[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tthe0:AAS81487.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2hoqA.bssp"
#ERROR : Can't open dsspfile "2yy6A.bssp"
#ERROR : Can't open dsspfile "2nyvA.bssp"
#ERROR : Can't open dsspfile "2no5B.bssp"
#ERROR : Can't open dsspfile "2no5A.bssp"
#ERROR : Can't open dsspfile "2no4B.bssp"
#ERROR : Can't open dsspfile "2no4A.bssp"
#ERROR : Can't open dsspfile "1x42A.bssp"
#ERROR : Can't open dsspfile "2hszA.bssp"
#ERROR : Can't open dsspfile "2zg6B.bssp"
#ERROR : Can't open dsspfile "2zg6A.bssp"
#ERROR : Can't open dsspfile "1vj5A.bssp"
#ERROR : Can't open dsspfile "3i28A.bssp"
#ERROR : Can't open dsspfile "2b0cA.bssp"
#ERROR : Can't open dsspfile "3ib6C.bssp"
#ERROR : Can't open dsspfile "3ib6A.bssp"
#ERROR : Can't open dsspfile "1ek1A.bssp"
#ERROR : Can't open dsspfile "1cqzB.bssp"
#ERROR : Can't open dsspfile "1cqzA.bssp"
#ERROR : Can't open dsspfile "2gfhA.bssp"
#ERROR : Can't open dsspfile "1z4oB.bssp"
#ERROR : Can't open dsspfile "1z4nA.bssp"
#ERROR : Can't open dsspfile "2wf5A.bssp"
#ERROR : Can't open dsspfile "1o03A.bssp"
#ERROR : Can't open dsspfile "1lvhA.bssp"
#ERROR : Can't open dsspfile "3fm9A.bssp"
#ERROR : Can't open dsspfile "1zrnA.bssp"
#ERROR : Can't open dsspfile "1judA.bssp"
#ERROR : Can't open dsspfile "1z4oA.bssp"
#ERROR : Can't open dsspfile "2w4mA.bssp"
#ERROR : Can't open dsspfile "1z4nB.bssp"
#ERROR : Can't open dsspfile "2hdoA.bssp"
#ERROR : Can't open dsspfile "2w43B.bssp"
#ERROR : Can't open dsspfile "2w43A.bssp"
#ERROR : Can't open dsspfile "2w11B.bssp"
#ERROR : Can't open dsspfile "2w11A.bssp"
#ERROR : Can't open dsspfile "3hltC.bssp"
#ERROR : Can't open dsspfile "3hltA.bssp"
#ERROR : Can't open dsspfile "1u6rA.bssp"
#ERROR : Can't open dsspfile "2om6A.bssp"
#ERROR : Can't open dsspfile "2pibA.bssp"
#ERROR : Can't open dsspfile "1j97B.bssp"
#ERROR : Can't open dsspfile "1j97A.bssp"
#ERROR : Can't open dsspfile "1f5sB.bssp"
#ERROR : Can't open dsspfile "1f5sA.bssp"
#ERROR : Can't open dsspfile "1te2A.bssp"
#ERROR : Can't open dsspfile "1i0eA.bssp"
#ERROR : Can't open dsspfile "2hi0B.bssp"
#ERROR : Can't open dsspfile "2hi0A.bssp"
#ERROR : Can't open dsspfile "1l7pB.bssp"
#ERROR : Can't open dsspfile "1l7pA.bssp"
#ERROR : Can't open dsspfile "1l7oA.bssp"
#ERROR : Can't open dsspfile "1l7mB.bssp"
#ERROR : Can't open dsspfile "1l7mA.bssp"
#ERROR : Can't open dsspfile "2crkA.bssp"
#ERROR : Can't open dsspfile "2ah5A.bssp"
#ERROR : Can't open dsspfile "1wr8B.bssp"
#ERROR : Can't open dsspfile "1wr8A.bssp"
#ERROR : Can't open dsspfile "2fi1A.bssp"

## Summary of PDB Search
:219
    1e-14  39%  2hoqA  [x.x.x] PUTATIVE HAD-HYDROLASE PH1655
    2e-13  40%  2yy6A  [x.x.x] PHOSPHOGLYCOLATE PHOSPHATASE
    2e-13  40%  2nyvA  [x.x.x] PHOSPHOGLYCOLATE PHOSPHATASE
    2e-11  37%  2no5B  [x.x.x] (S)-2-HALOACID DEHALOGENASE IVA
    2e-11  37%  2no5A  [x.x.x] (S)-2-HALOACID DEHALOGENASE IVA
    2e-11  37%  2no4B  [x.x.x] (S)-2-HALOACID DEHALOGENASE IVA
