[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tthe0:AAS81546.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2gs9A.bssp"
#ERROR : Can't open dsspfile "2fo7A.bssp"
#ERROR : Can't open dsspfile "1na0A.bssp"
#ERROR : Can't open dsspfile "2avpA.bssp"
#ERROR : Can't open dsspfile "1na3A.bssp"

## Summary of PDB Search
:916
    5e-05  48%  2gs9A  [x.x.x] HYPOTHETICAL PROTEIN TT1324
    8e-05  33%  2fo7A  [x.x.x] SYNTHETIC CONSENSUS TPR PROTEIN
    1e-04  32%  1na0A  [k.38.1] DESIGNED PROTEIN CTPR3
    1e-04  33%  2avpA  [x.x.x] SYNTHETIC CONSENSUS TPR PROTEIN
    4e-04  33%  1na3A  [k.38.1] DESIGNED PROTEIN CTPR2
:916

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2gs9A           ----------------------------------------------------------------------
2fo7A           ----------------------------------------------------------------------
1na0A           ----------------------------------------------------------------------
2avpA           ----------------------------------------------------------------------
1na3A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxLPPRVEGRVLEVGAFTGALVGFLQRKRPDLEWHALDGVEEAVALGKKRVPEV
2gs9A           ------------------LPPGES--LLEVGAGTGY---WLRR----LPYPQKVGVEEALAVGRRRAPEA
2fo7A           ----------------------------------------------------------------------
1na0A           ----------------------------------------------------------------------
2avpA           ----------------------------------------------------------------------
1na3A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AWHLGWAEEVELPPFDTLLLLSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2gs9A           TWVRAWGEALPFPSFDVVLLFT------------------------------------------------
2fo7A           ----------------------------------------------------------------------
1na0A           ----------------------------------------------------------------------
2avpA           ----------------------------------------------------------------------
1na3A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2gs9A           ----------------------------------------------------------------------
2fo7A           ----------------------------------------------------------------------
1na0A           ----------------------------------------------------------------------
2avpA           ----------------------------------------------------------------------
1na3A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2gs9A           ----------------------------------------------------------------------
2fo7A           ----------------------------------------------------------------------
1na0A           ----------------------------------------------------------------------
2avpA           ----------------------------------------------------------------------
1na3A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2gs9A           ----------------------------------------------------------------------
2fo7A           ----------------------------------------------------------------------
1na0A           ----------------------------------------------------------------------
2avpA           ----------------------------------------------------------------------
1na3A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2gs9A           ----------------------------------------------------------------------
2fo7A           ----------------------------------------------------------------------
1na0A           ----------------------------------------------------------------------
2avpA           ----------------------------------------------------------------------
1na3A           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2gs9A           ----------------------------------------------------------------------
2fo7A           ----------------------------------------------------------------------
1na0A           ----------------------------------------------------------------------
2avpA           ----------------------------------------------------------------------
1na3A           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2gs9A           ----------------------------------------------------------------------
2fo7A           ----------------------------------------------------------------------
1na0A           ----------------------------------------------------------------------
2avpA           ----------------------------------------------------------------------
1na3A           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxALYAAGRAEEVGRLLEEELKAH
2gs9A           ----------------------------------------------------------------------
2fo7A           ------------------------------------------------AYYKQGDYDEAIEYYQKALELD
1na0A           ------------------------------------------------AYYKQGDYDEAIEYYQKALELD
2avpA           ------------------------------------------------AYYKQGDYDEAIEYYQKALELD
1na3A           ------------------------------------------------AYYKQGDYDEAIEYYQKALELD


                         .         .         .         .         +         .         .:770
query           PQALEVLFDLAEHHEAQGDWRRAAEFWQKALEVALYREKDLALAREILRNLLFLRPHDxxxxxxxxxxxx
2gs9A           ----------------------------------------------------------------------
2fo7A           PRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELAYYKQGDYDEAIEYYQKALELDP--------------
1na0A           PNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELAYYKQGDYDEAIEYYQKALELDPNN------------
2avpA           PRSAEAWYNLGNAYYKQGDYDEAIEYYQKALEL-------------------------------------
1na3A           PNNAEAWYNLGNAYYKQGDYDEAIEYYQKALEL-------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2gs9A           ----------------------------------------------------------------------
2fo7A           ----------------------------------------------------------------------
1na0A           ----------------------------------------------------------------------
2avpA           ----------------------------------------------------------------------
1na3A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2gs9A           ----------------------------------------------------------------------
2fo7A           ----------------------------------------------------------------------
1na0A           ----------------------------------------------------------------------
2avpA           ----------------------------------------------------------------------
1na3A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           xxxxxx
2gs9A           ------
2fo7A           ------
1na0A           ------
2avpA           ------
1na3A           ------