[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tthe0:AAS81529.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2ywbC.bssp"
#ERROR : Can't open dsspfile "2ywbA.bssp"
#ERROR : Can't open dsspfile "2ywbB.bssp"
#ERROR : Can't open dsspfile "2ywbD.bssp"
#ERROR : Can't open dsspfile "2ywcD.bssp"
#ERROR : Can't open dsspfile "2ywcB.bssp"
#ERROR : Can't open dsspfile "2ywcA.bssp"
#ERROR : Can't open dsspfile "1gpmA.bssp"
#ERROR : Can't open dsspfile "1gpmB.bssp"
#ERROR : Can't open dsspfile "2vxoB.bssp"
#ERROR : Can't open dsspfile "2vxoA.bssp"
#ERROR : Can't open dsspfile "3a4iA.bssp"
#ERROR : Can't open dsspfile "2z0cA.bssp"
#ERROR : Can't open dsspfile "2dplA.bssp"
#ERROR : Can't open dsspfile "2dplB.bssp"
#ERROR : Can't open dsspfile "2z0cB.bssp"
#ERROR : Can't open dsspfile "1wl8A.bssp"
#ERROR : Can't open dsspfile "2d7jA.bssp"
#ERROR : Can't open dsspfile "2vpiA.bssp"
#ERROR : Can't open dsspfile "2vpiB.bssp"
#ERROR : Can't open dsspfile "2a9vD.bssp"
#ERROR : Can't open dsspfile "2a9vC.bssp"
#ERROR : Can't open dsspfile "2a9vB.bssp"
#ERROR : Can't open dsspfile "2a9vA.bssp"
#ERROR : Can't open dsspfile "1i7qB.bssp"
#ERROR : Can't open dsspfile "1i1qB.bssp"
#ERROR : Can't open dsspfile "1qdlB.bssp"
#ERROR : Can't open dsspfile "1t36B.bssp"
#ERROR : Can't open dsspfile "1jdbF.bssp"
#ERROR : Can't open dsspfile "1bxrB.bssp"
#ERROR : Can't open dsspfile "1m6vB.bssp"
#ERROR : Can't open dsspfile "1c30B.bssp"
#ERROR : Can't open dsspfile "1ox6A.bssp"
#ERROR : Can't open dsspfile "1ox4A.bssp"
#ERROR : Can't open dsspfile "1cs0B.bssp"

## Summary of PDB Search
:503
      0.0 100%  2ywbC  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]
      0.0  99%  2ywbA  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]
      0.0 100%  2ywbB  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]
      0.0 100%  2ywbD  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]
      0.0  97%  2ywcD  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]
      0.0 100%  2ywcB  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]
      0.0  99%  2ywcA  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]
    e-108  46%  1gpmA  [c.23.16 - c.26.2 - d.52.2] GMP SYNTHETASE
    e-106  46%  1gpmB  [c.23.16 - c.26.2 - d.52.2] GMP SYNTHETASE
    6e-58  37%  2vxoB  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]
    1e-51  38%  2vxoA  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]
    5e-51  47%  3a4iA  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT B
    7e-51  48%  2z0cA  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT B
    2e-50  47%  2dplA  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT B
    6e-50  48%  2dplB  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT B
    2e-48  48%  2z0cB  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT B
    5e-32  37%  1wl8A  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT A
    3e-31  37%  2d7jA  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT A
    6e-25  39%  2vpiA  [x.x.x] GMP SYNTHASE
    2e-24  39%  2vpiB  [x.x.x] GMP SYNTHASE
    4e-18  34%  2a9vD  [x.x.x] GMP SYNTHASE
    4e-18  34%  2a9vC  [x.x.x] GMP SYNTHASE
    4e-18  34%  2a9vB  [x.x.x] GMP SYNTHASE
    6e-18  34%  2a9vA  [x.x.x] GMP SYNTHASE
    8e-12  33%  1i7qB  [c.23.16] TRPG
    9e-11  34%  1i1qB  [c.23.16] ANTHRANILATE SYNTHASE COMPONENT II
    2e-10  32%  1qdlB  [c.23.16] PROTEIN (ANTHRANILATE SYNTHASE (TRPG-SUBUNIT))