    2e-11  37%  2no4A  [x.x.x] (S)-2-HALOACID DEHALOGENASE IVA
    3e-10  38%  1x42A  [x.x.x] HYPOTHETICAL PROTEIN PH0459
    2e-09  36%  2hszA  [x.x.x] NOVEL PREDICTED PHOSPHATASE
    4e-09  35%  2zg6B  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN ST2620
    6e-09  36%  2zg6A  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN ST2620
    3e-08  36%  1vj5A  [c.108.1 - c.69.1] EPOXIDE HYDROLASE 2, CYTOPLASMIC
    3e-08  36%  3i28A  [c.108.1 - c.69.1 (1s8oA)] EPOXIDE HYDROLASE 2
    3e-08  30%  2b0cA  [x.x.x] PUTATIVE PHOSPHATASE
    4e-08  35%  3ib6C  [x.x.x] UNCHARACTERIZED PROTEIN
    4e-08  35%  3ib6A  [x.x.x] UNCHARACTERIZED PROTEIN
    1e-07  35%  1ek1A  [c.108.1 - c.69.1] EPOXIDE HYDROLASE
    1e-07  35%  1cqzB  [c.108.1 - c.69.1] EPOXIDE HYDROLASE
    1e-07  35%  1cqzA  [c.108.1 - c.69.1] EPOXIDE HYDROLASE
    3e-07  31%  2gfhA  [x.x.x] HALOACID DEHALOGENASE-LIKE HYDROLASE DOMAIN
    4e-07  31%  1z4oB  [x.x.x] BETA-PHOSPHOGLUCOMUTASE
    4e-07  31%  1z4nA  [x.x.x] BETA-PHOSPHOGLUCOMUTASE
    4e-07  31%  2wf5A  [x.x.x] BETA-PHOSPHOGLUCOMUTASE
    4e-07  31%  1o03A  [c.108.1] BETA-PHOSPHOGLUCOMUTASE
    4e-07  31%  1lvhA  [c.108.1] BETA-PHOSPHOGLUCOMUTASE
    4e-07  31%  3fm9A  [x.x.x] BETA-PHOSPHOGLUCOMUTASE
    8e-07  35%  1zrnA  [x.x.x] L-2-HALOACID DEHALOGENASE
    8e-07  35%  1judA  [c.108.1 (1qh9A)] L-2-HALOACID DEHALOGENASE
    1e-06  31%  1z4oA  [x.x.x] BETA-PHOSPHOGLUCOMUTASE
    2e-06  31%  2w4mA  [x.x.x] N-ACYLNEURAMINATE-9-PHOSPHATASE
    6e-06  36%  1z4nB  [x.x.x] BETA-PHOSPHOGLUCOMUTASE
    8e-06  36%  2hdoA  [x.x.x] PHOSPHOGLYCOLATE PHOSPHATASE
    1e-05  37%  2w43B  [x.x.x] HYPOTHETICAL 2-HALOALKANOIC ACID DEHALOGENASE
    1e-05  37%  2w43A  [x.x.x] HYPOTHETICAL 2-HALOALKANOIC ACID DEHALOGENASE
    1e-05  37%  2w11B  [x.x.x] 2-HALOALKANOIC ACID DEHALOGENASE
    1e-05  37%  2w11A  [x.x.x] 2-HALOALKANOIC ACID DEHALOGENASE
    1e-05  49%  3hltC  [x.x.x] HDHD2
    1e-05  49%  3hltA  [x.x.x] HDHD2
    2e-05  30%  1u6rA  [x.x.x] CREATINE KINASE, M CHAIN
    2e-05  30%  2om6A  [x.x.x] PROBABLE PHOSPHOSERINE PHOSPHATASE
    3e-05  24%  2pibA  [x.x.x] PHOSPHORYLATED CARBOHYDRATES PHOSPHATASE TM_1254
    5e-05  34%  1j97B  [c.108.1] PHOSPHOSERINE PHOSPHATASE
    5e-05  34%  1j97A  [c.108.1] PHOSPHOSERINE PHOSPHATASE
    5e-05  34%  1f5sB  [c.108.1] PHOSPHOSERINE PHOSPHATASE (PSP)
    5e-05  34%  1f5sA  [c.108.1] PHOSPHOSERINE PHOSPHATASE (PSP)
    7e-05  29%  1te2A  [c.108.1] PUTATIVE PHOSPHATASE
    9e-05  30%  1i0eA  [a.83.1 - d.128.1] CREATINE KINASE,M CHAIN
    9e-05  33%  2hi0B  [x.x.x] PUTATIVE PHOSPHOGLYCOLATE PHOSPHATASE
    9e-05  33%  2hi0A  [x.x.x] PUTATIVE PHOSPHOGLYCOLATE PHOSPHATASE
    1e-04  36%  1l7pB  [c.108.1] PHOSPHOSERINE PHOSPHATASE
    1e-04  36%  1l7pA  [c.108.1] PHOSPHOSERINE PHOSPHATASE
    1e-04  36%  1l7oA  [c.108.1] PHOSPHOSERINE PHOSPHATASE
    1e-04  36%  1l7mB  [c.108.1] PHOSPHOSERINE PHOSPHATASE
    1e-04  36%  1l7mA  [c.108.1] PHOSPHOSERINE PHOSPHATASE
