[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tthe0:AAS81541.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1wrjA.bssp"
#ERROR : Can't open dsspfile "1mgtA.bssp"
#ERROR : Can't open dsspfile "1yfhB.bssp"
#ERROR : Can't open dsspfile "1yfhA.bssp"
#ERROR : Can't open dsspfile "1t38A.bssp"
#ERROR : Can't open dsspfile "1eh6A.bssp"
#ERROR : Can't open dsspfile "1t39B.bssp"
#ERROR : Can't open dsspfile "1t39A.bssp"
#ERROR : Can't open dsspfile "1qntA.bssp"
#ERROR : Can't open dsspfile "2g7hA.bssp"
#ERROR : Can't open dsspfile "1eh7A.bssp"
#ERROR : Can't open dsspfile "1eh8A.bssp"
#ERROR : Can't open dsspfile "1sfeA.bssp"
#ERROR : Can't open dsspfile "1yfhC.bssp"
#ERROR : Can't open dsspfile "3gx4X.bssp"
#ERROR : Can't open dsspfile "3gvaA.bssp"

## Summary of PDB Search
:147
    1e-11  35%  1wrjA  [x.x.x] METHYLATED-DNA--PROTEIN-CYSTEINE
    3e-11  38%  1mgtA  [c.55.7 - a.4.2] PROTEIN (O6-METHYLGUANINE-DNA
    6e-11  34%  1yfhB  [x.x.x] METHYLATED-DNA--PROTEIN-CYSTEINE
    6e-11  34%  1yfhA  [x.x.x] METHYLATED-DNA--PROTEIN-CYSTEINE
    8e-11  38%  1t38A  [c.55.7 - a.4.2] METHYLATED-DNA--PROTEIN-CYSTEINE
    8e-11  34%  1eh6A  [c.55.7 - a.4.2] O6-ALKYLGUANINE-DNA ALKYLTRANSFERASE
    1e-10  38%  1t39B  [c.55.7 - a.4.2] METHYLATED-DNA--PROTEIN-CYSTEINE
    1e-10  38%  1t39A  [c.55.7 - a.4.2] METHYLATED-DNA--PROTEIN-CYSTEINE
    1e-10  38%  1qntA  [c.55.7 - a.4.2] METHYLATED-DNA--PROTEIN-CYSTEINE
    4e-10  40%  2g7hA  [x.x.x] METHYLATED-DNA--PROTEIN-CYSTEINE
    1e-09  34%  1eh7A  [c.55.7 - a.4.2] O6-ALKYLGUANINE-DNA ALKYLTRANSFERASE
    2e-09  34%  1eh8A  [c.55.7 - a.4.2] O6-ALKYLGUANINE-DNA ALKYLTRANSFERASE
    4e-08  31%  1sfeA  [x.x.x] ADA O6-METHYLGUANINE-DNA METHYLTRANSFERASE
    5e-08  40%  1yfhC  [x.x.x] METHYLATED-DNA--PROTEIN-CYSTEINE
    3e-05  36%  3gx4X  [x.x.x] ALKYLTRANSFERASE-LIKE PROTEIN 1
    3e-05  36%  3gvaA  [x.x.x] ALKYLTRANSFERASE-LIKE PROTEIN 1
:147

