[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tthe0:AAS81497.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2hs3A.bssp"
#ERROR : Can't open dsspfile "3d54A.bssp"
#ERROR : Can't open dsspfile "2hruA.bssp"
#ERROR : Can't open dsspfile "2hs0A.bssp"
#ERROR : Can't open dsspfile "2hryA.bssp"
#ERROR : Can't open dsspfile "1vk3A.bssp"
#ERROR : Can't open dsspfile "1t3tA.bssp"
#ERROR : Can't open dsspfile "2z1fA.bssp"
#ERROR : Can't open dsspfile "2z1eA.bssp"

## Summary of PDB Search
:725
    e-110  48%  2hs3A  [x.x.x] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE II
    e-104  48%  3d54A  [x.x.x] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE II
    e-102  48%  2hruA  [x.x.x] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE II
    e-101  49%  2hs0A  [x.x.x] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE II
    e-100  48%  2hryA  [x.x.x] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE II
    5e-86  48%  1vk3A  [d.79.4 - d.139.1 - d.79.4 - d.139.1]
    5e-23  37%  1t3tA  [d.284.1 - a.5.10 - d.79.4 - d.139.1 - d.79.4 - d.139.1 -
    2e-12  32%  2z1fA  [x.x.x] HYDROGENASE EXPRESSION/FORMATION PROTEIN HYPE
    7e-12  32%  2z1eA  [x.x.x] HYDROGENASE EXPRESSION/FORMATION PROTEIN HYPE
:725

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxREIVQRLGREPNRVELLLFKVMWSEHCAYKNSRPLLKALPKEGEAVLQGPGENAG
2hs3A           -------------------EKLGREPTFVELQAFSVMWSEHCGYSHTKKYIRRLPKTG---FEG---NAG
3d54A           -------------------EKLGREPTFVELQAFSVMWSEHCGYSHTKKYIRRLPKTG---------NAG
2hruA           -------------------EKLGREPTFVELQAFSVMWSEHCGYSHTKKYIRRLPKTG---FEG---NAG
2hs0A           -------------------EKLGREPTFVELQAFSVMWSEHCGYSHTKKYIRRLPKTG---FEG---NAG
2hryA           -------------------EKLGREPTFVELQAFSVMWSEHCGYSHTKKYIRRLPK------------TG
1vk3A           -------------------EKLGREPTFVELQAFSV-WSEHCGYSHTKKYIRRLPKTG---FEG---NAG
1t3tA           ---------------QEAFTKLGRNPNDIELYMFAQANSEHCRHKDGKPQPKSLFKTPDYVLSAYKDNAA
2z1fA           -----------------------------------------------------------------GEDGA
2z1eA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VVRVGEGWAVAFKIESHNHPSAVEPFQGAATGVGGILRDIMSMGARPIALLDSLRFGPPEEARSRYLLKG
2hs3A           VVNLDDYYSVAFKIESHNHPSAIEPYNGAATGVGGIIRDVLAMGARPTAIFDSLHMSR--------IIDG
3d54A           VVNLDDYYSVAFKIESHNHPSAIEPYNGAATGVGGIIRDVLAMGARPTAIFDSLHMSR--------IIDG
2hruA           VVNLDDYYSVAFKIESANHPSAIEPYNGAATGVGGIIRDVLAMGARPTAIFDSLHMSR--------IIDG
2hs0A           VVNLDDYYSVAFKIESHNHPSAIEPYNGAATGVGGIIRDVLAMGARPTAIFDSLHMSR--------IIDG
2hryA           VVNLDDYYSVAFKIESANHPSAIEPYNGAATGVGGIIRDVLAMGARPTAIFDSLHMSR--------IIDG
1vk3A           VVNLDDYYSVAFKIESHNHPSAIEPYNGAATGVGGIIRDVLA-GARPTAIFDSL--------HSR-IIDG
1t3tA           VMEVGRYFAILMKVETHNHPTAISPWPGAATGSGGEIRDATGRGAKPKAGLSNLRFGKPERIVTAIMTEG
2z1fA           TIPFGDKHIV-FTIDGHT----VKPFPGGDIGVSGTVNDLAVMGAEPIALANSMIIG---EGLDMEVLKR
2z1eA           ---------IVFTIDGHT----VKPFPGGDIGVSGTVNDLAVMGAEPIALANSMIIG---EGLDMEVLKR


