[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tthe0:livG.4

[Show Plain Result]

#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1gajA.bssp"
#ERROR : Can't open dsspfile "1g9xA.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "2it1B.bssp"
#ERROR : Can't open dsspfile "2it1A.bssp"
#ERROR : Can't open dsspfile "1z47B.bssp"
#ERROR : Can't open dsspfile "1z47A.bssp"
#ERROR : Can't open dsspfile "2yyzA.bssp"
#ERROR : Can't open dsspfile "2r6gB.bssp"
#ERROR : Can't open dsspfile "2r6gA.bssp"
#ERROR : Can't open dsspfile "1q12A.bssp"
#ERROR : Can't open dsspfile "3fh6A.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "1g291.bssp"
#ERROR : Can't open dsspfile "1v43A.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "1oxvA.bssp"
#ERROR : Can't open dsspfile "1oxsC.bssp"
#ERROR : Can't open dsspfile "2oljA.bssp"
#ERROR : Can't open dsspfile "2oukB.bssp"
#ERROR : Can't open dsspfile "3gfoA.bssp"
#ERROR : Can't open dsspfile "1oxxK.bssp"
#ERROR : Can't open dsspfile "2onkA.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "1l2tB.bssp"
#ERROR : Can't open dsspfile "1l2tA.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "2yz2B.bssp"
#ERROR : Can't open dsspfile "2yz2A.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "2pcjA.bssp"
#ERROR : Can't open dsspfile "3fvqB.bssp"
#ERROR : Can't open dsspfile "3fvqA.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "2qi9C.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "1f3oA.bssp"
#ERROR : Can't open dsspfile "1mt0A.bssp"
#ERROR : Can't open dsspfile "2fgkA.bssp"
#ERROR : Can't open dsspfile "2ffbA.bssp"
#ERROR : Can't open dsspfile "2ff7A.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "1z2rA.bssp"
#ERROR : Can't open dsspfile "2zu0C.bssp"
#ERROR : Can't open dsspfile "1xefA.bssp"
#ERROR : Can't open dsspfile "2nq2D.bssp"
#ERROR : Can't open dsspfile "2ffaA.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "2hydA.bssp"
#ERROR : Can't open dsspfile "2nq2C.bssp"
#ERROR : Can't open dsspfile "2pzfA.bssp"
#ERROR : Can't open dsspfile "1yqtA.bssp"
#ERROR : Can't open dsspfile "3g60A.bssp"
#ERROR : Can't open dsspfile "3g5uA.bssp"
#ERROR : Can't open dsspfile "1pf4A.bssp"
#ERROR : Can't open dsspfile "1mv5D.bssp"
#ERROR : Can't open dsspfile "1mv5A.bssp"
#ERROR : Can't open dsspfile "1jj7A.bssp"
#ERROR : Can't open dsspfile "2ixfD.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "2pzgB.bssp"
#ERROR : Can't open dsspfile "2pzgA.bssp"
#ERROR : Can't open dsspfile "2pzfB.bssp"
#ERROR : Can't open dsspfile "2pzeB.bssp"
#ERROR : Can't open dsspfile "2pzeA.bssp"
#ERROR : Can't open dsspfile "2ixeD.bssp"
#ERROR : Can't open dsspfile "2ixgA.bssp"
#ERROR : Can't open dsspfile "2ixfC.bssp"
#ERROR : Can't open dsspfile "2ixfA.bssp"
#ERROR : Can't open dsspfile "2ixeA.bssp"
#ERROR : Can't open dsspfile "2ix8A.bssp"
#ERROR : Can't open dsspfile "2ix3A.bssp"
#ERROR : Can't open dsspfile "2iwhB.bssp"
#ERROR : Can't open dsspfile "2iw3B.bssp"
#ERROR : Can't open dsspfile "2iw3A.bssp"
#ERROR : Can't open dsspfile "2pjzA.bssp"
#ERROR : Can't open dsspfile "1xmiE.bssp"
#ERROR : Can't open dsspfile "1xmiD.bssp"
#ERROR : Can't open dsspfile "1xmiC.bssp"
#ERROR : Can't open dsspfile "1xmiB.bssp"
#ERROR : Can't open dsspfile "1xmiA.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "1xmjA.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "2ihyB.bssp"
#ERROR : Can't open dsspfile "2ihyA.bssp"
#ERROR : Can't open dsspfile "1xfaA.bssp"
#ERROR : Can't open dsspfile "1xf9D.bssp"
#ERROR : Can't open dsspfile "1xf9C.bssp"
#ERROR : Can't open dsspfile "1xf9B.bssp"
#ERROR : Can't open dsspfile "1xf9A.bssp"
#ERROR : Can't open dsspfile "1r10A.bssp"
#ERROR : Can't open dsspfile "1r0zD.bssp"
#ERROR : Can't open dsspfile "1r0zC.bssp"
#ERROR : Can't open dsspfile "1r0zB.bssp"
#ERROR : Can't open dsspfile "1r0zA.bssp"
#ERROR : Can't open dsspfile "1r0xD.bssp"
#ERROR : Can't open dsspfile "1r0xC.bssp"
#ERROR : Can't open dsspfile "1r0xB.bssp"
#ERROR : Can't open dsspfile "1r0xA.bssp"
#ERROR : Can't open dsspfile "1r0wC.bssp"
#ERROR : Can't open dsspfile "1r0wB.bssp"
#ERROR : Can't open dsspfile "1r0wA.bssp"
#ERROR : Can't open dsspfile "1q3hD.bssp"
#ERROR : Can't open dsspfile "1q3hC.bssp"
#ERROR : Can't open dsspfile "1q3hB.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"

## Summary of PDB Search
:259
    3e-31  32%  1g6hA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    4e-31  32%  1gajA  [c.37.1] HIGH-AFFINITY BRANCHED CHAIN AMINO ACID
    4e-30  32%  1g9xA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    3e-23  31%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    1e-21  30%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    5e-21  27%  2it1B  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    5e-21  27%  2it1A  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    7e-20  34%  1z47B  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    7e-20  34%  1z47A  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    3e-19  30%  2yyzA  [x.x.x] SUGAR ABC TRANSPORTER, ATP-BINDING PROTEIN
    2e-18  29%  2r6gB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-18  29%  2r6gA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-18  29%  1q12A  [c.37.1 - b.40.6] MALTOSE/MALTODEXTRIN TRANSPORT ATP-BINDING
    2e-18  29%  3fh6A  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-18  29%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-18  29%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    9e-18  28%  1g291  [c.37.1 - b.40.6 - b.40.6] MALTOSE TRANSPORT PROTEIN MALK