    1e-06  31%  1t36B  [c.8.3 - c.23.16] CARBAMOYL-PHOSPHATE SYNTHASE SMALL CHAIN
    2e-06  31%  1jdbF  [c.8.3 - c.23.16] CARBAMOYL PHOSPHATE SYNTHETASE
    2e-06  31%  1bxrB  [c.8.3 - c.23.16] CARBAMOYL-PHOSPHATE SYNTHASE
    9e-06  31%  1m6vB  [c.8.3 - c.23.16] CARBAMOYL-PHOSPHATE SYNTHETASE SMALL CHAIN
    3e-05  31%  1c30B  [c.8.3 - c.23.16] CARBAMOYL PHOSPHATE SYNTHETASE: SMALL
    4e-04  29%  1ox6A  [c.23.16 - c.1.2] IMIDAZOLE GLYCEROL PHOSPHATE SYNTHASE HISHF
    4e-04  29%  1ox4A  [c.23.16 - c.1.2] IMIDAZOLE GLYCEROL PHOSPHATE SYNTHASE HISHF
    6e-04  31%  1cs0B  [c.8.3 - c.23.16] CARBAMOYL PHOSPHATE SYNTHETASE: SMALL
:503

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MVLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDAPRPDPRLFSS
2ywbC           MVLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDAPRPDPRLFSS
2ywbA           MVLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDAPRPDPRLFSS
2ywbB           MVLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDAPRPDPRLFSS
2ywbD           MVLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDAPRPDPRLFSS
2ywcD           -VLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDAPRPDPRLFSS
2ywcB           -VLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDAPRPDPRLFSS
2ywcA           -VLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDAPRPDPRLFSS
1gpmA           -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
1gpmB           -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
2vxoB           -VVILDAGAQYGKVIDRRVRELFVQSEIFPLETPAFAIKEQGFRAIIISGGPNSVYAEDAPWFDPAIFTI
2vxoA           -------------------------SEIFPLETPAFAIKEQGFRAIIISGGP-------APWFDPAIFTI
3a4iA           ----------------------------------------------------------------------
2z0cA           ----------------------------------------------------------------------
2dplA           ----------------------------------------------------------------------
2dplB           ----------------------------------------------------------------------
2z0cB           ----------------------------------------------------------------------
1wl8A           MIVIMDNGGQYVHRIWRTLRYLGVETKIIPNTTPLEEIKAMNPKGIIFSGGPSLENTGNCEKVLEHYDEF
2d7jA           MIVIMDNGGQYVHRIWRTLRYLGVETKIIPNTTPLEEIKAMNPKGIIFSGGPSLENTGNCEKVLEHYDEF
2vpiA           -VVILDAGAQYGKVIDRRVRELFVQSEIFPLETPAFAIKEQGFRAIIISG---------APWFDPAIFTI
2vpiB           -VVILDAGAQYGKVIDRRVRELFVQSEIFPLETPAFAIKEQGFRAIIISG----------PWFDPAIFTI
2a9vD           ----------------------------------------------------------------------
2a9vC           ----------------------------------------------------------------------
2a9vB           ----------------------------------------------------------------------
2a9vA           ----------------------------------------------------------------------
1i7qB           ------------------------------------ERLQHMEQVLMLSPGPGTPSEAGCMPELLQRLRG
1i1qB           ----------------------------IPAQTLIDRLATMKNPVLMLSPGPGV---PSEAGCMPELLTG
1qdlB           ------------------------------------------PDRLIISPGPGTPEDIGVSLDVIKYLGK
1t36B           ---------------------------IVPAQTSAEDVLKMNPDGIFLSNGPGDPAPDDAITAIQKFLET
1jdbF           ---------------------------IVPAQTSAEDVLKMNPDGIFLSNGPGDPAPCDAITAIQKFLET
1bxrB           ---------------------------IVPAQTSAEDVLKMNPDGIFLSNGPGDPAPCDAITAIQKFLET
1m6vB           ---------------------------IVPAQTSAEDVLKMNPDGIFLSNGPGDPAPCDAITAIQKFLET
