[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tthe0:AAS81760.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2o5aB.bssp"
#ERROR : Can't open dsspfile "2o5aA.bssp"

## Summary of PDB Search
:113
    4e-10  32%  2o5aB  [x.x.x] BH1328 PROTEIN
    4e-10  32%  2o5aA  [x.x.x] BH1328 PROTEIN
:113

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxLIERIKELLAEKKAENVVALDLRRVSETLDYFVVASATSTPHLQAXXXXXXXXXXXXXXRP
2o5aB           ---------LLQLAVNAVDDKKAEQVVALNK---GISLDFFLICHGNSEKQVQAIAHELKKVAQEQGIEI
2o5aA           ---------LLQLAVNAVDDKKAEQVVALNK---GISLDFFLICHGNSEKQVQAIAHELKKVAQEQGIEI


                         .         .         *         .         .         .         .:140
query           RPTAGQSPRWVVLDYGEVVVHLMTPEAREYYDLEGFWADAExx
2o5aB           KRLEGEQARWVLIDLGDVVVHVFHKDERAYYNLEKLWPTVE--
2o5aA           KRLEGEQARWVLIDLGDVVVHVFHKDERAYYNLEKLWPTVE--