    1e-17  34%  1v43A  [c.37.1 - b.40.6 - b.40.6] SUGAR-BINDING TRANSPORT
    1e-17  33%  1ji0A  [c.37.1] ABC TRANSPORTER
    2e-16  27%  1oxvA  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    2e-16  27%  1oxsC  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    2e-15  24%  2oljA  [x.x.x] AMINO ACID ABC TRANSPORTER
    3e-15  24%  2oukB  [x.x.x] PROTEIN ARTP
    1e-13  25%  3gfoA  [x.x.x] COBALT IMPORT ATP-BINDING PROTEIN CBIO 1
    2e-13  28%  1oxxK  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    1e-12  34%  2onkA  [x.x.x] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, ATP-BINDING
    2e-12  28%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    7e-12  24%  1l2tB  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    7e-12  24%  1l2tA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    9e-12  35%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-11  27%  2yz2B  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    3e-11  27%  2yz2A  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    6e-11  38%  2d2fA  [x.x.x] SUFC PROTEIN
    6e-11  38%  2d2eA  [x.x.x] SUFC PROTEIN
    1e-10  29%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    2e-10  24%  2pcjA  [x.x.x] LIPOPROTEIN-RELEASING SYSTEM ATP-BINDING PROTEIN
    2e-10  34%  3fvqB  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    2e-10  34%  3fvqA  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    2e-10  33%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-10  35%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-10  28%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-09  34%  2qi9C  [x.x.x] VITAMIN B12 IMPORT ATP-BINDING PROTEIN BTUD
    4e-09  33%  1l7vC  [c.37.1] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
    4e-09  27%  1f3oA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    7e-09  20%  1mt0A  [c.37.1] HAEMOLYSIN SECRETION ATP-BINDING PROTEIN
    7e-09  20%  2fgkA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    7e-09  20%  2ffbA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    7e-09  20%  2ff7A  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    1e-08  25%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-08  34%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    1e-08  29%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    2e-08  20%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    3e-08  33%  1z2rA  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    5e-08  39%  2zu0C  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    5e-08  30%  1xefA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    5e-08  39%  2nq2D  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    5e-08  30%  2ffaA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    5e-08  39%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    5e-08  39%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    5e-08  39%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    5e-08  39%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    8e-08  41%  2hydA  [x.x.x] ABC TRANSPORTER HOMOLOG
    1e-07  39%  2nq2C  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    7e-07  30%  2pzfA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    9e-07  51%  1yqtA  [x.x.x] RNASE L INHIBITOR
    1e-06  35%  3g60A  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    1e-06  35%  3g5uA  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    2e-06  34%  1pf4A  [f.37.1 - c.37.1] TRANSPORT ATP-BINDING PROTEIN MSBA
    3e-06  33%  1mv5D  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    3e-06  33%  1mv5A  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    6e-06  31%  1jj7A  [c.37.1] PEPTIDE TRANSPORTER TAP1
    6e-06  32%  2ixfD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    8e-06  27%  1vplA  [c.37.1] ABC TRANSPORTER, ATP-BINDING PROTEIN
    8e-06  31%  2pzgB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-06  31%  2pzgA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-06  31%  2pzfB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-06  31%  2pzeB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-06  31%  2pzeA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-05  32%  2ixeD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    1e-05  38%  2ixgA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    1e-05  38%  2ixfC  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    1e-05  38%  2ixfA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    1e-05  38%  2ixeA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    1e-05  38%  2ix8A  [x.x.x] ELONGATION FACTOR 3A
    1e-05  38%  2ix3A  [x.x.x] ELONGATION FACTOR 3
    1e-05  38%  2iwhB  [x.x.x] ELONGATION FACTOR 3A
    1e-05  38%  2iw3B  [x.x.x] ELONGATION FACTOR 3A
    1e-05  38%  2iw3A  [x.x.x] ELONGATION FACTOR 3A
    2e-05  40%  2pjzA  [x.x.x] HYPOTHETICAL PROTEIN ST1066
    4e-05  29%  1xmiE  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-05  29%  1xmiD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-05  29%  1xmiC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-05  29%  1xmiB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-05  29%  1xmiA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-05  30%  1sgwA  [c.37.1] PUTATIVE ABC TRANSPORTER