1c30B           ---------------------------IVPAQTSAEDVLKMNPDGIFLSNGPGDPAPCDAITAIQKFLET
1ox6A           -----------------------------------------------------NLFNRGFEKPIREYIES
1ox4A           -----------------------------------------------------NLFNRGFEKPIREYIES
1cs0B           ---------------------------IVPAQTSAEDVLKMNPDGIFLSNGPGDPAPCDAITAIQKFLET


                         .         .         *         .         .         .         .:140
query           GLPLLGICYGMQLLAQELGGRVERAGRAEYGKALLTRHEGPLFRGLEGEVQVWMSHQDAVTAPPPGWRVV
2ywbC           GLPLLGICYGMQLLAQELGGRVERA----YGKALLTRHEGPLFRGLEGEVQVWMSHQDAVTAPPPGWRVV
2ywbA           GLPLLGICYGMQLLAQELGGRVERA---EYGKALLTRHEGPLFRGLEGEVQVWMSHQDAVTAPPPGWRVV
2ywbB           GLPLLGICYGMQLLAQELGGRVERA----YGKALLTRHEGPLFRGLEGEVQVWMSHQDAVTAPPPGWRVV
2ywbD           GLPLLGICYGMQLLAQELGGRVER-----YGKALLTRHEGPLFRGLEGEVQVWMSHQDAVTAPPPGWRVV
2ywcD           GLPLLGICYG-QLLAQELGGRVERAGRAEYGKALLTRHEGPLFRGLEGEVQVW-SHQDAVTAPPPGWRVV
2ywcB           GLPLLGICYG-QLLAQELGGRVERAGRAEYGKALLTRHEGPLFRGLEGEVQVW-SHQDAVTAPPPGWRVV
2ywcA           GLPLLGICYG-QLLAQELGGRVERAGRAEYGKALLTRHEGPLFRGLEGEVQVW-SHQDAVTAPPPGWRVV
1gpmA           GVPVFGVCYGMQTMAMQLGGHVEASNEREFGYAQVVVNDSALVRGIEDALDVWMSHGDKVTAIPSDFITV
1gpmB           GVPVFGVCYGMQTMAMQLGGHVEASNEREFGYAQVVVNDSALVRGIEDALDVWMSHGDKVTAIPSDFITV
2vxoB           GKPVLGICYGMQMMNKVFGGTVHKKSDGVFN--ISVDNTCSLFRGLQKEEVVLLTHGDSVDKVADGFKVV
2vxoA           GKPVLGICYGMQMMNKVFGGTVHKVFNISVDNTC------SLFRGLQKEEVVLLTHGDSVDKVADGFKVV
3a4iA           ----------------------------------------------------------------------
2z0cA           ----------------------------------------------------------------------
2dplA           ----------------------------------------------------------------------
2dplB           ----------------------------------------------------------------------
2z0cB           ----------------------------------------------------------------------
1wl8A           NVPILGICLGHQLIAKFFGGKVGRGEKAEYSLVEIEIIDEEIFKGLPKRLKVWESHMDEVKELPPKFKIL
2d7jA           NVPILGICLGHQLIAKFFGGKVGRGEKAEYSLVXXXXXXXXXFKGLPKRLKVWESHMDEVKELPPKFKIL
2vpiA           GKPVLGICYGMQMMNKVFGGTVHKKSVREDGVNISVDNTCSLFRGLQKEEVVLLTHGDSVDKVADGFKVV
2vpiB           GKPVLGICYGMQMMNKVFGGTVHKKSVREDGVNISVDNTCSLFRGLQKEEVVLLTHGDSVDKVADGFKVV
2a9vD           --PILGICVGAQFIALHFGASVVKAKHPEFGKTKVSVHSENIFGGLPSEITVWENHNDEIINLPDDFTLA
2a9vC           --PILGICVGAQFIALHFGASVVKAKHPEFGKTKVSVHSENIFGGLPSEITVWENHNDEIINLPDDFTLA
2a9vB           --PILGICVGAQFIALHFGASVVKAKHPEFGKTKVSVHSENIFGGLPSEITVWENHNDEIINLPDDFTLA
2a9vA           --PILGICVGAQFIALHFGASVVKAKHPEFGKTKVSVHSENIFGGLPSEITVWENHNDEIINLPDDFTLA
1i7qB           QLPIIGICLGHQAIVEAYGGQVGQAGEILHGKASAIAHDGEMFAGMANPLPVARYHSLVGSNIPADLTVN
1i1qB           KLPIIGICLGHQAIVEAYGGYV---GQILHGKATSIEHDGQMFAGLANPLPVARYHSSNV---PAGLTIN
1qdlB           RTPILGVCLGHQAIGYAFGAKIRRARKVFHGKILVNNSPLSLYYGIAKEFKATRYHSLVVDEVHRPLIVD
1t36B           DIPVFGICLGHQLLALASGAKTV---KMKFG------HHGGNHPVKDVEKNVVMNHGFAVATLPANLRVT
1jdbF           DIPVFGICLGHQLLALASGAKTV---KMKFG------HHGGNHPVKDVEKNVVMNHGFAVATLPANLRVT
1bxrB           DIPVFGICLGHQLLALASGAKTV---KMKFG------HHGGNHPVKDVEKNVVMNHGFAVATLPANLRVT
1m6vB           DIPVFGICLGHQLLALASGAKTV---KMKFG------HHGGNHPVKDVEKNVVMNHGFAVATLPANLRVT
1c30B           DIPVFGISLGHQLLALASGAKTV---KMKFG------HHGGNHPVKDVEKNVVMNHGFAVATLPANLRVT
1ox6A           GKPIMGICVGLQAL---FAGSVEKSTGLNYIDFKLSRFDDSLFFGLDPYKRYYFVHSFAANLENDGWKIA