                         +         .         .         .         .         *         .:210
query           VVSGIAFYGNAIGVPTVGGDLYFHEGYRENPLVNAMCLGLLREEHLKRSRASLGRPIYYAGAKTGRDGIG
2hs3A           IIEGIADYGNSIGVPTVGGELRISSLYAHNPLVNVLAAGVVRNDMLVDSKASRGQVIVIFGGATGRDGIH
3d54A           IIEGIADYGNSIGVPTVGGELRISSLYAHNPLVNVLAAGVVRNDMLVDSKASRGQVIVIFGGATGRDGT-
2hruA           IIEGIADYGNSIGVPTVGGELRISSLYAHNPLVNVLAAGVVRNDMLVDSKASRGQVIVIFGGATGRDGI-
2hs0A           IIEGIADYGNSIGVPTVGGELRISSLYAHNPLVNVLAAGVVRNDMLVDSKASRGQVIVIFGGATGRDGI-
2hryA           IIEGIADYGNSIGVPTVGGELRISSLYAHNPLVNVLAAGVVRNDMLVDSKASRGQVIVIFGGATGRDGI-
1vk3A           IIEGIADYGNSIGVPTVGGELRISSLYAHNPLVNVLAAGVVRNDLVDSKASRPGQVIVIFGGATGRDG--
1t3tA           PLGGAAF-NNEFGRPALTGYFRTYEGYHK-PIMLAGGIGNIRADHVQKGEIVVGAKLIVLGGPAMNIGFA
2z1fA           VLKSMDETAREVPVPIVTGDTKVVEDKIEMFVITA---GIGIAEHVSDAGAKVGDAVLVSGT-IGDHGIA
2z1eA           VLKSMDETAREVPVPIVTGDTKVVEDKIEMFVITA---GIGIAEHVSDAGAKVGDAVLVSGT-IGDHGIA


                         .         .         .         +         .         .         .:280
query           GAAFASRELKEEKAEDRPAVQVGDPFLGKLLMEATLEAIELDLVEGVQDMGAAGLTSSLSELAHKSGLGV
2hs3A           GASFASEDLTGDKAT-KLSIQVGDPFAEKMLIEAFLEMVEEGLVEGAQDLGAGGVLSATSELVAKGNLGA
3d54A           ----------------KLSIQVGDPFAEKMLIEAFLEMVEEGLVEGAQDLGAGGVLSATSELVAKGNLGA
2hruA           ---------------------VGDPFAEKMLIEAFLEMVEEGLVEGAQDLGAGGVLSATSELVAKGNLGA
2hs0A           -------------------IQVGDPFAEKMLIEAFLEMVEEGLVEGAQDLGAGGVLSATSELVAKGNLGA
2hryA           ---------------------VGDPFAEKMLIEAFLEMVEEGLVEGAQDLGAGGVLSATSELVAKGNLGA
1vk3A           ---------------TKLSIQVGDPFAEKLI-EAFLE-VEEGLVEGAQDLGAGGVLSATSELVAKGNLGA
1t3tA           SVQRDNPEMERRCQEDR-CWQLGD----------------ANPILFIHDVGAGGLSNAMPELVSDGGRGG
2z1fA           GIAFET-ELKSDVAP------IWD------VVKAVAETIGWENIHAMKDPTRAGLSNALNEIARKSNVGI
2z1eA           GIAFET-ELKSDVAP------IWD------VVKAVAETIGWENIHAMKDPTRAGLSNALNEIARKSNVGI


                         .         *         .         .         .         .         +:350
query           ELHLDLVPTREEGMTPEELLLSESQERMVLVPKEGKEKALEEVFGRWGLDCVPVARTIPERVFRVLFRGE
2hs3A           IVHLDRVPLREPDMEPWEILISESQERMAVVTSPQKASRILEIARKHLLFGDVVAEVIEEPVYRVMYRND
3d54A           IVHLDRVPLREPDMEPWEILISESQERMAVVTSPQKASRILEIARKHLLFGDVVAEVIEEPVYRVMYRND
2hruA           IVHLDRVPLREPDMEPWEILISESQERMAVVTSPQKASRILEIARKHLLFGDVVAEVIEEPVYRVMYRND
2hs0A           IVHLDRVPLREPDMEPWEILISESQERMAVVTSPQKASRILEIARKHLLFGDVVAEVIEEPVYRVMYRND
2hryA           IVHLDRVPLREPDMEPWEILISESQERMAVVTSPQKASRILEIARKHLLFGDVVAEVIEEPVYRVMYRND
1vk3A           IVHLDRVPLREPD-EPWEILISESQERAVVTSPQ-KASRILEIARKHLLFGDVVAEVIEEPVYRV-YRND
1t3tA           KFELRDILSDEPGMSPLEIWCNESQERYVL----------------------------------------
2z1fA           LVREADIPIRPEVRAASEMLVANEGKVVMVVAREYAEEALE-------------AMRKTEKGRNAAIIGE
2z1eA           LVREADIPIRPEVRAASEMLVANEGKVVMVVAREYAEEALE-------------AMRKTEKGRNAAIIGE