    4e-05  29%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-05  29%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-05  29%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-05  30%  1xmjA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-05  30%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-05  30%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-04  29%  2ihyB  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    5e-04  29%  2ihyA  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    7e-04  29%  1xfaA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-04  29%  1xf9D  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-04  29%  1xf9C  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-04  29%  1xf9B  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-04  29%  1xf9A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-04  29%  1r10A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-04  29%  1r0zD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-04  29%  1r0zC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-04  29%  1r0zB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-04  29%  1r0zA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-04  29%  1r0xD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-04  29%  1r0xC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-04  29%  1r0xB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-04  29%  1r0xA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-04  29%  1r0wC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-04  29%  1r0wB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-04  29%  1r0wA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-04  29%  1q3hD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-04  29%  1q3hC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-04  29%  1q3hB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-04  29%  1q3hA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-04  34%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 194->243)
:259

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRVLEVQGVTKRFGGLVAVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDITGS
1g6hA           MEILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNK
1gajA           MEILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNK
1g9xA           MEILRTENIVKYFGEFKALDGVSISVCKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNK
3d31A           --MIEIESLSRKWKNF-SLDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDSGRILLDGKDVTDL
3dhwC           --MIKLSNITKVFHQIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTL
2it1B           ---IKLENIVKKFGNFTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEKDVTEL
2it1A           ---IKLENIVKKFGNFTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEKDVTEL
1z47B           ---IEFVGVEKIYGGARSVRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGKRVTDL
1z47A           ---IEFVGVEKIYGGARSVRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGKRVTDL
2yyzA           ---IRVVNLKKYFGKVKAVDGVSFEVKDGEFVALLGPSGCGKTTTLLMLAGIYKPTSGEIYF-DDVLVND
2r6gB           ---VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGD-LFIGEKRMND
2r6gA           ---VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGD-LFIGEKRMND
1q12A           ---VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGD-LFIGEKRMND
3fh6A           ---VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGD-LFIGEKRMND
2awoA           ---VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGD-LFIGEKRMND
2awnB           ---VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGD-LFIGEKRMND
1g291           --------VWKVFGEVTAVREMSLEVKDGEFMILLGPSGCGKTTTLRMIAGLEEPSRGQI-YIGDKLVAD
1v43A           ---VKLENLTKRFGNFTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDRDVTYL
1ji0A           --VLEVQSLHVYYGAIHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNGQDIT-N
1oxvA           -----VKNVSKVFGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASN
1oxsC           -----VKNVSKVFGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASN
2oljA           LQMIDVHQLKKSFGSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFXXXXXXXXXXNLKAD
2oukB           -QMIDVHQLKKSFGSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFXXXXXXXXXXNLKAD
3gfoA           --ILKVEELNYNYSGTHALKGINMNIKRGEVTAILGGNGVGKSTLFQNFNGILKPSSGRILFDNKPIDYS
1oxxK           -----VKNVSKVFGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASN
2onkA           ---------------------------------LLGPTGAGKSVFLELIAGIVKPDRGEVRLNGADITPL
2awoC           ---------------------INLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGD-LFIGEKRMND
1l2tB           --MIKLKNVTKTYKMIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIKTNDL
1l2tA           --MIKLKNVTKTYKMIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIKTNDL
2awnA           ---VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGD-LFIGEKRMND
2yz2B           -----------------ALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDGERKKGY
2yz2A           -----------------ALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDGERKKGY
2d2fA           ---LEIRDLWASIDGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGEYTVERGEILLDGENILEL
2d2eA           ---LEIRDLWASIDGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGEYTVERGEILLDGENILEL
1b0uA           ---LHVIDLHKRYGGHEVLKGVSLQARAGDVXXXXXXXXXXKSTFLRCINFLEKPSEGAIIVNGQNI-NL
2pcjA           --ILRAENIKKVIRGYEILKGISLSVKKGEFVSIIGASGSGKSTLLYILGLLDAPTEGKVFLEGKEVDYT
3fvqB           ---LHIGHLSKSFQNTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTISKN
3fvqA           ---LHIGHLSKSFQNTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTISKN
2awoD           ---VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGD-LFIGEKRMND