1ox4A           GKPIMGICVGLQAL---FAGSVEKSTGLNYIDFKLSRFDDSLFFGLDPYKRYYFVHSFAANLENDGWKIA
1cs0B           DIPVFGI-LGHQLLALASGAKTV---KMKFG------HHGGNHPVKDVEKNVVMNHGFAVATLPANLRVT


                         +         .         .         .         .         *         .:210
query           AETEENPVAAIASPDGRAYGVQFHPEVAHTPKGMQILENFLELAGAKRDWTPEHXXXXXXXXXXXXAGKD
2ywbC           AETEENPVAAIASPDGRAYGVQFHPEVAHTPKGMQILENFLELAGVKRDWTPEHXXXXXXXXXXXXAGKD
2ywbA           AETEENPVAAIASPDGRAYGVQFHPEVAHTPKGMQILENFLELAGVKRDWTPEHXXXXXXXXXXXXAGKD
2ywbB           AETEENPVAAIASPDGRAYGVQFHPEVAHTPKGMQILENFLELAGVKRDWTPEHXXXXXXXXXXXXAGKD
2ywbD           AETEENPVAAIASPDGRAYGVQFHPEVAHTPKGMQILENFLELAGVKRDWTPEHXXXXXXXXXXXXAGKD
2ywcD           AETEENPVAAIASPDGRAYGVQFHPEVAHTPKG-QILENFLELAGVKRDWTPEHXXXXXXXXXXXXAGKD
2ywcB           AETEENPVAAIASPDGRAYGVQFHPEVAHTPKG-QILENFLELAGVKRDWTPEHXXXXXXXXXXXXAGKD
2ywcA           AETEENPVAAIASPDGRAYGVQFHPEVAHTPKG-QILENFLELAGVKRDWTPEHXXXXXXXXXXXXAGKD
1gpmA           ASTESCPFAIMANEEKRFYGVQFHPEVTHTRQGMRMLERFVDICQCEALWTPAKIIDDAVARIREQVGDD
1gpmB           ASTESCPFAIMANEEKRFYGVQFHPEVTHTRQGMRMLERFVDICQCEALWTPAKIIDDAVARIREQVGDD
2vxoB           ARS-GNIVAGIANESKKLYGAQFHPEVGLTENGKVILKNFLDIAGCSGTFTVQNRELECIREIKERVGTS
2vxoA           ARS-GNIVAGIANESKKLYGAQFHPEVGLTENGKVILKNFLDIAGCSGTFTVQNRELECIREIKERVGTS
3a4iA           -------------------------------------------------------------------GDS
2z0cA           -------------------------------------------------------------------GDS
2dplA           -------------------------------------------------------------------GDS
2dplB           -------------------------------------------------------------------GDS
2z0cB           -------------------------------------------------------------------GDS
1wl8A           ARS-ETPIEAMKHEELPIYGVQFHPEVAHTEKGEEILRNFAKLCG-------------------------
2d7jA           ARSETCPIEAMKHEELPIYGVQFHPEVAHTEKGEEILRNFAKLCG-------------------------
2vpiA           ARS-GNIVAGIANESKKLYGAQFHPEVGLTENGKVILKNFLDIAGCSGTFT-------------------
2vpiB           ARS-GNIVAGIANESKKLYGAQFHPEVGLTENGKVILKNFLDIAGCSGTFT-------------------
2a9vD           ASSATCQVQGFYHKTRPIYATQFHPEVEHTQYGRDIFRNFIGICASYREIQKEN----------------
2a9vC           ASSATCQVQGFYHKTRPIYATQFHPEVEHTQYGRDIFRNFIGICASYREIQKEN----------------
2a9vB           ASSATCQVQGFYHKTRPIYATQFHPEVEHTQYGRDIFRNFIGICASYREIQKEN----------------
2a9vA           ASSATCQVQGFYHKTRPIYATQFHPEVEHTQYGRDIFRNFIGICASYRE---------------------
1i7qB           ARFGE-MVMAXXXXXXXXCGFQFHPESILTTHGARLLEQTLAWALAK-----------------------
1i1qB           AHFN-GMVMAVRHDADRVCGFQFHPESILTTQGARLLEQTLAWAQQK-----------------------
1qdlB           ASAEDNEIMAIHHEEYPIYGVQFHPESVGTSLGYKILYNFL-----------------------------
1t36B           HKSFDGTLQGIHRTDKPAFSFQGHPEASPGPDAAPLFDHFIEL---------------------------
1jdbF           HKSFDGTLQGIHRTDKPAFSFQGHPEASPGPDAAPLFDHFIEL---------------------------
1bxrB           HKSFDGTLQGIHRTDKPAFSFQGHPEASPGPDAAPLFDHFIEL---------------------------
1m6vB           HKSFDGTLQGIHRTDKPAFSFQGHPEAS---PAAPLFDHFIEL---------------------------
1c30B           HKSFDGTLQGIHRTDKPAFSFQGHPEASPGPDAAPLFDHFIEL---------------------------
1ox6A           KAKYGSEEFIAAVNKNNIFATQFHPEKS-GKAGLNVIENFLK----------------------------
1ox4A           KAKYGSEEFIAAVNKNNIFATQFHPEKS-GKAGLNVIENFLK----------------------------
1cs0B           HKSFDGTLQGIHRTDKPAFSFQGHPEASPGPDAAPLFDHFIEL---------------------------


