[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tthe0:AAS81657.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2j00N.bssp"
#ERROR : Can't open dsspfile "1vs5N.bssp"
#ERROR : Can't open dsspfile "3i1oN.bssp"
#ERROR : Can't open dsspfile "2gy9N.bssp"
#ERROR : Can't open dsspfile "3e1aG.bssp"
#ERROR : Can't open dsspfile "3bbnN.bssp"

## Summary of PDB Search
:61
    2e-32 100%  2j00N  [g.39.1 (1fjgN)] 30S RIBOSOMAL PROTEIN S14
    7e-08  49%  1vs5N  [x.x.x] 30S RIBOSOMAL PROTEIN S14
    7e-08  49%  3i1oN  [x.x.x] 30S RIBOSOMAL PROTEIN S14
    7e-08  49%  2gy9N  [x.x.x] 30S RIBOSOMAL SUBUNIT PROTEIN S14
    7e-08  49%  3e1aG  [x.x.x] 30S RIBOSOMAL PROTEIN S14
    9e-06  44%  3bbnN  [x.x.x] RIBOSOMAL PROTEIN S14
:61

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW
2j00N           -ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW
1vs5N           ------------------RQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
3i1oN           ------------------RQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
2gy9N           ------------------RQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
3e1aG           ------------------RQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
3bbnN           ------------------RLHRRCFLTGRPRANIRDFGLSGHILREMVHTCLLPGATRSSW