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxTPLGPLWLEVSPLGVRRLEPALYPRGPEAEGALALKVREAVQAYFAGERPDFLDLPLDYTGLSPAR
1wrjA           -----------------------------------------------YFEGKKVDLTE-PVDFKPFNEFR
1mgtA           ------------------------------------------------------------LSFEGVTPFE
1yfhB           ----SPLGKLELSGCEQGLHEIKPAAVLGGPEP----LMQCTAWLNAYF--HQPEAIEFPVPFQQESFTR
1yfhA           ----SPLGKLELSGCEQGLHEIKPAAVLGGPEP----LMQCTAWLNAYF--HQPEAIEFPVPFQQESFTR
1t38A           ----------------------------------------------------------------------
1eh6A           ----SPLGKLELSGCEQGLHEIKPAAVLGGPEP----LMQCTAWLNAYF--HQPEAIEFPVPFQQESFTR
1t39B           ----------------------------------------------------------------------
1t39A           ----------------------------------------------------------------------
1qntA           ----------------------------------------------------------------------
2g7hA           ---------------------------------------KVRELIS--YKLEVPEFTKKVLDI-------
1eh7A           ----SPLGKLELSGCEQGLHEIKPAAVLGGPEP----LMQCTAWLNAYF--HQPEAIEFPVPFQQESFTR
1eh8A           ----SPLGKLELSGCEQGLHEIKPAAVLGGPEP----LMQCTAWLNAYF--HQPEAIEFPVPFQQESFTR
1sfeA           -------------------------MFPAADNAPADLMFQVREVIASLNQRDTP--LTLPLDIRGTA-FQ
1yfhC           ----------------------------------------------------------------------
3gx4X           ----------------------------------------------------------------------
3gvaA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LRLYERVRLVPYGRTVSYGALGRELGLSPRAVGAALRACPFFLLVPAHRVIHADGRLGGFQGQEGLKLWL
1wrjA           IRVFKEVMRIKWGEVRTYKQVADAVKTSPRAVGTALSKNNVLLIIPCHRVI-GEKSLGGYSRGVELKRKL
1mgtA           KKVYEWLKNVKRGSVITYGDLAKALNTSPRAVGGAMKRNPYPIVVPCHRVVAHDG-IGYYSSGIEEKKFL
1yfhB           QVLWKLLKVVKFGEVISYQQLAALAGKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWL
1yfhA           QVLWKLLKVVKFGEVISYQQLAALAGKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWL
1t38A           --LWKLLKVVKFGEVISYQQLAALAGKAARAVGGAMRGNPVPILIPSHRVVCSSGAVGNYSGGLAVKEWL
1eh6A           QVLWKLLKVVKFGEVISYQQLAALAGKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWL
1t39B           --LWKLLKVVKFGEVISYQQLAALAGKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWL
1t39A           --LWKLLKVVKFGEVISYQQLAALAGKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWL
1qntA           --LWKLLKVVKFGEVISYQQLAALAGKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWL
2g7hA           ------VKDIEFGKTLTYGDIAKKLNTSPRAVGMALKRNPLPLIIPCHRVV-AKNSLGGYSYGLDKKKFI
1eh7A           QVLWKLLKVVKFGEVISYQQLAALAGKAARAVGGAMRGNPVPILIP-HRVVCSSGAVGNYSGGLAVKEWL
1eh8A           QVLWKLLKVVKFGEVISYQQLAALAGKAARAVGGAMRGNPVPILIP-HRVVCSSGAVGNYSGGLAVKEWL
1sfeA           QQVWQALRTIPCGETVSYQQLANAIG-KPKXXXXXXXXXXLAIVIPCHRVVRGDGSLSGYRWGVSRKAQL
1yfhC           --LWKLLKVVKFGEVISYQQLAALAGKAARAVGGAMRGNPVPILIPCHRVVCSSGAVG-----LAVKEWL
3gx4X           -KVYDAVCEIPYGKVSTYGEIARYVGMPARQVGQAMKHLHPETHVPWHRVINSRGTI-------------
3gvaA           -KVYDAVCEIPYGKVSTYGEIARYVGMPARQVGQAMKHLHPETHVPWHRVINSRGTI-------------


                         +         .         .         .         .         *         .:210
query           LRFEGxx
1wrjA           LELEG--
1mgtA           LEIEG--
1yfhB           LAHEG--
1yfhA           LAHEG--
1t38A           LAHEG--
1eh6A           LAHEG--
1t39B           LAHEG--
1t39A           LAHEG--
1qntA           LAHEG--
2g7hA           LERE---
1eh7A           LAHEG--
1eh8A           LAHEG--
1sfeA           LRRE---
1yfhC           LAHEG--
3gx4X           -------
3gvaA           -------