                         .         .         .         +         .         .         .:280
query           RVLLAVSGGVDSSTLALLLAKAGVDHLAVFVDHXXXXXXXXXXXXXXXXXXGVNLLVVDAKERFLKALKG
2ywbC           RVLLAVSGGVDSSTLALLLAKAGVDHLAVFVDHXXXXXXXXXXXXXXXXXXGVNLLVVDAKERFLKALKG
2ywbA           RVLLAVSGGVDSSTLALLLAKAGVDHLAVFVDHXXXXXXXXXXXXXXXXXXGVNLLVVDAKERFLKALKG
2ywbB           RVLLAVSGGVDSSTLALLLAKAGVDHLAVFVDHXXXXXXXXXXXXXXXXXXGVNLLVVDAKERFLKALKG
2ywbD           RVLLAVSGGVDSSTLALLLAKAGVDHLAVFVDHXXXXXXXXXXXXXXXXXXGVNLLVVDAKERFLKALKG
2ywcD           RVLLAVSGGVDSSTLALLLAKAGVDHLAVFVDHXXXXXXXXXXXXXXXXXXGVNLLVVDAKERFLKALKG
2ywcB           RVLLAVSGGVDSSTLALLLAKAGVDHLAVFVDHXXXXXXXXXXXXXXXXXXGVNLLVVDAKERFLKALKG
2ywcA           RVLLAVSGGVDSSTLALLLAKAGVDHLAVFVDHXXXXXXXXXXXXXXXXXXGVNLLVVDAKERFLKALKG
1gpmA           KVILGLSGGVDSSVTAMLLHRAGKNLTCVFVDNGLLRLNEAEQVLDMFGDHGLNIVHVPAEDRFLSALAG
1gpmB           KVILGLSGGVDSSVTAMLLHRAGKNLTCVFVDNLLRLNEAEQVLDMFGDHFGLNIVHVPAEDRFLSALAG
2vxoB           KVLVLLSGGVDSTVCTALLNRAQEQVIAVHIDNGFMRKRESQSVEEALKKLGIQVKVINAAHSFYKTLNM
2vxoA           KVLVLLSGGVDSTVCTALLNRAQEQVIAVHIDNGFMRKRESQSVEEALKKLGIQVKVINAAHSFYKTLNM
3a4iA           KAIIALSGGVDSSTAAVLAHKAIGDRLAVFVNTGFLRKGEPEFVVKTFRDEGMNLHYVDAQDRFFSALKG
2z0cA           KAIIALSGGVDSSTAAVLAHKAIGDRLAVFVNTGFLRKGEPEFVVKTFRDEGMNLHYVDAQDRFFSALKG
2dplA           KAIIALSGGVDSSTAAVLAHKAIGDRLAVFVNTGFLRKGEPEFVVKTFRDEGMNLHYVDAQDRFFSALKG
2dplB           KAIIALSGGVDSSTAAVLAHKAIGDRLAVFVNTGFLRKGEPEFVVKTFRDEGMNLHYVDAQDRFFSALKG
2z0cB           KAIIALSGGVDSSTAAVLAHKAIGDRLAVFVNTGFLRKGEPEFVVKTFRDEGMNLHYVDAQDRFFSALKG
1wl8A           ----------------------------------------------------------------------
2d7jA           ----------------------------------------------------------------------
2vpiA           ----------------------------------------------------------------------
2vpiB           ----------------------------------------------------------------------
2a9vD           ----------------------------------------------------------------------
2a9vC           ----------------------------------------------------------------------
2a9vB           ----------------------------------------------------------------------
2a9vA           ----------------------------------------------------------------------
1i7qB           ----------------------------------------------------------------------
1i1qB           ----------------------------------------------------------------------
1qdlB           ----------------------------------------------------------------------
1t36B           ----------------------------------------------------------------------
1jdbF           ----------------------------------------------------------------------
1bxrB           ----------------------------------------------------------------------
1m6vB           ----------------------------------------------------------------------
1c30B           ----------------------------------------------------------------------
1ox6A           ----------------------------------------------------------------------
1ox4A           ----------------------------------------------------------------------
1cs0B           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VEDPEEKRKIIGREFVAAFSQVARERGPFRFLAQGTLYPDVIESAGGHGAAKIKSHHNVGGXXXXXXXXX
2ywbC           VEDPEEKRKIIGREFVAAFSQVARERGPFRFLAQGTLYPDVIESA---------------------XXXX