    1e-04  30%  2crkA  [a.83.1 - d.128.1] PROTEIN (CREATINE KINASE)
    1e-04  29%  2ah5A  [x.x.x] COG0546: PREDICTED PHOSPHATASES
    6e-04  47%  1wr8B  [c.108.1] PHOSPHOGLYCOLATE PHOSPHATASE
    6e-04  47%  1wr8A  [c.108.1] PHOSPHOGLYCOLATE PHOSPHATASE
    6e-04  29%  2fi1A  [x.x.x] HYDROLASE, HALOACID DEHALOGENASE-LIKE FAMILY
:219

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xVRALTFDVGNTLILASPRFWLLPLLEARGLRPRGDVRKAALEAFRFYEENHLKARDLETALGLWREFHR
2hoqA           ----------------------------------------------------------------------
2yy6A           ----------------------------------------------------------------------
2nyvA           ----------------------------------------------------------------------
2no5B           ----------------------------------------------------------------------
2no5A           ----------------------------------------------------------------------
2no4B           ----------------------------------------------------------------------
2no4A           ----------------------------------------------------------------------
1x42A           ----------------------------------------------------------------------
2hszA           ----------------------------------------------------------------------
2zg6B           --KAVLVDFGNTLVGFKPVFYVYQVLKDNGYDL--DLRKV----FRAYAKEHVDPKDFLYILGIYP----
2zg6A           --KAVLVDFGNTLVGFKPVFYVYQVLKDNGYDL--DLRKV----FRAYAKEHVDPKDFLYILGIYP----
1vj5A           ----------------------------------------------------------------------
3i28A           ----------------------------------------------------------------------
2b0cA           ---------------------------------------------------------LKKSFHMGEAFHQ
3ib6C           ----------------------------------------------------------------------
3ib6A           ----------------------------------------------------------------------
1ek1A           ----------------------------------------------------------------------
1cqzB           ----------------------------------------------------------------------
1cqzA           ----------------------------------------------------------------------
2gfhA           -VRAVFFDLDNTLI------------DTAGASRRGEVIKLLQSKYHYKEEAEIICDKVQVKLSKWEEAIQ
1z4oB           ----------------------------------------------------------------------
1z4nA           ----------------------------------------------------------------------
2wf5A           ----------------------------------------------------------------------
1o03A           ----------------------------------------------------------------------
1lvhA           ----------------------------------------------------------------------
3fm9A           ----------------------------------------------------------------------
1zrnA           ----------------------------------------------------------------------
1judA           ----------------------------------------------------------------------
1z4oA           ----------------------------------------------------------------------
