[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tthe0:AAS81585.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3hjnB.bssp"
#ERROR : Can't open dsspfile "3hjnA.bssp"
#ERROR : Can't open dsspfile "2z0hA.bssp"
#ERROR : Can't open dsspfile "2pbrA.bssp"
#ERROR : Can't open dsspfile "2ccgA.bssp"
#ERROR : Can't open dsspfile "2cckA.bssp"
#ERROR : Can't open dsspfile "2ccjB.bssp"
#ERROR : Can't open dsspfile "2cckB.bssp"
#ERROR : Can't open dsspfile "2ccgB.bssp"
#ERROR : Can't open dsspfile "2z0hB.bssp"
#ERROR : Can't open dsspfile "2ccjA.bssp"
#ERROR : Can't open dsspfile "4tmkA.bssp"
#ERROR : Can't open dsspfile "2plrB.bssp"
#ERROR : Can't open dsspfile "2plrA.bssp"
#ERROR : Can't open dsspfile "1e9fA.bssp"
#ERROR : Can't open dsspfile "1e9dA.bssp"
#ERROR : Can't open dsspfile "1e9cA.bssp"
#ERROR : Can't open dsspfile "1nn5A.bssp"
#ERROR : Can't open dsspfile "1e2gA.bssp"
#ERROR : Can't open dsspfile "1e98A.bssp"
#ERROR : Can't open dsspfile "1e2fA.bssp"
#ERROR : Can't open dsspfile "1e2dA.bssp"
#ERROR : Can't open dsspfile "3tmkC.bssp"
#ERROR : Can't open dsspfile "3tmkE.bssp"
#ERROR : Can't open dsspfile "3tmkD.bssp"
#ERROR : Can't open dsspfile "3tmkA.bssp"
#ERROR : Can't open dsspfile "1tmkA.bssp"
#ERROR : Can't open dsspfile "1w2hB.bssp"
#ERROR : Can't open dsspfile "1n5kA.bssp"
#ERROR : Can't open dsspfile "1g3uA.bssp"
#ERROR : Can't open dsspfile "1n5kB.bssp"
#ERROR : Can't open dsspfile "1n5lA.bssp"
#ERROR : Can't open dsspfile "1w2hA.bssp"
#ERROR : Can't open dsspfile "1n5lB.bssp"
#ERROR : Can't open dsspfile "2v54B.bssp"
#ERROR : Can't open dsspfile "2v54A.bssp"
#ERROR : Can't open dsspfile "2yvuB.bssp"
#ERROR : Can't open dsspfile "2yvuA.bssp"
#ERROR : Can't open dsspfile "1rj9B.bssp"
#ERROR : Can't open dsspfile "1okkA.bssp"
#ERROR : Can't open dsspfile "2ng1A.bssp"
#ERROR : Can't open dsspfile "1ls1A.bssp"
#ERROR : Can't open dsspfile "1jpnA.bssp"
#ERROR : Can't open dsspfile "1jpnB.bssp"
#ERROR : Can't open dsspfile "1jpjA.bssp"
#ERROR : Can't open dsspfile "2j7pB.bssp"
#ERROR : Can't open dsspfile "2j7pA.bssp"
#ERROR : Can't open dsspfile "2ffhA.bssp"
#ERROR : Can't open dsspfile "1ffhA.bssp"
#ERROR : Can't open dsspfile "2c04A.bssp"
#ERROR : Can't open dsspfile "2c03B.bssp"
#ERROR : Can't open dsspfile "2c03A.bssp"

## Summary of PDB Search
:198
    4e-38  50%  3hjnB  [x.x.x] THYMIDYLATE KINASE
    4e-38  49%  3hjnA  [x.x.x] THYMIDYLATE KINASE
    1e-35  49%  2z0hA  [x.x.x] THYMIDYLATE KINASE
    7e-33  41%  2pbrA  [x.x.x] THYMIDYLATE KINASE
    6e-29  41%  2ccgA  [x.x.x] THYMIDYLATE KINASE
    2e-28  42%  2cckA  [x.x.x] THYMIDYLATE KINASE
    2e-28  41%  2ccjB  [x.x.x] THYMIDYLATE KINASE
    3e-28  42%  2cckB  [x.x.x] THYMIDYLATE KINASE
    3e-28  40%  2ccgB  [x.x.x] THYMIDYLATE KINASE
    2e-27  44%  2z0hB  [x.x.x] THYMIDYLATE KINASE
    2e-27  41%  2ccjA  [x.x.x] THYMIDYLATE KINASE
    5e-27  42%  4tmkA  [c.37.1] PROTEIN (THYMIDYLATE KINASE)
    1e-14  33%  2plrB  [x.x.x] PROBABLE THYMIDYLATE KINASE
    2e-14  32%  2plrA  [x.x.x] PROBABLE THYMIDYLATE KINASE
    5e-12  37%  1e9fA  [c.37.1] THYMIDYLATE KINASE
    2e-11  37%  1e9dA  [c.37.1] THYMIDYLATE KINASE
