[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tthe0:AAS81794.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2eisA.bssp"
#ERROR : Can't open dsspfile "3d6lA.bssp"
#ERROR : Can't open dsspfile "2gvhC.bssp"
#ERROR : Can't open dsspfile "2gvhB.bssp"
#ERROR : Can't open dsspfile "2gvhA.bssp"
#ERROR : Can't open dsspfile "2q2bB.bssp"
#ERROR : Can't open dsspfile "2q2bA.bssp"
#ERROR : Can't open dsspfile "2qq2C.bssp"
#ERROR : Can't open dsspfile "1vpmC.bssp"
#ERROR : Can't open dsspfile "1vpmB.bssp"
#ERROR : Can't open dsspfile "1vpmA.bssp"
#ERROR : Can't open dsspfile "1y7uA.bssp"
#ERROR : Can't open dsspfile "2qq2L.bssp"
#ERROR : Can't open dsspfile "2qq2I.bssp"
#ERROR : Can't open dsspfile "2qq2D.bssp"
#ERROR : Can't open dsspfile "2qq2B.bssp"
#ERROR : Can't open dsspfile "2qq2E.bssp"
#ERROR : Can't open dsspfile "2qq2J.bssp"
#ERROR : Can't open dsspfile "2qq2H.bssp"
#ERROR : Can't open dsspfile "2qq2F.bssp"
#ERROR : Can't open dsspfile "2qq2A.bssp"
#ERROR : Can't open dsspfile "2qq2G.bssp"
#ERROR : Can't open dsspfile "3bjkF.bssp"
#ERROR : Can't open dsspfile "1yliB.bssp"
#ERROR : Can't open dsspfile "1yliA.bssp"
#ERROR : Can't open dsspfile "1nngA.bssp"
#ERROR : Can't open dsspfile "3bjkD.bssp"
#ERROR : Can't open dsspfile "3bjkC.bssp"
#ERROR : Can't open dsspfile "3bjkB.bssp"
#ERROR : Can't open dsspfile "3bjkA.bssp"
#ERROR : Can't open dsspfile "3b7kA.bssp"
#ERROR : Can't open dsspfile "3b7kC.bssp"
#ERROR : Can't open dsspfile "3b7kB.bssp"

## Summary of PDB Search
:125
    2e-14  43%  2eisA  [x.x.x] HYPOTHETICAL PROTEIN TTHB207
    2e-13  32%  3d6lA  [x.x.x] PUTATIVE HYDROLASE
    2e-11  37%  2gvhC  [x.x.x] AGR_L_2016P
    2e-11  37%  2gvhB  [x.x.x] AGR_L_2016P
    2e-11  37%  2gvhA  [x.x.x] AGR_L_2016P
    1e-09  33%  2q2bB  [x.x.x] CYTOSOLIC ACYL COENZYME A THIOESTER HYDROLASE
    1e-09  33%  2q2bA  [x.x.x] CYTOSOLIC ACYL COENZYME A THIOESTER HYDROLASE
    2e-09  30%  2qq2C  [x.x.x] CYTOSOLIC ACYL COENZYME A THIOESTER HYDROLASE
    8e-09  37%  1vpmC  [d.38.1] ACYL-COA HYDROLASE
    8e-09  37%  1vpmB  [d.38.1] ACYL-COA HYDROLASE
    8e-09  37%  1vpmA  [d.38.1] ACYL-COA HYDROLASE
    2e-08  38%  1y7uA  [x.x.x] ACYL-COA HYDROLASE
    3e-08  31%  2qq2L  [x.x.x] CYTOSOLIC ACYL COENZYME A THIOESTER HYDROLASE
    3e-08  30%  2qq2I  [x.x.x] CYTOSOLIC ACYL COENZYME A THIOESTER HYDROLASE
    3e-08  30%  2qq2D  [x.x.x] CYTOSOLIC ACYL COENZYME A THIOESTER HYDROLASE
    3e-08  30%  2qq2B  [x.x.x] CYTOSOLIC ACYL COENZYME A THIOESTER HYDROLASE
    4e-08  31%  2qq2E  [x.x.x] CYTOSOLIC ACYL COENZYME A THIOESTER HYDROLASE
    5e-08  32%  2qq2J  [x.x.x] CYTOSOLIC ACYL COENZYME A THIOESTER HYDROLASE
    5e-08  31%  2qq2H  [x.x.x] CYTOSOLIC ACYL COENZYME A THIOESTER HYDROLASE
    5e-08  31%  2qq2F  [x.x.x] CYTOSOLIC ACYL COENZYME A THIOESTER HYDROLASE