2awnD           ---VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGD-LFIGEKRMND
2awnC           ---------------------INLDIHEGEFVVFVGPSGCGKSTLLRMIAG-------------------
2qi9C           ---------------------LSGEVRAGEILHLVGPNGAGKST---LLARAGTSGKGSIQFAGQPLEAW
1l7vC           ---------------------LSGEVRAGEILHLVGPNGAGKST---LLARAGTSGKGSIQFAGQPLEAW
1f3oA           ---IKLKNVTKTYKGIYALKNVNLNIKEGEFVS-IGPSGSGKST-LNIIGCLDKPTEGEVYIDNIKTNDL
1mt0A           ----------------VILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALA
2fgkA           ----------------VILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALA
2ffbA           ----------------VILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALA
2ff7A           ----------------VILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALA
3bk7A           ------------------------EIRKGEVIGIVGPNGIGKTTFVKMLAGVEEPTEGKVEW---DLTVA
3b60A           ---LEFRNVTFTYPGVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLREY
2d62A           --------IWKRFGDVTAVKDLSLEIKDGEFLVLLGPSGCGKTTTLR-IAGLEEPTRGQIYI--EDNLVA
3b5jA           ----------------VILDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVLIDGHDLALA
1z2rA           ----EFRNVTFTYPGVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLREY
2zu0C           ---------------------LSLDVHPGEVHAIMGPNGSGKSTLSATLAGDYEVTGGTVEFKGKDLLAL
1xefA           ----------------VILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALA
2nq2D           -----------------AFQQLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGKI----------
2ffaA           ----------------VILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALA
2d3wD           ---------------------LSLDVHPGEVHAIMGPNGSGKSTLSATLAGDYEVTGGTVEFKGKDLLAL
2d3wC           ---------------------LSLDVHPGEVHAIMGPNGSGKSTLSATLAGDYEVTGGTVEFKGKDLLAL
2d3wB           ---------------------LSLDVHPGEVHAIMGPNGSGKSTLSATLAGDYEVTGGTVEFKGKDLLAL
2d3wA           ---------------------LSLDVHPGEVHAIMGPNGSGKSTLSATLAGDYEVTGGTVEFKGKDLLAL
2hydA           ------------------LKDINLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGHNITGS
2nq2C           --------------------QLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGKI----------
2pzfA           -----MENVTAFWGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-----
1yqtA           ------------------------EIKKGEVIGIVGPNGIGKTTFVK-LAGVEEPTEGKI----------
3g60A           ---------------------LNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDPLDGMVSIDGQDIRTI
3g5uA           ---------------------LNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDPLDGMVSIDGQDIRTI
1pf4A           ---VDVKDVTFTYQGKEALSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSICLDGHDV---
1mv5D           ------------------LRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQPIDNI
1mv5A           ------------------LRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQPIDNI
1jj7A           ---------------VLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPL---
2ixfD           ----------------------------GKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLV--
1vplA           ------------------------------------PNGAGKTTTLRIISTLIKPSSGIVTVFGKNVV-E
2pzgB           -------------GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-----
2pzgA           -------------GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-----
2pzfB           -------------GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-----
2pzeB           -------------GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-----
2pzeA           -------------GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-----
2ixeD           ----------------------------GKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLV--
2ixgA           ----------------------------GKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPL---
2ixfC           ----------------------------GKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPL---
2ixfA           ----------------------------GKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPL---
2ixeA           ----------------------------GKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPL---
2ix8A           ------------------ITDINFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSGEV----------
2ix3A           ------------------ITDINFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSGEV----------
2iwhB           ------------------ITDINFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSGEV----------
2iw3B           ------------------ITDINFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSGEV----------
2iw3A           ------------------ITDINFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSGEV----------
2pjzA           -----------------SLENINLEVN-GEKVIILGPNGSGKTTLLRAISGL-LPYSGNIFINGMEV---
1xmiE           --------------GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-----
1xmiD           --------------GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-----
1xmiC           --------------GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-----
1xmiB           --------------GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-----
1xmiA           --------------GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-----
1sgwA           ------------------LERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIYNGVPIT--
2bbtA           --------------GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-----
2bbsA           --------------GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-----
2bboA           --------------GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-----