    2e-11  37%  1e9cA  [c.37.1] THYMIDYLATE KINASE
    2e-11  37%  1nn5A  [c.37.1] SIMILAR TO DEOXYTHYMIDYLATE KINASE (THYMIDYLATE
    3e-11  36%  1e2gA  [c.37.1] THYMIDYLATE KINASE
    5e-11  36%  1e98A  [c.37.1] THYMIDYLATE KINASE
    5e-11  36%  1e2fA  [c.37.1] THYMIDYLATE KINASE
    5e-11  36%  1e2dA  [c.37.1] THYMIDYLATE KINASE
    1e-09  34%  3tmkC  [c.37.1] THYMIDYLATE KINASE
    6e-09  40%  3tmkE  [c.37.1] THYMIDYLATE KINASE
    6e-09  40%  3tmkD  [c.37.1] THYMIDYLATE KINASE
    6e-09  40%  3tmkA  [c.37.1] THYMIDYLATE KINASE
    6e-09  40%  1tmkA  [c.37.1] THYMIDYLATE KINASE
    8e-08  31%  1w2hB  [x.x.x] THYMIDYLATE KINASE TMK
    2e-07  31%  1n5kA  [c.37.1] THYMIDYLATE KINASE
    2e-07  33%  1g3uA  [c.37.1] THYMIDYLATE KINASE
    3e-07  34%  1n5kB  [c.37.1] THYMIDYLATE KINASE
    4e-07  32%  1n5lA  [c.37.1] THYMIDYLATE KINASE
    7e-07  34%  1w2hA  [x.x.x] THYMIDYLATE KINASE TMK
    1e-06  39%  1n5lB  [c.37.1] THYMIDYLATE KINASE
    2e-04  34%  2v54B  [x.x.x] THYMIDYLATE KINASE
    2e-04  34%  2v54A  [x.x.x] THYMIDYLATE KINASE
    0.001  55%  2yvuB  [x.x.x] PROBABLE ADENYLYL-SULFATE KINASE
    0.001  55%  2yvuA  [x.x.x] PROBABLE ADENYLYL-SULFATE KINASE
    0.001  55%  1rj9B  [a.24.13 - c.37.1] SIGNAL RECOGNITION PARTICLE PROTEIN
    0.001  55%  1okkA  [a.24.13 - c.37.1] SIGNAL RECOGNITION PARTICLE PROTEIN
    0.001  55%  2ng1A  [x.x.x] SIGNAL SEQUENCE RECOGNITION PROTEIN FFH
    0.001  55%  1ls1A  [a.24.13 - c.37.1] SIGNAL RECOGNITION PARTICLE PROTEIN
    0.001  55%  1jpnA  [a.24.13 - c.37.1] SIGNAL RECOGNITION PARTICLE PROTEIN
    0.001  55%  1jpnB  [a.24.13 - c.37.1] SIGNAL RECOGNITION PARTICLE PROTEIN
    0.001  55%  1jpjA  [a.24.13 - c.37.1] SIGNAL RECOGNITION PARTICLE PROTEIN
    0.001  55%  2j7pB  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    0.001  55%  2j7pA  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    0.001  55%  2ffhA  [a.24.13 - c.37.1 - a.36.1] PROTEIN (FFH)
    0.001  55%  1ffhA  [x.x.x] FFH
    0.001  55%  2c04A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    0.001  55%  2c03B  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    0.001  55%  2c03A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
:198

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxGLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLPEVRSLLLTQELSPEAEYLLFSADRA
3hjnB           ---MFITFEGIDGSGKSTQIQLLAQYLEKRGKKVILKREPGGTETKIRKILLEEEVTPKAELFLFLASRN
3hjnA           ---MFITFEGIDGSGKSTQIQLLAQYLEKRGKKVILKREPGGTETKIRKILLEEEVTPKAELFLFLASRN
2z0hA           ---MFITFEGIDGSGKSTQIQLLAQYLEKRGK-VILKREPGGTETKIRKILLEEEVTPKAELFLFLASR-
2pbrA           ---MLIAFEGIDGSGKTTQAKKLYEYLKQKGYFVSLYREPGGTVGEVXXXXXXXXXXXXXXXXXXXASRS
2ccgA           ----FITFEGPEGSGKTTVINEVYHRL-VKDYDVIMTREPGG-VPEIRKIVLENDMDIRTEAMLFAASRR
2cckA           ----FITFEGPEGSGKTTVINEVYHRL-VKDYDVIMTREPGG-VPEIRKIVL-EDMDIRTEAMLFAASRR
2ccjB           ----FITFEGPEGSGKTTVINEVYHRL-VKDYDVIMTREPGG-VPEIRKIVLENDMDIRTEAMLFAASRR
2cckB           ----FITFEGPEGSGKTTVINEVYHRL-VKDYDVIMTREPGG-VPEIRKIVLEGDMDIRTEAMLFAASRR
2ccgB           ----FITFEGPEGSGKTTVINEVYHRL-VKDYDVIMTREPGG-VPEIRKIVLENDMDIRTEAMLFAASRR