    5e-08  30%  2qq2A  [x.x.x] CYTOSOLIC ACYL COENZYME A THIOESTER HYDROLASE
    7e-08  31%  2qq2G  [x.x.x] CYTOSOLIC ACYL COENZYME A THIOESTER HYDROLASE
    1e-07  34%  3bjkF  [x.x.x] ACYL-COA THIOESTER HYDROLASE HI0827
    1e-07  35%  1yliB  [d.38.1 (1nngB)] PUTATIVE ACYL-COA THIOESTER HYDROLASE HI0827
    1e-07  35%  1yliA  [x.x.x] PUTATIVE ACYL-COA THIOESTER HYDROLASE HI0827
    1e-07  35%  1nngA  [d.38.1] PUTATIVE ACYL-COA THIOESTER HYDROLASE HI0827
    1e-06  34%  3bjkD  [x.x.x] ACYL-COA THIOESTER HYDROLASE HI0827
    1e-06  34%  3bjkC  [x.x.x] ACYL-COA THIOESTER HYDROLASE HI0827
    1e-06  34%  3bjkB  [x.x.x] ACYL-COA THIOESTER HYDROLASE HI0827
    1e-06  34%  3bjkA  [x.x.x] ACYL-COA THIOESTER HYDROLASE HI0827
    9e-05  28%  3b7kA  [x.x.x] ACYL-COENZYME A THIOESTERASE 12
    1e-04  23%  3b7kC  [x.x.x] ACYL-COENZYME A THIOESTERASE 12
    1e-04  23%  3b7kB  [x.x.x] ACYL-COENZYME A THIOESTERASE 12
:125

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRTGDLLEVVAR
2eisA           --------VFPGETN-HYGTLFGGTVLAWDQAAFVAATRHARKKVVTVHADAVDFKRPVPLGAIVELVAR
3d6lA           -------VAMPSDTNPAGNIFGGWILSQIDLAGAIAARELSPERVVTISMDKVVFKEPVFIGDIISCYSK
2gvhC           ---RLIDIVFPGDTN-HHGTLFGGTGLALDRVAFIAATRFGRTPFVTASCERIDFRQPARIGHIVEFTAR
2gvhB           ---RLIDIVFPGDTN-HHGTLFGGTGLALDRVAFIAATRFGRTPFVTASCERIDFRQPARIGHIVEFTAR
2gvhA           ---RLIDIVFPGDTN-HHGTLFGGTGLALDRVAFIAATRFGRTPFVTASCERIDFRQPARIGHIVEFTAR
2q2bB           ----------------------------MDEVAGIVAARHCKTNIVTASVDAINFHDKIRKGCVITISGR
2q2bA           ----------------------------MDEVAGIVAARHCKTNIVTASVDAINFHDKIRKGCVITISGR
2qq2C           ----------------------------MDEVAGIVAARHCKTNIVTASVDAINFHDKIRKGCVITISGR
1vpmC           --SRTIQLVLPPDTNHLGTIFGGKVLAYIDEIAALTA-KHANSAVVTASIDSVDFKSSATVGDALELEGF
1vpmB           --SRTIQLVLPPDTNHLGTIFGGKVLAYIDEIAALTA-KHANSAVVTASIDSVDFKSSATVGDALELEGF
1vpmA           --SRTIQLVLPPDTNHLGTIFGGKVLAYIDEIAALTA-KHANSAVVTASIDSVDFKSSATVGDALELEGF
1y7uA           -----------------------------EDVASISASRHSRKECVT-ASDWVDFLHPVRSSDCVSYESF
2qq2L           ----------------------------MDEVAGIVAARHCKTNIVTASVDAINFHDKIRKGCVITISGR
2qq2I           ----------------------------MDEVAGIVAARHCKTNIVTASVDAINFHDKIRKGCVITISGR
2qq2D           ----------------------------MDEVAGIVAARHCKTNIVTASVDAINFHDKIRKGCVITISGR
2qq2B           ----------------------------MDEVAGIVAARHCKTNIVTASVDAINFHDKIRKGCVITISGR
2qq2E           ----------------------------MDEVAGIVAARHCKTNIVTASVDAINFHDKIRKGCVITISGR
2qq2J           ----------------------------MDEVAGIVAARHCKTNIVTASVDAINFHDKIRKGCVITISGR
2qq2H           ----------------------------MDEVAGIVAARHCKTNIVTASVDAINFHDKIRKGCVITISGR
2qq2F           ----------------------------MDEVAGIVAARHCKTNIVTASVDAINFHDKIRKGCVITISGR
2qq2A           ----------------------------MDEVAGIVAARHCKTNIVTASVDAINFHDKIRKGCVITISGR