1xmjA           ------------------LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-----
2bbtB           ------------------LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-----
2bbsB           ------------------LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-----
2ihyB           --------------GKTILKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATSGTVNLFGK-----
2ihyA           --------------GKTILKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATSGTVNLFGK-----
1xfaA           --------------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-----
1xf9D           --------------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-----
1xf9C           --------------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-----
1xf9B           --------------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-----
1xf9A           --------------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-----
1r10A           --------------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-----
1r0zD           --------------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-----
1r0zC           --------------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-----
1r0zB           --------------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-----
1r0zA           --------------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-----
1r0xD           --------------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-----
1r0xC           --------------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-----
1r0xB           --------------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-----
1r0xA           --------------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-----
1r0wC           --------------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-----
1r0wB           --------------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-----
1r0wA           --------------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-----
1q3hD           --------------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-----
1q3hC           --------------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-----
1q3hB           --------------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-----
1q3hA           --------------GNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-----
2awoD           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TPDKAAKLGIGRTFQNIRLFGAMTVLENILVGRHIHTRVPYLHALLRTPXXXXXXXXXXXXXXXXXXYVG
1g6hA           EPAELYHYGIVRTFQTPQPLKEMTVLENLLIGEICPGESP-LNSLF-YKKWIPKEEEMVEKAFKILEFLK
1gajA           EPAELYHYGIVRTFQTPQPLKEMTVLENLLIG-EINPGESPLNSLF-YKKWIPKEEEMVEKAFKILEFLK
1g9xA           EPAELYHYGIVRTFQTPQPLKEMTVLENLLIG-EINPGESPLNSLF-YKKWIPKEEEMVEKAFKILEFLK
3d31A           SPEKH---DIAFVYQNYSLFPHMNVKKNLEFGMRM-KKIKDPKRVLDTARD-----------------LK
3dhwC           SESELTKARIGMIFQHFNLLSSRTVFGNVALPLELDN----------TPKDEVKRRVTELLSL-----VG
2it1B           PPKDR---NVGLVFQNWALYPHMTVYKNI----------AFPLELRKAPREEIDKKVRE---------VA
2it1A           PPKDR---NVGLVFQNWALYPHMTVYKNI----------AFPLELRKAPREEIDKKVRE---------VA
1z47B           PPQKR---NVGLVFQNYALFQHMTVYDNVSFGLR-EKRVPKDEMDARV--------------RELLRFMR
1z47A           PPQKR---NVGLVFQNYALFQHMTVYDNVSFGLR-EKRVPKDEMDARV--------------RELLRFMR
2yyzA           IPPKYRE--VGMVFQNYALYPHMTVFENIAFP-------------LRARRISKDEVEKRVVEIARKLLIN
2r6gB           TP--PAERGVGMVFQSYALYPHLSVAENMSFGEVINQRVNQVAEVLQ-----------------------
2r6gA           TP--PAERGVGMVFQSYALYPHLSVAENMSFGEVINQRVNQVAEVLQ-----------------------
1q12A           TP--PAERGVGMVFQSYALYPHLSVAENMSFGEVINQRVNQVAEVLQ-----------------------
3fh6A           TP--PAERGVGMVFQSYALYPHLSVAENMSFGEVINQRVNQVAEVLQ-----------------------
2awoA           TP--PAERGVGMVFQSYALYPHLSVAENMSFGEVINQRVNQVAEVLQ-----------------------
2awnB           TP--PAERGVGMVFQSYALYPHLSVAENMSFGEVINQRVNQVAEVLQ-----------------------
1g291           -PEKGIFVDIAMVFQSYALYPHMTVYDNIAFPLKLR-KVPRQEIDQRV--------------REVAELLG
1v43A           PPKDR---NISMVFQH------MTVYENIFPKDEIDKRVRWAAELLQIEE--------------------
1ji0A           KPAHVINRGIALVPEGRRIFPELTVYENLGAYNRIKRDLEWIFSL----------------------FPR
1oxvA           VPPEDRK--IGMVFQTWALYPNLTAFENIMSKEEIRKRVEEVAKIL-----------------------D
1oxsC           VPPEDRK--IGMVFQTWALYPNLTAFENIMSKEEIRKRVEEVAKIL-----------------------D
2oljA           TNLNKVREEVGMVFQRFNLFPHMTVLNNITLAPMKVRKWPREKAEAKA--------------MELLDKVG
2oukB           TNLNKVREEVGMVFQRFNLFPHMTVLNNITLAPMKVRKWPREKAEAKA--------------MELLDKVG
3gfoA           RKGMKLRESIGIVFQDNQLFSA-SVYQDVSFGA-VNMKLPEDEIRKRVDNALKR--------------TG
1oxxK           VPPEDRK--IGMVFQTWALYPNLTAFENIMSKEEIRKRVEEVAKIL-----------------------D
2onkA           PPERR---GIGFVPQDYALFPHLSVYRNIAYG-----------------LXXXXXXXXXXXXXXMAEKLG
2awoC           TP--PAERGVGM----VALYPHLSVAENMSFGEVINQRVNQVAEVLQ-----------------------
1l2tB           DDDELTKIKIGFVFQQFNLIPLLTALENV--------ELPLIFKYRGAMSGEERRKRALECLKMAELEER
1l2tA           DDDELTKIKIGFVFQQFNLIPLLTALENV--------ELPLIFKYRGAMSGEERRKRALECLKMAELEER
2awnA           TP--PAERGVGMVFQSYAL---------------------------------------------------
2yz2B           --EIRRNIGIAFQYPEDQFFAERVFDEVAFAVKNFYDPVPLVKKAME--------------------FVG
2yz2A           --EIRRNIGIAFQYPEDQFFAERVFDEVAFAVKNFYDPVPLVKKAME--------------------FVG
2d2fA           SPDERARKGLFLAFQ-------------------------------------------------------
2d2eA           SPDERARKGLFLAFQ-------------------------------------------------------
1b0uA           VRDKDGQLKVAMVFQHFNLWSHMTVLENVMLGLSKHARERALKYLAK---------------------VG