                         .         .         .         .         *         .         .:420
query           VVAEVPTEALAEAPTYVRVGREDPEVRRLRETPIPPLEADPQEVLRRLLASPNLASREAVYERYDHQVGT
2hs3A           LVMEVPVQLLANAP--------EEDIVEYTPGKIPEFKVEFEEVNAR-----------EVFEQYDHMVGT
3d54A           LVMEVPVQLLANAP--------EEDIVEYTPGKIPEFKVEFEEVNAR-----------EVFEQYDHMVGT
2hruA           LVMEVPVQLLANAP--------EEDIVEYTPGKIPEFKVEFEEVNAR-----------EVFEQYDHMVGT
2hs0A           LVMEVPVQLLANAP--------EEDIVEYTPGKIPEFKVEFEEVNAR-----------EVFEQYD---GT
2hryA           LVMEVPVQLLANAP--------EEDIVEYTPGKIPEFKVEFEEVNAR-----------EVFEQYDHMVGT
1vk3A           LV-EVPVQLLANAP--------EEDIVEYTPGKIPEFKVEFEEVNAR-----------EVFEQYDH-VGT
1t3tA           ----------------------------------------------------------------------
2z1fA           VIADYRGKVLLETGIGGKRFMEPPE---------------------------------------------
2z1eA           VIADYRGKVLLETGIGGKRFMEPPE---------------------------------------------


                         .         .         +         .         .         .         .:490
query           RTALLPGKGDAAVLWIKGTRLGVAAKVDQNPRYSRLHPRLGAMHALAEACRNVSVVGAKPLAYTDGLNLG
2hs3A           DTVVPPGFG-AAVMRIKRDG-GYSLVTHSRADLALQDTYWGTLIAVLESVRKTLSVGAEPLAITNCVNYG
3d54A           DTVVPPGFG-AAVMRIKRDG-GYSLVTHSRADLALQDTYWGTLIAVLESVRKTLSVGAEPLAITNCVNYG
2hruA           DTVVPPGFG-AAVMRIKRDG-GYSLVTHSRADLALQDTYWGTLIAVLESVRKTLSVGAEPLAITNCVNYG
2hs0A           DTVVPPGFG-AAVMRIKRDG-GYSLVTHSRADLALQDTYWGTLIAVLESVRKTLSVGAEPLAITNCVNYG
2hryA           DTVVPPGFG-AAVMRIKRDG-GYSLVTHSRADLALQDTYWGTLIAVLESVRKTLSVGAEPLAITNCVNYG
1vk3A           DTVVPPGFGAAVRIKRDG---GYSLVTHSRADLALQDTYWGTLIAVLESVRKTLSVGAEPLAITNCVNYG
1t3tA           ----------------------------------------------------------------------
2z1fA           ----------------------------------------------------------------------
2z1eA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           SPETPEGYHELAETIAGLKEASEALGVPVVSGNVSLYNESGGKRIPPTAMVGVVGVLEVDKRAExxxxxx
2hs3A           DPDVPVG---LSAMMTALKNACEFSGVPVASGNASLYNTYQGKPIPPTLVVGMLGKVNPQKVAK------
3d54A           DPDVPVG---LSAMMTALKNACEFSGVPVASGNASLYNTYQGKPIPPTLVVGMLGKVNPQKVAK------
2hruA           DPDVPVG---LSAMMTALKNACEFSGVPVASGNASLYNTYQGKPIPPTLVVGMLGKVNPQKVAK------
2hs0A           DPDVPVG---LSAMMTALKNACEFSGVPVASGNASLYNTYQGKPIPPTLVVGMLGKVNPQKVAK------
2hryA           DPDVPVG---LSAMMTALKNACEFSGVPVASGNASLYNTYQGKPIPPTLVVGMLGKVNPQKVAK------
1vk3A           DPDVPVGLSATA-----LKNACEFSGVPVASGNASLYNTYQGKPIPPTLVVGL-----------------
1t3tA           ----------------------------------------------------------------------
2z1fA           ----------------------------------------------------------------------
2z1eA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2hs3A           ----------------------------------------------------------------------
3d54A           ----------------------------------------------------------------------
2hruA           ----------------------------------------------------------------------
2hs0A           ----------------------------------------------------------------------
2hryA           ----------------------------------------------------------------------
1vk3A           ----------------------------------------------------------------------
1t3tA           ----------------------------------------------------------------------
2z1fA           ----------------------------------------------------------------------
2z1eA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2hs3A           ----------------------------------------------------------------------
3d54A           ----------------------------------------------------------------------
2hruA           ----------------------------------------------------------------------
2hs0A           ----------------------------------------------------------------------
2hryA           ----------------------------------------------------------------------
1vk3A           ----------------------------------------------------------------------
1t3tA           ----------------------------------------------------------------------
2z1fA           ----------------------------------------------------------------------
2z1eA           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxx
2hs3A           -------------------------
3d54A           -------------------------
2hruA           -------------------------
2hs0A           -------------------------
2hryA           -------------------------
1vk3A           -------------------------
1t3tA           -------------------------
2z1fA           -------------------------
2z1eA           -------------------------