2w4mA           -VRAVFFDLDNTLI------------DTAGASRRGEVIKLLQSKYHYKEEAEIICDKVQVKLSK-ECFHN
1z4nB           ----------------------------------------------------------------------
2hdoA           ----------------------------------------------------------------------
2w43B           ----------------------------------------------------------------------
2w43A           ----------------------------------------------------------------------
2w11B           ----------------------------------------------------------------------
2w11A           ----------------------------------------------------------------------
3hltC           ----------------------------------------------------------------------
3hltA           ----------------------------------------------------------------------
1u6rA           ------------------------------------------------------ARDWPDARGIWHNDNK
2om6A           -VKLVTFDVWNTLLLNILDEFSHQLAKISGLHIK-DVANAVIEV-----RNEIKKRAQAS------EDPR
2pibA           -----------------------------------DTEPLYFEAYRRVAESYGKTEDLHRRIGVPEREGL
1j97B           ----------------------------------------------------------------------
1j97A           ----------------------------------------------------------------------
1f5sB           ----------------------------------------------------------------------
1f5sA           ----------------------------------------------------------------------
1te2A           ----------------------------------------------------------------------
1i0eA           ------------------------------------------------------ARDWPDARGIWHNDNK
2hi0B           ----------------------------------------------------------------------
2hi0A           ----------------------------------------------------------------------
1l7pB           ----------------------------------------------------------------------
1l7pA           ----------------------------------------------------------------------
1l7oA           ----------------------------------------------------------------------
1l7mB           ----------------------------------------------------------------------
1l7mA           ----------------------------------------------------------------------
2crkA           ------------------------------------------------------ARDWPDARGIWHNDNK
2ah5A           ----------------------------------------------------------------------
1wr8B           ----------------------------------------------------------------------
1wr8A           ----------------------------------------------------------------------
2fi1A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           RLLVGMGLEDHAEALSRELVARWKDPATWPLVPGAEATLKALKAKGYPLAVVSNWDATLPEILEVVGLGR
2hoqA           -------------------------------VPGARKVLIRLKELGYELGIITDGNPVKQEKILRLELDD
2yy6A           --------------------------------PEIPYTLEALKSKGFKLAVVSNLEELSKKILDILNLSG
2nyvA           --------------------------------PEIPYTLEALKSKGFKLAVVSNLEELSKKILDILNLSG
2no5B           -------LEDR-KGLKDRLMSAYKELSAYP---DAAETLEKLKSAGYIVAILSNGDEMLQAALKASKLDR