2pcjA           NEKELSLLKLGFVFQFHYLIPELTALENVIVPM-LKMGKPKKEAKER--------------GEYLLSELG
3fvqB           TNLPVRERRLGYLVQEGVLFPHLTVYRNIAYG--------------------------------------
3fvqA           TNLPVRERRLGYLVQEGVLFPHLTVYRNIAYG--------------------------------------
2awoD           TP--PAERGVGMVEPSVFLLAALRVQMRIEISR-LHKRL-------------------------------
2awnD           TP--PAERGVG-----------------------------------------------------------
2awnC           -------LGVGMVFQSYALYPHLSVAENMSFGEVINQRVNQVAEVLQ-----------------------
2qi9C           S---ATKLALHRAYQQTPPF-ATPVWHYLTLHQHDKTRTELLNDV-----------------------AG
1l7vC           S---ATKLALHRAYQQTPPF-ATPVWHYLTLHQHDKTRTELLNDV-----------------------AG
1f3oA           DDDELTKIKIGFVFQQFNLIPLLTALENV--------ELPLIFK-YRGASGEERRKRALECLKAELEERF
1mt0A           DPNW------------LRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREG
2fgkA           DPNW------------LRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREG
2ffbA           DPNW------------LRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREG
2ff7A           DPNW------------LRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREG
3bk7A           YKPQYIKAEYGTVYELLSKIDSSKLNSNF-----------YKTELLKP--------------------LG
3b60A           TL-ASLRNQVALVSQNVHLFND-TVANNIAYAR-------------------------------------
2d62A           DPEKGVKERDVAVFQSYALY-PHTVYDNIAFPLKLR-KVPKQEIDKRV---------------REVAELG
3b5jA           DPNW------------LRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREG
1z2rA           TL-ASLRNQVALVSQNVHLFND-TVANNIAYAR-------------------------------------
2zu0C           SPEDRAGEGIFMAFQ-------------------------------------------------------
1xefA           DPN-------------------------------------------------------------------
2nq2D           ----EVYQSIGFVPQFFSSPFAYSVLDIVLMGRSTH----------------------------------
2ffaA           DPN-------------------------------------------------------------------
2d3wD           SPEDRAGEGIFMAFQ-------------------------------------------------------
2d3wC           SPEDRAGEGIFMAFQ-------------------------------------------------------
2d3wB           SPEDRAGEGIFMAFQ-------------------------------------------------------
2d3wA           SPEDRAGEGIFMAFQ-------------------------------------------------------
2hydA           LRNQ-----IGLVQQDNILF-SDTVKENILLGR-------------------------------------
2nq2C           ----EVYQSIGFVPQFFSSPFAYSVLDIVLMGRSTH----------------------------------
2pzfA           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
3g60A           NVRYLREI-IGVVSQEPVLF-ATTIAENIRYGR-------------------------------------
3g5uA           NVRYLREI-IGVVSQEPVLF-ATTIAENIRYGR-------------------------------------
1pf4A           ----------------------------------------------------------------------
1mv5D           SLEN-WRSQIGFVSQDSAIM-AGTIRENLTYG--------------------------------------
1mv5A           SLEN-WRSQIGFVSQDSAIM-AGTIRENLTYG--------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixfD           ------------QYDHHYLHTQVAAVGQLLFGRSFRENIAY--GLTRTP---------------------
1vplA           EPHEVRKLGAYRNMQGIEYL-------RFVAGFYASSSSEIEEMVERATEI-----------------AG
2pzgB           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
2ixeD           ------------QYDHHYLHTQVAAVGPLLFGRSFRENIAY--GLTRTP---------------------
2ixgA           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LLHRKDELARNLPYGEQRKLEIXXXXXXXXXXXXXXXXXXGMNPKETEALQEFILKIRSEMGLTILLIEH
1g6hA           LSHLYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAK-GITFLIIEH
1gajA           LSHLYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDQPIAGVAPGLAHDIFNHVLELKAK-GITFLIIEH
1g9xA           LSHLYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAK-GITFLIIEH
3d31A           IEHLLDRNPLTLSGGEQQRVALARALVTNPKILLLDEPLSALDPRTQENAREMLSVLHKKNKLTVLHITH
3dhwC           LGDKHDSYPSNLSGGQKQRVAIARALASNPKVLLCDEATSALDPATTRSILELLKDINRRLGLTILLITH
2it1B           KMLHIDKLLNRYPWGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKELGITTVYVTH
2it1A           KMLHIDKLLNRYPWGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKELGITTVYVTH
1z47B           LESYANRFPHELSGGXXXXXXXXXXXXXXXXXXXFDEPFAAIDTQIRRELRTFVRQVHDEMGVTSVFVTH
1z47A           LESYANRFPHELSGGXXXXXXXXXXXXXXXXXXXFDEPFAAIDTQIRRELRTFVRQVHDEMGVTSVFVTH
2yyzA           LLDRK---PTQLSGGQQQRVALARALVKQPKVLLFDEPLSNLDANLRMIMRAEIKHLQQELGITSVYVTH
2r6gB           LAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTH
2r6gA           LAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTH
1q12A           LAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTH
3fh6A           LAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTH
2awoA           LAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTH
2awnB           LAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTH
1g291           LTELLNRKPRELSGGQRQRVALGRAIVRKPQVFLMDEPLSNLDAKLRVRMRAELKKLQRQLGVTTIYVTH
1v43A           LLNR---YPAQLSGGXXXXXXXXXXXXXEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKLKVTTIYVTH
1ji0A           LKERLKQLGGTLSGGEQQ----LAIGRALSRPKLLDEPSLGLAPILVSEVFEVIQKINQE-GTTILLVEQ
1oxvA           IHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSH
1oxsC           IHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSH
2oljA           LKDKAHAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANE-GMTMVVVTH
2oukB           LKDKAHAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANE-GMTMVVVTH
3gfoA           IEHLKDKPTHCLSFGQKKRVAIAGVLVMEPKVLILDEPTAGLDPMGVSEIMKLLVEMQKELGXXXXXXXX
1oxxK           IHHVLNHFPRELSGXXXXXXXXXXXXXKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSH
2onkA           IAHLLDRKPARLSGGERQRVALARALVIQPRLLLLDEPLSAVDLKTKGVLMEELRFVQREFDVPILHVTH
2awoC           LAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTH
1l2tB           FANHK---PNQLSGGQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLNEEDGKTVVVVTH
1l2tA           FANHK---PNQLSGGQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLNEEDGKTVVVVTH
2awnA           -----------------------------------------------------ISRLHKRLGRTMIYVTH
2yz2B           LDFDKDRVPFFLSGGEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKWKT-LGKTVILISH
2yz2A           LDFDKDRVPFFLSGGEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKWKT-LGKTVILISH
2d2fA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
1b0uA           IDERQGKYPVHLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVEVLR--IMQQLAEEGKTMVVVTH
2pcjA           LGDKLSRKPYELSGGEQQRVAIARALANEPILLFADEPTGNLDSANTKRVMDIFLKI-NEGGTSIVMVTH
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           -----------------------------------------------------ISRLHKRLGRTMIYVTH
2awnC           LAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTH
2qi9C           ALALDDKLGRSLSGGEWQRVRLAAVVLQITPQANPAGQLLLLDPNSLDVAQQSILSALSQQGLAI-VSSH
1l7vC           ALALDDKLGRSLSGGEWQRVRLAAVVLQITPQANPAGQLLLLDPNSLDVAQQSILSALCQQGLAI-VSSH
1f3oA           ANHKPNQLSG----GQQQRVAIARALANNPPIILADEPTGALDSKTGEKIQ-LLKKLNEEDGKTVVVVTH
1mt0A           YNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICK--GRTVIIIAH
2fgkA           YNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKICK--GRTVIIIAH
2ffbA           YNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKICK--GRTVIIIAH
2ff7A           YNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICK--GRTVIIIAH
3bk7A           IIDLYDRNVEDLSGGELQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLMEKNEKTALVVEH
3b60A           ----------------------------------------------------------------------
2d62A           LTELLNRKPRELSGGQRQRVAL-GRAIIRRPKVFLDEPLSNLDAKLRVKRAE-LKKLQRQLGVTTIYVTH
3b5jA           YNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICK--GRTVIIIAH
1z2rA           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2hydA           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
3g60A           ----------------------------------------------------------------------
3g5uA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
1vplA           LGEKIKDRVSTYSKGMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRK-ILKQASQEGLTILVSSH
2pzgB           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2pjzA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
2awoD           -----------------------------------------------------ISRLHKRLGRTMIYVTH


                         .         .         .         +         .         .         .:280
query           DMRLVMRISDRIAVLDYGSKIAEGKPEEVRTNPRVIEAYLxxxxxxxxx
1g6hA           RLDIVLNYIDHLYVMFNGQIIAEGRGEEVLSDPKVVEIYI---------
1gajA           RLDIVLNYIDHLYVMFNGQIIAEGRGEEVLSDPKVVEIYI---------
1g9xA           RLDIVLNYIDHLYVMFNGQIIAEGRGEEVLSDPKVVEIYI---------
3d31A           DQTEARIMADRIAVVMDGKLIQVGKPEEIFEKP----------------
3dhwC           EMDVVKRICDCVAVISNGELIEQDTVSEVFSHPK---------------
2it1B           DQAEALAMADRIAVIREGEILQVGTPDEVYYKPK---------------
2it1A           DQAEALAMADRIAVIREGEILQVGTPDEVYYKPK---------------
1z47B           DQEEALEVADRVLVLHEGNVEQFGTPEEVYEKP----------------
1z47A           DQEEALEVADRVLVLHEGNVEQFGTPEEVYEKP----------------
2yyzA           DQAEAMTMASRIAVFNQGKLVQYGTPDEVYDSPK---------------
2r6gB           DQVEAMTLADKIVVLDAGRVAQVGKPLELYHYP----------------
2r6gA           DQVEAMTLADKIVVLDAGRVAQVGKPLELYHYP----------------
1q12A           DQVEAMTLADKIVVLDAGRVAQVGKPLELYHYP----------------
3fh6A           DQVEAMTLADKIVVLDAGRVAQVGKPLELYHYP----------------
2awoA           DQVEAMTLADKIVVLDAGRVAQVGKPLELYHYP----------------
2awnB           DQVEAMTLADKIVVLDAGRVAQVGKPLELYHYP----------------
1g291           DQVEAMTMGDRIAVMNRGVLQQVGSPDEVYDKP----------------
1v43A           DQVEAMTMGDRIAVMNRGQLLQIGSPTEVYLRPNSV-------------
1ji0A           NALGALKVAHYGYVLETGQIVLEGKASELLDN-EVRKAYL---------
1oxvA           DPADIFAIADRXXXXXXXXXXXXXXPEDLYDNPVSIQ------------
1oxsC           DPADIFAIADRXXXXXXXXXXXXXXPEDLYDNPVSIQ------------
2oljA           EMGFAREVGDRVLFMDGGYIIEEGKPEDLFDRPQ---------------
2oukB           EMGFAREVGDRVLFMDGGYIIEEGKPEDLFDRPQ---------------
3gfoA           XXXXVPLYCDNVFVMKEGRVILQGNPKEVFAEKEVI-------------
1oxxK           DPADIFAIADRXXXXXXXXXXXXXXPEDLYDNPVSIQ------------
2onkA           DLIEAAMLADEVAVMLNGRIVEKGKLKEL--------------------
2awoC           DQVEAMTLADKIVVLDAGRVAQVGKPLELYHYP----------------
1l2tB           DIN-VARFGERIIYLKDGEVEREEK------------------------
1l2tA           DIN-VARFGERIIYLKDGEVEREEK------------------------
2awnA           DQVEAMTLADKIVVLDAGRVAQVGKPLELYHYP----------------
2yz2B           DIETVINHVDRVVVLEKGKKVFDG-------------------------
2yz2A           DIETVINHVDRVVVLEKGKKVFDG-------------------------
2d2fA           -------------------------------------------------
2d2eA           -------------------------------------------------
1b0uA           EMGFARHVSSHVIFLHQGKIEEEGDPEQVFGNPQ---------------
2pcjA           ERELA-ELTHRTLEMKDGKVVGE--------------------------
3fvqB           -------------------------------------------------
3fvqA           -------------------------------------------------
2awoD           -------------------------------------------------
2awnD           DQVEAMTLADKIVVLDAGRVAQVGKPLELYHYP----------------
2awnC           DQVEAMTLADKIVVLDAGRVAQVGKPLELYHYP----------------