2ywbA           VEDPEEKRKIIGREFVAAFSQVARERGPFRFLAQGTLYPDVI-----------------XXXXXXXXXXX
2ywbB           VEDPEEKRKIIGREFVAAFSQVARERGPFRFLAQGTLYPDVI------------------------XXXX
2ywbD           VEDPEEKRKIIGREFVAAFSQVARERGPFRFLAQGTLYPDVI-----------------------XXXXX
2ywcD           VEDPEEKRKIIGREFVAAFSQVARERGPFRFLAQGTLYPDVI-------------------------FEL
2ywcB           VEDPEEKRKIIGREFVAAFSQVARERGPFRFLAQGTLYPDVI------------------------XXXX
2ywcA           VEDPEEKRKIIGREFVAAFSQVARERGPFRFLAQGTLYPDVI----------------XXXXXXXXXXXX
1gpmA           ENDPEAKRKIIGRVFVEVFDEEALKLEDVKWLAQGTIYPDVIESAAKMGLVE------------------
1gpmB           ENDPEAKRKIIGRVFVEVFDEEALKLEDVKWLAQGTIYPDVIEMKMG----------------------L
2vxoB           TTSPEEKRKIIGDTFVKIANEVIGEKPEEVFLAQGTLRPDLIESASLVASGKIKTHHNDTERKLREEGKV
2vxoA           TTSPEEKRKIIGDTFVKIANEVIGEKPEEVFLAQGTLRPDLIESASLVASGKIKTHHNDTERKLREEGKV
3a4iA           VTDPEEKRKIIGRVFIEVFEEVAKKIGA-EYLIQGTIAPNL---------------------------KL
2z0cA           VTDPEEKRKIIGRVFIEVFEEVAKKIGA-EYLIQGTIALKLIEPL-------------------------
2dplA           VTDPEEKRKIIGRVFIEVFEEVAKKIGA-EYLIQGTIAPLNLK--------------------------L
2dplB           VTDPEEKRKIIGRVFIEVFEEVAKKIGA-EYLIQGTILK-LIEPL-------------------------
2z0cB           VTDPEEKRKIIGRVFIEVFEEVAKKIGA-EYLIQGTILK-LIEPL-------------------------
1wl8A           ----------------------------------------------------------------------
2d7jA           ----------------------------------------------------------------------
2vpiA           ----------------------------------------------------------------------
2vpiB           ----------------------------------------------------------------------
2a9vD           ----------------------------------------------------------------------
2a9vC           ----------------------------------------------------------------------
2a9vB           ----------------------------------------------------------------------
2a9vA           ----------------------------------------------------------------------
1i7qB           ----------------------------------------------------------------------
1i1qB           ----------------------------------------------------------------------
1qdlB           ----------------------------------------------------------------------
1t36B           ----------------------------------------------------------------------
1jdbF           ----------------------------------------------------------------------
1bxrB           ----------------------------------------------------------------------
1m6vB           ----------------------------------------------------------------------
1c30B           ----------------------------------------------------------------------
1ox6A           ----------------------------------------------------------------------
1ox4A           ----------------------------------------------------------------------
1cs0B           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           XXXXXXXXKDEVREXXXXXXXXXXXXXRHPFPGPGLAVRVLGEVTEERLEILRRADDIFTSLLREWGLYE
2ywbC           XXXXXXXXKDEVREXXXXXXXXXXXXXRHPFPGPGLAVRVLGEVTEERLEILRRADDIFTSLLREWGLYE
2ywbA           XXXXXXXXKDEVREXXXXXXXXXXXXXRHPFPGPGLAVRVLGEVTEERLEILRRADDIFTSLLREWGLYE
2ywbB           XXXXXXXXKDEVREXXXXXXXXXXXXXRHPFPGPGLAVRVLGEVTEERLEILRRADDIFTSLLREWGLYE
2ywbD           XXXXXXXXKDEVREXXXXXXXXXXXXXRHPFPGPGLAVRVLGEVTEERLEILRRADDIFTSLLREWGLYE
2ywcD           LEPFRLLFKDEVREXXXXXXXXXXXXXRHPFPGPGLAVRVLGEVTEERLEILRRADDIFTSLLREWGLYE