2no5A           -------LEDR-KGLKDRLMSAYKELSAYP---DAAETLEKLKSAGYIVAILSNGDEMLQAALKASKLDR
2no4B           -------LEDR-KGLKDRLMSAYKELSAYP---DAAETLEKLKSAGYIVAILSNGDEMLQAALKASKLDR
2no4A           -------LEDR-KGLKDRLMSAYKELSAYP---DAAETLEKLKSAGYIVAILSNGDEMLQAALKASKLDR
1x42A           ------------------------------LYPEVVEVLKSLKGK-YHVGITDS-DTEYLAHLDALGIKD
2hszA           ------------------------------LYPNVKETLEALKAQGYILAVVTNKPTKVQPILTAFGIDH
2zg6B           -----------SERLVKELKADIRDGEAF-LYDDTLEFLEGLKSNGYKLALVSNASPRVKTLLEKFDLKK
2zg6A           -----------SERLVKELKADIRDGEAF-LYDDTLEFLEGLKSNGYKLALVSNASPRVKTLLEKFDLKK
1vj5A           -----------------------------------------LRKKGFTTAILTN--TWLDDRAERDGLAQ
3i28A           -----------------------------------------LRKKGFTTAILTN--TWLDDRAERDGLAQ
2b0cA           HERGEISDEAFAEALCHEMLSYEQFSHGWQAVPEVIAIMHKLREQGHRVVVLSNWPEEYPEIRDAA----
3ib6C           ----------------------------------AKETLEKVKQLGFKQAILSNTATSDTEVIKRVGIID
3ib6A           ----------------------------------AKETLEKVKQLGFKQAILSNTATSDTEVIKRVGIID
1ek1A           ----------------------------------------ALKKKGFTTCIVTNWDGDKRDSLAMCELSQ
1cqzB           ----------------------------------------ALKKKGFTTCIVTNWDGDKRDSLAMCELSQ
1cqzA           ----------------------------------------ALKKKGFTTCIVTNWDGDKRDSLAMCELSQ
2gfhA           ETKGGADNRKLAE----ECYFLWKSTRLQHMIDDVKAMLTELR-KEVRLLLLTNGDRTQREKIEACACQS
1z4oB           -----------------------QDVSPADVYPGILQLLKDLRSNKIKIALASA-SKNGPFLLERMNLTG
1z4nA           -----------------------QDVSPADVYPGILQLLKDLRSNKIKIALASA-SKNGPFLLERMNLTG
2wf5A           -----------------------QDVSPADVYPGILQLLKDLRSNKIKIALASA-SKNGPFLLERMNLTG
1o03A           -----------------------QDVSPADVYPGILQLLKDLRSNKIKIALASA-SKNGPFLLERMNLTG
1lvhA           -----------------------QDVSPADVYPGILQLLKDLRSNKIKIALASA-SKNGPFLLERMNLTG
3fm9A           -----------------------QDVSPADVYPGILQLLKDLRSNKIKIALASA-SKNGPFLLERMNLTG
1zrnA           ------------------------------LAPFSEVSLRELKRRGLKLAILSNGSPSIDAVVSHAGLRD
1judA           ------------------------------LAPFSEVSLRELKRRGLKLAILSNGSPSIDAVVSHAGLRD
1z4oA           -----------------------QDVSPADVYPGILQLLKDLRSNKIKIALASA-SKNGPFLLERMNLTG
2w4mA           TCITDLRTSHWEEALAEECYFLWKSTRLMTLAEDVKAMLTELR-KEVRLLLLTNGDRTQREKIEACACQS
1z4nB           -----------------------------------------------------------PFLLERMNLTG
2hdoA           ----------------------------------------------------------------------
2w43B           --------------------------------------------------------------LERNGLLR
2w43A           --------------------------------------------------------------LERNGLLR
2w11B           --------------------------------------------------------------LERNGLLR
2w11A           --------------------------------------------------------------LERNGLLR
3hltC           ----------------------------------------------------------------------
3hltA           ----------------------------------------------------------------------