2qi9C           DLNHTLRHAHRAWLLK-GGKLASGRREEVLTPPNLAQAY----------
1l7vC           DLNHTLRHAHRAWLLK-GGKLASGRREEVLTPPNLAQAY----------
1f3oA           DIN-VARFGERIIYLKDGEVEREEK------------------------
1mt0A           RLSTV-KNADRIIVMEKGKIVEQGK------------------------
2fgkA           RLSTV-KNADRIIVMEKGKIVEQGK------------------------
2ffbA           RLSTV-KNADRIIVMEKGKIVEQGK------------------------
2ff7A           RLSTV-KNADRIIVMEKGKIVEQGK------------------------
3bk7A           DVLMIDYVSDRLIVFE---------------------------------
3b60A           -------------------------------------------------
2d62A           DQ--VEATGDRIAV-NKGELQQVGTPDEVYYKP----------------
3b5jA           RLSTV-KNADRIIVMEKGKIVEQGK------------------------
1z2rA           -------------------------------------------------
2zu0C           -------------------------------------------------
1xefA           -------------------------------------------------
2nq2D           -------------------------------------------------
2ffaA           -------------------------------------------------
2d3wD           -------------------------------------------------
2d3wC           -------------------------------------------------
2d3wB           -------------------------------------------------
2d3wA           -------------------------------------------------
2hydA           -------------------------------------------------
2nq2C           -------------------------------------------------
2pzfA           -------------------------------------------------
1yqtA           -------------------------------------------------
3g60A           -------------------------------------------------
3g5uA           -------------------------------------------------
1pf4A           -------------------------------------------------
1mv5D           -------------------------------------------------
1mv5A           -------------------------------------------------
1jj7A           -------------------------------------------------
2ixfD           -------------------------------------------------
1vplA           NMLEVEFLCDRIALIHNGTIVETGTVEELK-------------------
2pzgB           -------------------------------------------------
2pzgA           -------------------------------------------------
2pzfB           -------------------------------------------------
2pzeB           -------------------------------------------------
2pzeA           -------------------------------------------------
2ixeD           -------------------------------------------------
2ixgA           -------------------------------------------------
2ixfC           -------------------------------------------------
2ixfA           -------------------------------------------------
2ixeA           -------------------------------------------------
2ix8A           -------------------------------------------------
2ix3A           -------------------------------------------------
2iwhB           -------------------------------------------------
2iw3B           -------------------------------------------------
2iw3A           -------------------------------------------------
2pjzA           -------------------------------------------------
1xmiE           -------------------------------------------------
1xmiD           -------------------------------------------------
1xmiC           -------------------------------------------------
1xmiB           -------------------------------------------------
1xmiA           -------------------------------------------------
1sgwA           -------------------------------------------------
2bbtA           -------------------------------------------------
2bbsA           -------------------------------------------------
2bboA           -------------------------------------------------
1xmjA           -------------------------------------------------
2bbtB           -------------------------------------------------
2bbsB           -------------------------------------------------
2ihyB           -------------------------------------------------
2ihyA           -------------------------------------------------
1xfaA           -------------------------------------------------
1xf9D           -------------------------------------------------
1xf9C           -------------------------------------------------
1xf9B           -------------------------------------------------
1xf9A           -------------------------------------------------
1r10A           -------------------------------------------------
1r0zD           -------------------------------------------------
1r0zC           -------------------------------------------------
1r0zB           -------------------------------------------------
1r0zA           -------------------------------------------------
1r0xD           -------------------------------------------------
1r0xC           -------------------------------------------------
1r0xB           -------------------------------------------------
1r0xA           -------------------------------------------------
1r0wC           -------------------------------------------------
1r0wB           -------------------------------------------------
1r0wA           -------------------------------------------------
1q3hD           -------------------------------------------------
1q3hC           -------------------------------------------------
1q3hB           -------------------------------------------------
1q3hA           -------------------------------------------------
2awoD           DQVEAMTLADKIVVLDAGRVAQVGKPLELYHYP----------------