2ywcB           XXXXXXXXKDEVREXXXXXXXXXXXXXRHPFPGPGLAVRVLGEVTEERLEILRRADDIFTSLLREWGLYE
2ywcA           XXXXXXXXKDEVREXXXXXXXXXXXXXRHPFPGPGLAVRVLGEVTEERLEILRRADDIFTSLLREWGLYE
1gpmA           --PLKELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRADAIFIEELRKADLYD
1gpmB           VEPLKELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRADAIFIEELRKADLYD
2vxoB           IEPLKDFHKDEVRILGRELGLPEELVSRHPFPGPGLAIRVICKDFPETNNILKIVADFSASVKKPHTLLQ
2vxoA           IEPLKDFHKDEVRILGRELGLPEELVSRHPFPGPGLAIRVICKDFPETNNILKIVADFSASVKKPHTLLQ
3a4iA           IEPLRDLYKDEVRELAKFLGLPEKIYNRMPFPGPGLAVRVIGEVTPEKIRIVREANAIVEEEVERAGL--
2z0cA           ----RDLYKDEVRELAKFLGLPEKIYNRMPFPGPGLAVRVIGEVTPEKIRIVREANAIVEEEVERAGL--
2dplA           IEPLRDLYKDEVRELAKFLGLPEKIYNRMPFPGPGLAVRVIGEVTPEKIRIVREANAIVEEEVERAGL--
2dplB           ----RDLYKDEVRELAKFLGLPEKIYNRMPFPGPGLAVRVIGEVTPEKIRIVREANAIVEEEVERAGL--
2z0cB           ----RDLYKDEVRELAKFLGLPEKIYNRMPFPGPGLAVRVIGEVTPEKIRIVREANAIVEEEVERAGL--
1wl8A           ----------------------------------------------------------------------
2d7jA           ----------------------------------------------------------------------
2vpiA           ----------------------------------------------------------------------
2vpiB           ----------------------------------------------------------------------
2a9vD           ----------------------------------------------------------------------
2a9vC           ----------------------------------------------------------------------
2a9vB           ----------------------------------------------------------------------
2a9vA           ----------------------------------------------------------------------
1i7qB           ----------------------------------------------------------------------
1i1qB           ----------------------------------------------------------------------
1qdlB           ----------------------------------------------------------------------
1t36B           ----------------------------------------------------------------------
1jdbF           ----------------------------------------------------------------------
1bxrB           ----------------------------------------------------------------------
1m6vB           ----------------------------------------------------------------------
1c30B           ----------------------------------------------------------------------
1ox6A           ----------------------------------------------------------------------
1ox4A           ----------------------------------------------------------------------
1cs0B           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           KVAQALAVLTPVRSVGVAGDERKYGYVLALRAVTTEDFMTADWARLPLEFLDEAARRITRRVPEIGRVVY
2ywbC           KVAQALAVLTPV------------GYVLALRAVTTEDFMTADWARLPLEFLDEAARRITRRVPEIGRVVY
2ywbA           KVAQALAVLTPV------------GYVLALRAVTTEDFMTADWARLPLEFLDEAARRITRRVPEIGRVVY
2ywbB           KVAQALAVLTPV------------GYVLALRAVTTEDFMTADWARLPLEFLDEAARRITRRVPEIGRVVY
2ywbD           KVAQALAVLTPV------------GYVLALRAVTTEDFMTADWARLPLEFLDEAARRITRRVPEIGRVVY
2ywcD           KVAQALAVLTPVR-----------GYVLALRAVTTEDF-TADWARLPLEFLDEAARRITRRVPEIGRVVY
2ywcB           KVAQALAVLTPV------------GYVLALRAVTTEDF-TADWARLPLEFLDEAARRITRRVPEIGRVVY
2ywcA           KVAQALAVLTPV------------GYVLALRAVTTEDF-TADWARLPLEFLDEAARRITRRVPEIGRVVY
1gpmA           KVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDFLGRVSNRIINEVNGISRVVY
1gpmB           KVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDFLGRVSNRIINEVNGISRVVY
2vxoB           RVKACTAFLLPIKTVGVQGDCRSYSYVC---GISSKD--EPDW-----ESLIFLARLIPRMCHNVNRVVY
2vxoA           RVKACTAFLLPIKTVGVQGDCRSYSYVC---GISSKD--EPDW-----ESLIFLARLIPRMCHNVNRVVY
3a4iA           RPWQAFAVLLGVKTVGVQGDIRAYKETIAVRIVESIDGMTANAMNVPWEVLQRIAFRITSEIPEVGRVLY
2z0cA           RPWQAFAVLLGVKTVGVQGDIRAYKETIAVRIVESIDGMTANAMNVPWEVLQRIAFRITSEIPEVGRVLY
2dplA           RPWQAFAVLLGVKTVGVQGDIRAYKETIAVRIVESIDGMTANAMNVPWEVLQRIAFRITSEIPEVGRVLY
2dplB           RPWQAFAVLLGVKTVGVQGDIRAYKETIAVRIVESIDGMTANAMNVPWEVLQRIAFRITSEIPEVGRVLY
2z0cB           RPWQAFAVLLGVKTVGVQGDIRAYKETIAVRIVES---MTANAMNVPWEVLQRIAFRITSEIPEVGRVLY
1wl8A           ----------------------------------------------------------------------
2d7jA           ----------------------------------------------------------------------
2vpiA           ----------------------------------------------------------------------
2vpiB           ----------------------------------------------------------------------
2a9vD           ----------------------------------------------------------------------
2a9vC           ----------------------------------------------------------------------
2a9vB           ----------------------------------------------------------------------
2a9vA           ----------------------------------------------------------------------
1i7qB           ----------------------------------------------------------------------
1i1qB           ----------------------------------------------------------------------
1qdlB           ----------------------------------------------------------------------
1t36B           ----------------------------------------------------------------------
1jdbF           ----------------------------------------------------------------------
1bxrB           ----------------------------------------------------------------------
1m6vB           ----------------------------------------------------------------------
1c30B           ----------------------------------------------------------------------
1ox6A           ----------------------------------------------------------------------
1ox4A           ----------------------------------------------------------------------
1cs0B           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           DLTSKPPATIEWE
2ywbC           DLTSKPPATIEWE
2ywbA           DLTSKPPATIEWE
2ywbB           DLTSKPPATIEWE
2ywbD           DLTSKPPATIEWE
2ywcD           DLTSKPPATIEWE
2ywcB           DLTSKPPATIEWE
2ywcA           DLTSKPPATIEWE
1gpmA           DISGKPPATIEWE
1gpmB           DISGKPPATIEWE
2vxoB           -------------
2vxoA           -------------
3a4iA           DITNKPPATIEFE
2z0cA           DITNKPPATIEFE
2dplA           DITNKPPATIEFE
2dplB           DITNKPPATIEFE
2z0cB           DITNKPPATIEFE
1wl8A           -------------
2d7jA           -------------
2vpiA           -------------
2vpiB           -------------
2a9vD           -------------
2a9vC           -------------
2a9vB           -------------
2a9vA           -------------
1i7qB           -------------
1i1qB           -------------
1qdlB           -------------
1t36B           -------------
1jdbF           -------------
1bxrB           -------------
1m6vB           -------------
1c30B           -------------
1ox6A           -------------
1ox4A           -------------
1cs0B           -------------