1u6rA           SFLVWVNEEDHLRVISMEKGGNMKEVFRRFCV-GLQKIEEIFKKAGHPFM----WNEHLGYVLTCLGTGR
2om6A           KVLTGSQLKVDVELVKRATARAILNVDESLVLEGTKEALQFVKERGLKTAVIGNWPGSYTRLL-LERFGL
2pibA           PILEALEIKDSLENFKKRVHEEKKRVFSELLKPGVREALEFVKSKRIKLALATSTQXXXXXXXXXXXXXK
1j97B           ---------------------------------GAEETIKELKNRGYVVAVVSGFDIAVNKIKEKLGLGK
1j97A           ---------------------------------GAEETIKELKNRGYVVAVVSGFDIAVNKIKEKLGLGK
1f5sB           ---------------------------------GAEETIKELKNRGYVVAVVSGFDIAVNKIKEKLGLGK
1f5sA           ---------------------------------GAEETIKELKNRGYVVAVVSGFDIAVNKIKEKLGLGK
1te2A           ---------------------------TRPLLPGVREAVALCKEQGLLVGLASASPLHLEKVL-TFDLRD
1i0eA           SFLVWVNEEDHLRVISMEKGGNMKEVFRRFCV-GLQKIEEIFKKAGHPFM----WNQHLGYVLTCLGTGR
2hi0B           --------------------------------------LKNLRQKGVKLAVVSNKPNEAVQVLVEELFPG
2hi0A           --------------------------------------LKNLRQKGVKLAVVSNKPNEAVQVLVEELFPG
1l7pB           ---------------------------------GAEETIKELKNRGYVVAVVSGFDIAVNKIKEKLGLGK
1l7pA           ---------------------------------GAEETIKELKNRGYVVAVVSGFDIAVNKIKEKLGLGK
1l7oA           ---------------------------------GAEETIKELKNRGYVVAVVSGFDIAVNKIKEKLGLGK
1l7mB           ---------------------------------GAEETIKELKNRGYVVAVVSGFDIAVNKIKEKLGLGK
1l7mA           ---------------------------------GAEETIKELKNRGYVVAVVSGFDIAVNKIKEKLGLGK
2crkA           SFLVWVNEEDHLRVISMEKGGNMKEVFRRFCV-GLQKIEEIFKKAGHPFM----WNEHLGYVLTCLGTGR
2ah5A           ----------------------------------------------YPLYITTTKDTSTAQDAKNLEIHH
1wr8B           ----------------------------------------------------------------------
1wr8A           ----------------------------------------------------------------------
2fi1A           -------LEKYKENEAREL----EHPI---LFEGVSDLLEDISNQGGRHFLVSHRNDQVLEILEKTSIAA


                         +         .         .         .         .         *         .:210
query           YFDHLSVSALSGYAKPDPRLFREALEALGVSPEEAVHVGDAEADLLGAEAVGMRALLFDPLGENPKALPR
2hoqA           FFEHVIISDFEGVKKPHPKIFKKALKAFNVKPEEALMVGDLYSDIYGAKRVGMKTVWF------------
2yy6A           YFDLIVGGDTFGEKKPSPTPVLKTLEILGEEPEKALIVGDTDADIEAGKRAGTKTAL-------------
2nyvA           YFDLIVGGDTFGEKKPSPTPVLKTLEILGEEPEKALIVGDTDADIEAGKRAGTKTAL-------------
2no5B           VLDSLSADDLKIY-KPDPRIYQFACDRLGVNPNEVCFVSSNAWDLGGAGKFGFNTVRINRQGNPPE----
2no5A           VLDSLSADDLKIY-KPDPRIYQFACDRLGVNPNEVCFVSSNAWDLGGAGKFGFNTVRINRQGNPPE----
2no4B           VLDSLSADDLKIY-KPDPRIYQFACDRLGVNPNEVCFVSSNAWDLGGAGKFGFNTVRINRQGNPPE----
2no4A           VLDSLSADDLKIY-KPDPRIYQFACDRLGVNPNEVCFVSSNAWDLGGAGKFGFNTVRINRQGNPPE----
1x42A           LFDSITTSEEAGFFKPHPRIFELALKKAGVKGEEAVYVGDNPVDCGGSKNLG-TSILLDRKGE-------
2hszA           LFSELGGQSLP-EIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAG------------------
2zg6B           YFDALAL----------PKIFGFALAKVGY---PAVHVGDIELDYIGAKRSYVDPILLDRYDFYPDVRDR
2zg6A           YFDALA-----------PKIFGFALAKVGY---PAVHVGDIELDYIGAKRSYVDPILLDRYDFYPDVRDR
