA           ----------------------------------------------------------------------
2bteA           ----------------------------------------------------------------------
1ileA           EADPAL----------------------------------------------------------------
1qu3A           ----------------------------------------------------------------------
1ffyA           ----------------------------------------------------------------------
2nzoA           -------------------------IDDFEKLDIRTGTIVKAEEFPEARPAIKLVIDFGTEIGIKQSSIT
2nzhB           -------------------------IDDFEKLDIRTGTIVKAEEFPEARPAIKLVIDFGTEIGIKQSSIT
2nzhA           -------------------------IDDFEKLDIRTGTIVKAEEFPEARPAIKLVIDFGTEIGIKQSSIT
2e8gA           -------------------------------VDIVVGEVMSVGKHPSADRLLVTNVNIGERAVTVVT---
3g48B           --------------------------EDFLTLDLRIGTVTHAEEFP-AIRLEIDFGELGMKQSS--AQIT
3g48A           --------------------------EDFLTLDLRIGTVTHAEEFKEA-RVPAIRLEIDFGEKQSSAQIT
1gd7A           -------------------------LEAFQILDLRVGRVLRAEPHEKARKLWVDLGPLGVKQSS--AQIT
1obhA           ----------------------------------------------------------------------
1wz2A           ----------------------------------------------------------------------
1wkbA           ----------------------------------------------------------------------
2q2iA           -----------------------ISYADFEKVDIRVGTIVEAVPFPEARKPAIVKIDFGPEIGIKKSSIT
2q2hA           -----------------------ISYADFEKVDIRVGTIVEAVPFPEARKPAIVKIDFGPEIGIKKSSIT
2q2iB           -----------------------ISYADFEKVDIRVGTIVEAVPFP--EPAIKVKIDFGPEIGIKKSSIT
1u0bB           ----------------------------------------------------------------------
2q2hB           -----------------------ISYADFEKVDIRVGTIVEAVPFP----AIKVKIDFGPEIGIKKSSIT
1li5A           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           KWYRPEELVGKKVVLVANLKPAKLRGIESQGMILAAQEGEALALVTVEGEVPPGAVVK
1a8hA           ----------------------------------------------------------
2d5bA           ----------------------------------------------------------
2d54A           ----------------------------------------------------------
2ct8A           ----------------------------------------------------------
2csxA           ----------------------------------------------------------
1rqgA           ----------------------------------------------------------
1pfwA           ----------------------------------------------------------
1pfuA           ----------------------------------------------------------
1f4lA           ----------------------------------------------------------
1qqtA           ----------------------------------------------------------
1pybA           KYYTPEELVGKKIVIVANLKPRKIFGIESQGMILAASDGENLSVIVPDRDVKEGA---
1pg0A           ----------------------------------------------------------
1pg2A           ----------------------------------------------------------
1mkhA           KYYKPEELLNRYVVVVANLEPKKL-GIGSQGMLLAADDGERVALLMPDKEVKLGAKVR
1pxfA           PYYSEEELMGKTVVVLCNLQKAKMRGETSECMLLCAEDGSESVLLTPERMMPAGVRV-
3ersX           PYYSEEELMGKTVVVLCNLQKAKMRGETSECMLLCAEDGSESVLLTPERMMPAGVRV-
1ntgA           QFVPKEELQDRLVVVLCNLKPQKMRGVESQGMLLCA----------------------
2cwpA           DQIPPEELEGKKFIFVVNLKPKKFSGVESQGMILAETEDGKVYLIPVPEEVPVGARV-
1fl0A           NHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGSVPG----
1eujA           NHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGSVPG----
1e7zA           NHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGSVPG----
1gaxA           ----------------------------------------------------------
2v0cA           ----------------------------------------------------------
1obcA           ----------------------------------------------------------
1h3nA           ----------------------------------------------------------
2bteA           ----------------------------------------------------------
1ileA           ----------------------------------------------------------
1qu3A           ----------------------------------------------------------
1ffyA           ----------------------------------------------------------
2nzoA           KRYKPEGLINKQVIAVVNFPPRRIAGFKSEVLVLGGIPGQGVVLLQPDQPVPNGTKI-
2nzhB           KRYKPEGLINKQVIAVVNFPPRRIAGFKSEVLVLGGIPGQGVVLLQPDQPVPNGTKI-
2nzhA           KRYKPEGLINKQVIAVVNFPPRRIAGFKSEVLVLGGIPGQGVVLLQPDQPVPNGTKI-
2e8gA           -----NDLTVKERVAVALLPPRNFFGIVSEGMFLGAGEG---VLKNVKGEI-------
3g48B           KRYNPEDLIGQQIVAVVNFPPKRVAGFKSEVLVLGVPEAGDVVLLQPNMELPNGTKI-
3g48A           KRYNPEDLIGQQIVAVVNFPPKRVAGFKSEVLVLGVPEAGDVVLLQPNMELPNGTKI-
1gd7A           ELYRPEDLVGRLVVCAVNLGAKRVAGFLSEVLVLGVDEAGRVVLLAPDREVPLGGKV-
1obhA           ----------------------------------------------------------
1wz2A           ----------------------------------------------------------
1wkbA           ----------------------------------------------------------
2q2iA           VHYTPESLVGRQVLGVVNFPPRQIGPFRSEVLTLGADANGDIVLAAVERPVPNG----
2q2hA           VHYTPESLVGRQVLGVVNFPPRQIGPFRSEVLTLGADANGDIVLAAVERPVPNG----
2q2iB           VHYTPESLVGRQVLGVVNFPPRQIGPFRSEVLTLGADANGDIVLAAVERPVPNG----
1u0bB           ----------------------------------------------------------
2q2hB           VHYTPESLVGRQVLGVVNFPPRQIGPFRSEVLTLGADANGDIVLAAVERPVPNG----
1li5A           ----------------------------------------------------------