2z0hB           ----FITFEGIDGSGKSTQIQLLAQYLE---KKVILKREPGGTETKIRKILLEEEVTPKAELFLFLASR-
2ccjA           ----FITFEGPEGSGKTTVINEVYHRL-VKDYDVIMTREPGG-VPEIRKIVLENDMDIRTEAMLFAASRR
4tmkA           ----YIVIEGLEGAGKTTARNVVVETLEQLGRDMVFTREPGGTAEKLRSLLLDEVITDKAEVLMFYAARV
2plrB           --GVLIAFEGIDGSGKSSQATLLKDWIELK-RDVYLT-ESDWIHDIIKEAKKKDLLTPLTFSLIHATDFS
2plrA           --GVLIAFEGIDGSGKSSQATLLKDWIELK-RDVYLTEWNSSDWIHIKEAKKKDLLTPLTFSLIHATDFS
1e9fA           --GALIVLEGVDGAGKSTQSRKLVEALCAAGHRAELLRFPERS-TEIGKLLSSSDVEDHSVHLLFSANRW
1e9dA           --GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERS-TEIGKLLSSSDVEDHSVHLLFSANRW
1e9cA           --GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERS-TEIGKLLSSSDVEDHSVHLLFSANRW
1nn5A           --GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERS-TEIGKLLSSSDVEDHSVHLLFSANRW
1e2gA           --GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERS-TEIGKLLSSSDVEDHSVHLLFSANRW
1e98A           --GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERS-TEIGKLLSSSDVEDHSVHLLFSANRW
1e2fA           --GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERS-TEIGKLLSSSDVEDHSVHLLFSANRW
1e2dA           --GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERS-TEIGKLLSSSDVEDHSVHLLFSANRW
3tmkC           --GKLILIEGLDRTGKTTQCNILYKKLQPNCKPERSTRI--GGLINEYLTDDSFQLSDQAIHLLFSANRW
3tmkE           --GKLILIEGLDRTGKTTQCNILYKKLQPNCKPERSTRI--GGLINEYLTDDSFQLSDQAIHLLFSANRW
3tmkD           --GKLILIEGLDRTGKTTQCNILYKKLQPNCKPERSTRI--GGLINEYLTDDSFQLSDQAIHLLFSANRW
3tmkA           --GKLILIEGLDRTGKTTQCNILYKKLQPNCKPERSTRI--GGLINEYLTDDSFQLSDQAIHLLFSANRW
1tmkA           --GKLILIEGLDRTGKTTQCNILYKKLQPNCKPERSTRI--GGLINEYLTDDSFQLSDQAIHLLFSANRW
1w2hB           ---MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYG-QSVAADIAAEALHGEAMATLFALDRA
1n5kA           ---MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYG-QSVAADIAAEALHGEAMATLFALDRA
1g3uA           ---MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYG-QSVAADIAAEALHGEAMATLFALDRA
1n5kB           ---MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYG-QSVAADIAAEALHGEAMATLFALDRA
1n5lA           ---MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYG-QSVAADIAAEALHGEAMATLFALDRA
1w2hA           ---MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYG-QSVAADIAAEALHGEAMATLFALDRA
1n5lB           ---MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYG-QSVAADIAAEALHGEAMATLFALDRA
2v54B           --GALIVFEGLDKSGKTTQCMNIMESIPANTIKYLNFPQRSTVTGKMIDDYLTRKYNDHIVNLLFCANRW
2v54A           --GALIVFEGLDKSGKTTQCMNIMESIPANTIKYLNFPQRSTVTGKMIDDYLTRKYNDHIVNLLFCANRW
2yvuB           --GIVVWLTGLPGSGKTTIATRLADLLQKEG---------------------------------------
2yvuA           --GIVVWLTGLPGSGKTTIATRLADLLQKEG---------------------------------------
1rj9B           -------LVGLQGSGKTTTAAKLALYYKGKGRRPLL----------------------------------
1okkA           -------LVGLQGSGKTTTAAKLALYYKGKGRRPLL----------------------------------
2ng1A           -------LVGLQGSGKTTTAAKLALYYKGKGRRPLL----------------------------------
1ls1A           -------LVGLQGSGKTTTAAKLALYYKGKGRRPLL----------------------------------
1jpnA           -------LVGLQGSGKTTTAAKLALYYKGKGRRPLL----------------------------------