1vj5A           HFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEVVFLDDIGANLKPARDLGMVTIL---VQDTDTALKE
3i28A           HFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEVVFLDDIGANLKPARDLGMVTIL---VQDTDTALKE
2b0cA           --DHIYLSQDLGMRKPEARIYQHVLQAEGFSPSDTVFFDDNADNIEGANQLGITSIL-------------
3ib6C           YFDFIYASNSEKMEKPDKTIFDFTLNALQIDKTEAVMVGNTESDIIGANRAGIHAIWL----QNPEVCLQ
3ib6A           YFDFIYASNSEKMEKPDKTIFDFTLNALQIDKTEAVMVGNTESDIIGANRAGIHAIWL----QNPEVCLQ
1ek1A           HFDFLIESCQVGMIKPEPQIYNFLLDTLKAKPNEVVFLDDFGSNLKPARDMGMVTIL---VHNTASALRE
1cqzB           HFDFLIESCQVGMIKPEPQIYNFLLDTLKAKPNEVVFLDDFGSNLKPARDMGMVTIL---VHNTASALRE
1cqzA           HFDFLIESCQVGMIKPEPQIYNFLLDTLKAKPNEVVFLDDFGSNLKPARDMGMVTIL---VHNTASALRE
2gfhA           YFDAIVIGGEQKEEKPAPSIFYHCCDLLGVQPGDCVMVGDTETDIQGGLNAGLKATVW------------
1z4oB           YFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGI-------------------------
1z4nA           YFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGI-------------------------
2wf5A           YFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGI-------------------------
1o03A           YFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGI-------------------------
1lvhA           YFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGI-------------------------
3fm9A           YFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGI-------------------------
1zrnA           GFDHLSVDPVQVY-KPDNRVYELAEQALGLDRSAILFVASNAWDATGARYFGFPTCVFEEMGQTP-----
1judA           GFDHLSVDPVQVY-KPDNRVYELAEQALGLDRSAILFVSSNAWDATGARYFGFPTCVFEEMGQTP-----
1z4oA           YFDAIADPAVAA-SKPAPDIFIAAAHAVGVAPSESIGLEDSQAGI-------------------------
2w4mA           YFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGDTETDIQGGLNAGLKATVW------------
1z4nB           YFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGI-------------------------
2hdoA           --------------KPDPLPLLTALEKVNVAPQNALFIGDSVSDEQTAQAANVLAVWGDPNADHQKVAHR
2w43B           YFKGISAESVKEY-KPSPKVYKYFLDSIGA--KEAFLVSSNAFDVIGAKNAGMRSIIVDPIGGKPDVI--
2w43A           YFKGISAESVKEY-KPSPKVYKYFLDSIGA--KEAFLVSSNAFDVIGAKNAGMRSIIVDPIGGKPDVI--
2w11B           YFKGISAESVKEY-KPSPKVYKYFLDSIGA--KEAFLVSSNAFDVIGAKNAGMRSIIVDPIGGKPDVI--
2w11A           YFKGISAESVKEY-KPSPKVYKYFLDSIGA--KEAFLVSSNAFDVIGAKNAGMRSIIVDPIGGKPDVI--
3hltC           --------------KPEKTFFLEALRGTGCEPEEAVMIGDCRDDVGGAQDVGMLGIL-------------
3hltA           --------------KPEKTFFLEALRGTGCEPEEAVMIGDCRDDVGGAQDVGMLGIL-------------
1u6rA           GGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSSNADRLGSSEVEQVQLVVD-----------
2om6A           EFIDKTFFADEVLSYKPRKEFEKVLNSFEVKPEESLHIGDTYADYQGARKVG------------------
2pibA           YFDVVFGDQVKN-GKPDPEIYLLVLERLNVVPEKVVVFEDSKSGVEAAKSAGIERI--------------
1j97B           LTGDVEGEVLKENAKGE--ILEKIAKIEGINLEDTVAVGDGANDISMFKKAGLK----------------
1j97A           LTGDVEGEVLKENAKGE--ILEKIAKIEGINLEDTVAVGDGANDISMFKKAGLK----------------
1f5sB           LTGDVEGEVLKENAKGE--ILEKIAKIEGINLEDTVAVGDGANDISMFKKAGLK----------------