1jpnB           -------LVGLQGSGKTTTAAKLALYYKGKGRRPLL----------------------------------
1jpjA           -------LVGLQGSGKTTTAAKLALYYKGKGRRPLL----------------------------------
2j7pB           -------LVGLQGSGKTTTAAKLALYYKGKGRRPLL----------------------------------
2j7pA           -------LVGLQGSGKTTTAAKLALYYKGKGRRPLL----------------------------------
2ffhA           -------LVGLQGSGKTTTAAKLALYYKGKGRRPLL----------------------------------
1ffhA           -------LVGLQGSGKTTTAAKLALYYKGKGRRPLL----------------------------------
2c04A           -------LVGLQGSGKTTTAAKLALYYKGKGRRPLL----------------------------------
2c03B           -------LVGLQGSGKTTTAAKLALYYKGKGRRPLL----------------------------------
2c03A           -------LVGLQGSGKTTTAAKLALYYKGKGRRPLL----------------------------------


                         .         .         *         .         .         .         .:140
query           EHVRKVILPGLAAGKVVISDRYLDSSLAYQGYGRGLPLPWLREVAREATRGLKPRLTFLLDLPPEAALRR
3hjnB           LLVTE-IKQYLSEGYAVLLDRYTDSSVAYQGFGRNLGKEIVEELNDFATDGLIPDLTFYIDVDVETALKR
3hjnA           LLVTE-IKQYLSEGYAVLLDRYTDSSVAYQGFGRNLGKEIVEELNDFATDGLIPDLTFYIDVDVETALKR
2z0hA           ----NLLVTEIKQYYAVLLDRYTDSSVAYQGFGRNLGKEIVEELNDFATDGLIPDLTFYIDVDVETALKR
2pbrA           KLIEEKIIPDLKRDKVVILDRFVLSTIAYQGYGKGLDVEFIKNLNEFATRGVKPDITLLLDIPVDIALRR
2ccgA           EHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRER
2cckA           EHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRER
2ccjB           EHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRER
2cckB           EHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRER
2ccgB           EHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRER
2z0hB           ----NLLVTEIKQYYAVLLDRYTDSSVAYQGFGRNLGKEIVEELNDFATDGLIPDLTFYIDVDVETA---
2ccjA           EHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRER
4tmkA           QLVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGDFRPDLTLYLDVTPEVGLKR
2plrB           DRYERYILP-LKSGFIVISDRYIYTAYARDSV-RGVDIDWVKKLYSFA---IKPDITFYIRVSPDIALER
2plrA           DRYERYILP-LKSGFIVISDRYIYTAYARDSV-RGVDIDWVKKLYSFA---IKPDITFYIRVSPDIALER
1e9fA           EQV-PLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDW----CKQPDVGLKPDLVLFLQLQLADAAKR
1e9dA           EQV-PLIKEKLSQGVTLVVDRYAFSGVAYTGAKENFSLDW----CKQPDVGLKPDLVLFLQLQLADAAKR
1e9cA           EQV-PLIKEKLSQGVTLVVDRYAFSGVAYTGAKENFSLDW----CKQPDVGLKPDLVLFLQLQLADAAKR
1nn5A           EQV-PLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDW----CKQPDVGLKPDLVLFLQLQLADAAKR
1e2gA           EQV-PLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDW----CKQPDVGLKPDLVLFLQLQLADAAKR
1e98A           EQV-PLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDW----CKQPDVGLKPDLVLFLQLQLADAAKR
1e2fA           EQV-PLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDW----CKQPDVGLKPDLVLFLQLQLADAAKR
1e2dA           EQV-PLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDW----CKQPDVGLKPDLVLFLQLQLADAAKR
3tmkC           EIVDK-IKKDLLEGKNIVMDRYVYSGVAYSAATNGMDLDW---CLQPDVGLLKPDLTLFLSTQDDERYET
3tmkE           EIVDK-IKKDLLEGKNIVMDRYVYSGVAYSAATNGMDLDW---CLQPDVGLLKPDLTLFL----------
3tmkD           EIVDK-IKKDLLEGKNIVMDRYVYSGVAYSAATNGMDLDW---CLQPDVGLLKPDLTLFL----------
3tmkA           EIVDK-IKKDLLEGKNIVMDRYVYSGVAYSAATNGMDLDW---CLQPDVGLLKPDLTLFL----------
1tmkA           EIVDK-IKKDLLEGKNIVMDRYVYSGVAYSAATNGMDLDW---CLQPDVGLLKPDLTLFL----------
1w2hB           GAVHTI--QGLCRGDVVILDRYVASNAAYSANAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGER
1n5kA           GAVHTI--QGLCRGDVVILDRYVASNAAYSANAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGER
1g3uA           GAVHTI--QGLCRGDVVILDRYVASNAAYSANAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGER
1n5kB           GAVHTI--QGLCRGDVVILDRYVASNAAYSANAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGER
1n5lA           GAVHTI--QGLCRGDVVILDRYVASNAAYSANAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGER
1w2hA           GAVHTI--QGLCRGDVVILDRYVASNAAYSANAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGER
1n5lB           GAVHTI--QGLCRGDVVILDRYVASNAAY-----------------------------------------
2v54B           EFA-SFIQEQLEQGITLIVDRYAFSGVAYKSYESGLPKP-------------------------------
2v54A           EFA-SFIQEQLEQGITLIVDRYAFSGVAYKSYESGLPKP-------------------------------
2yvuB           ----------------------------------------------------------------------
2yvuA           ----------------------------------------------------------------------
1rj9B           ----------------------------------------------------------------------
1okkA           ----------------------------------------------------------------------
2ng1A           ----------------------------------------------------------------------
1ls1A           ----------------------------------------------------------------------
1jpnA           ----------------------------------------------------------------------
1jpnB           ----------------------------------------------------------------------
1jpjA           ----------------------------------------------------------------------
2j7pB           ----------------------------------------------------------------------
2j7pA           ----------------------------------------------------------------------
2ffhA           ----------------------------------------------------------------------
1ffhA           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VRRPDRLEGLGLEFFRRVREGYLALARAEPGRFVVLDATLPEEEIARAIQAHLRPLLx
3hjnB           NRFEKR------EFLERVREGYLVLAREHPERIVVLDGKRSIEEIHRDV---------
3hjnA           KNRFEK-----REFLERVREGYLVLAREHPERIVVLDGKRSIEEIHRDV---------
2z0hA           KNRFEK-----REFLERVREGYLVLAREHPERIVVLDGKRSIEEIHRDV---------
2pbrA           LKEKNRFE--NKEFLEKVRKGFLELAKEEE-NVVVIDASGEEEEVFKEILRALSGVL-
2ccgA           IRDQNRLDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENV-------------
2cckA           IIKNSRLDQEDLKFHEKVIEGYQEII-----RFKSVNADQPLENV-------------
2ccjB           IIKNNRLDQEDLKFHEKVIEGYQEIIQ----RFKSVNADQPLENV-------------
2cckB           IIK-NRLDQEDLKFHEKVIEGYQEII-----RFKSVNADQPLENV-------------
2ccgB           IIK-NSLDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENV-------------
2z0hB           ----XXXXXXXXXXXXXXXXGYLVLAREHPERIVVLDGKRSIEEIHRDV---------