1f5sA           LTGDVEGEVLKENAKGE--ILEKIAKIEGINLEDTVAVGDGANDISMFKKAGLK----------------
1te2A           SFDALASAEKLPYSKPHPQVYLDCAAKLGVDPLTCVALEDS-----------------------------
1i0eA           GGVHVKLAHLSKHPKFEEILTRLRLQKRGTSVFDV-----SNADRLGSSEVEQVQLVVD-----------
2hi0B           SFD-FALGEKSGIRRKPAPDTSECVKVLGVPRDKCVYIGDSEIDI-------------------------
2hi0A           SFD-FALGEKSGIRRKPAPDTSECVKVLGVPRDKCVYIGDSEIDI-------------------------
1l7pB           LTGDVEGEVLKENAKGE--ILEKIAKIEGINLEDTVAVGDGANDI-------------------------
1l7pA           LTGDVEGEVLKENAKGE--ILEKIAKIEGINLEDTVAVGDGANDI-------------------------
1l7oA           LTGDVEGEVLKENAKGE--ILEKIAKIEGINLEDTVAVGDGANDI-------------------------
1l7mB           LTGDVEGEVLKENAKGE--ILEKIAKIEGINLEDTVAVGDGANDI-------------------------
1l7mA           LTGDVEGEVLKENAKGE--ILEKIAKIEGINLEDTVAVGDGANDI-------------------------
2crkA           GGVHVKLAHLSKHPKFEEILTRLRLQKRGTSVFDI-----SNADRLGSSEVEQVQLVVD-----------
2ah5A           FFDGIYGSSPEAPHKAD--VIHQALQTHQLAPEQAIIIGDTKFD-LGARETGIQKL--------------
1wr8B           ----------------------KASEFLGIKPKEVAHVGDGENDLDAFKVVGYK----------------
1wr8A           ----------------------KASEFLGIKPKEVAHVGDGENDLDAFKVVGYK----------------
2fi1A           YFTEVVTSSSGFKRKPNPESMLYLREKYQIS--SGLVIGDRPIDIEAGQAAGLDTHLF-------TSIVN


                         .         .         .         +         .         .         .:280
query           LERVLDYLx
2hoqA           ---------
2yy6A           ---------
2nyvA           ---------
2no5B           ---------
2no5A           ---------
2no4B           ---------
2no4A           ---------
1x42A           ---------
2hszA           ---------
2zg6B           VKNLREAL-
2zg6A           VKNLREAL-
1vj5A           LEKV-----
3i28A           LEKV-----
2b0cA           ---------
3ib6C           DERL-----
3ib6A           DERL-----
1ek1A           LEKV-----
1cqzB           LEKV-----
1cqzA           LEKV-----
2gfhA           ---------
1z4oB           ---------
1z4nA           ---------
2wf5A           ---------
1o03A           ---------
1lvhA           ---------
3fm9A           ---------
1zrnA           ---------
1judA           ---------
1z4oA           ---------
2w4mA           ---------
1z4nB           ---------
2hdoA           FQKPLDIL-
2w43B           ---------
2w43A           ---------
2w11B           ---------
2w11A           ---------
3hltC           ---------
3hltA           ---------
1u6rA           ---------
2om6A           ---------
2pibA           ---------
1j97B           ---------
1j97A           ---------
1f5sB           ---------
1f5sA           ---------
1te2A           ---------
1i0eA           ---------
2hi0B           ---------
2hi0A           ---------
1l7pB           ---------
1l7pA           ---------
1l7oA           ---------
1l7mB           ---------
1l7mA           ---------
2crkA           ---------
2ah5A           ---------
1wr8B           ---------
1wr8A           ---------
2fi1A           LRQVLD---