2ccjA           IKNSNRLDQEDLKFHEKVIEGYQEIIH----RFKSVNADQPLENV-------------
4tmkA           ARELDRIEQESFDFFNRTRARYLELA-AQDKSIHTIDATQPLEAVMDAIR--------
2plrB           IKKSKRFPGLSLKYQGLITEVYDKLVKDE--NFIVIDGTKTPKEIQIQIRKFVGELI-
2plrA           IKKSKRFPGLSLKYQGLITEVYDKLVKDE--NFIVIDGTKTPKEIQIQIRKFVGELI-
1e9fA           ----------------------------------------------------------
1e9dA           ----------------------------------------------------------
1e9cA           ----------------------------------------------------------
1nn5A           ER--------------------------------------------------------
1e2gA           GER-------------------------------------------------------
1e98A           ----------------------------------------------------------
1e2fA           ----------------------------------------------------------
1e2dA           ----------------------------------------------------------
3tmkC           VKFQEKVKQTFMKLLKEIRKG-------------------------------------
3tmkE           ----------------------------------------------------------
3tmkD           ----------------------------------------------------------
3tmkA           ----------------------------------------------------------
1tmkA           ----------------------------------------------------------
1w2hB           SRGARDNYERDAELQQRTGAVYAELAQGWGGRWLVVGADVDPGRLAATL---------
1n5kA           RDNYER----DAELQQRTGAVYAELAQGWGGRWLVVGADVDPGRLAATL---------
1g3uA           SRRAQRDPGRARDNYERDAE--------------------------------------
1n5kB           SR--------------------------------------------------------
1n5lA           ----DNYE-RDAELQQRTGAVYAELAQGWGGRWLVVGADVDPGRLAATL---------
1w2hA           ----------------------------------------------------------
1n5lB           ----------------------------------------------------------
2v54B           ----------------------------------------------------------
2v54A           ----------------------------------------------------------
2yvuB           ----------------------------------------------------------
2yvuA           ----------------------------------------------------------
1rj9B           ----------------------------------------------------------
1okkA           ----------------------------------------------------------
2ng1A           ----------------------------------------------------------
1ls1A           ----------------------------------------------------------
1jpnA           ----------------------------------------------------------
1jpnB           ----------------------------------------------------------
1jpjA           ----------------------------------------------------------
2j7pB           ----------------------------------------------------------
2j7pA           ----------------------------------------------------------
2ffhA           ----------------------------------------------------------
1ffhA           ----------------------------------------------------------
2c04A           ----------------------------------------------------------
2c03B           ----------------------------------------------------------
2c03A           ----------------------------------------------------------