2qq2G           ----------------------------MDEVAGIVAARHCKTNIVTASVDAINFHDKIRKGCVITISGR
3bjkF           -------LAMPSDTNANGDIFGGWIMSQMAMGGAILAKEIAHGRVVTVAVESMNFIKPISVGDVVCCYGQ
1yliB           -------LAMPSDTNANGDIFGGWIMSQMDMGGAILAKEIAHGRVVTVAVESMNFIKPISVGDVVCCYGQ
1yliA           -------LAMPSDTNANGDIFGGWIMSQMDMGGAILAKEIAHGRVVTVAVESMNFIKPISVGDVVCCYGQ
1nngA           -------LAMPSDTNANGDIFGGWIMSQMDMGGAILAKEIAHGRVVTVAVESMNFIKPISVGDVVCCYGQ
3bjkD           -------LAMPSDTNANGDIFGGWIMSQMAMGGAILAKEIAHGRVVTVAVESMNFIKPISVGDVVCCYGQ
3bjkC           -------LAMPSDTNANGDIFGGWIMSQMAMGGAILAKEIAHGRVVTVAVESMNFIKPISVGDVVCCYGQ
3bjkB           -------LAMPSDTNANGDIFGGWIMSQMAMGGAILAKEIAHGRVVTVAVESMNFIKPISVGDVVCCYGQ
3bjkA           -------LAMPSDTNANGDIFGGWIMSQMAMGGAILAKEIAHGRVVTVAVESMNFIKPISVGDVVCCYGQ
3b7kA           ---QSIELVLPPHANHHGNTFGGQIMAWMETVATISASRLCWAHPFLKSVDMFKFRGPSTVGDRLVFTAI
3b7kC           ------QAIQPAHATARGELSAGQLLKWIDTTACLAAEKHAGVSCVTASVDDIQFEETARVGQVITIKAK
3b7kB           ------QAIQPAHATARGELSAGQLLKWIDTTACLAAEKHAGVSCVTASVDDIQFEETARVGQVITIKAK


                         .         .         *         .         .         .         .:140
query           VVRVGRTSLTVEVEVYKERFGEGNGRVLATQGVLTYVAVNEKGEPVPVxxxxxxx
2eisA           LKEVGRTS-RVEVE-WVEPVKEGEEAYLAARGGFVLVAVDERGRPSPV-------
3d6lA           VVNVGNTSISVEVEVTAQRVDSQTSCINVTSALVTYVSVTRDGKKNPI-------
2gvhC           PVKAGRRSLTVEVEVAETII--GRQQHTCTRGIF-HVAIPE--------------
2gvhB           PVKAGRRSLTVEVEVAETII--GRQQHTCTRGIF-HVAIPE--------------
2gvhA           PVKAGRRSLTVEVEVAETII--GRQQHTCTRGIF-HVAIPE--------------
2q2bB           MTFTSNKSM--EIEVLVDADPVVDKRYRAASAFFTYVSLNQEGKPMPV-------
2q2bA           MTFTSNKSM--EIEVLVDADPVVDKRYRAASAFFTYVSLNQEGKPMPV-------
2qq2C           MTFTSNKSMEIEVLVDADPVVDSQKRYRAASAFFTYVSLSQEGRSLPV-------
1vpmC           VTHTGRTS-EVYVRVHSNNLLTGE-RTLTTESFLT-VAVDESG------------
1vpmB           VTHTGRTS-EVYVRVHSNNLLTGE-RTLTTESFLT-VAVDESG------------
1vpmA           VTHTGRTS-EVYVRVHSNNLLTGE-RTLTTESFLT-VAVDESG------------
1y7uA           VIWTGRTS-EVFVKVVSEYLISGEKRIAATSFV-TFVALSKENNPVPV-------
2qq2L           MTFTSNKSMEIEVLVDAD---PSQKRYRAASAFFTYVSLSQEGRSLPV-------
2qq2I           MTFTSNKSMEIEVLVDADPVVDSSKRYRAASAFFTYVSLSQEGRSLPV-------
2qq2D           MTFTSNKSMEIEVLVDADPVVDSSKRYRAASAFFTYVSLSQEGRSLPV-------
2qq2B           MTFTSNKSMEIEVLVDADPVVDSSKRYRAASAFFTYVSLSQEGRSLPV-------
2qq2E           MTFTSNKSMEIEVLVDADPVQK---RYRAASAFFTYVSLSQEGRSLPV-------
2qq2J           MTFTSNKSMEIEVLVDADPV-----RYRAASAFFTYVSLSQEGRSLPV-------
2qq2H           MTFTSNKSM--EIEVLVDADPVVDKRYRAASAFFTYVSLSQEGRSLPV-------
2qq2F           MTFTSNKSMEIEVLVDADPVVQ--KRYRAASAFFTYVSLSQEGRSLPV-------
2qq2A           MTFTSNKSMEIEVLVDADPV-VSQKRYRAASAFFTYVSLSQEGRSLPV-------
2qq2G           MTFTSNKSMEIEVLVDADPV----KRYRAASAFFTYVSLSQEGRSLPV-------
3bjkF           CLKVGRSSXXXXXXXXSEPIGE---RYCVTDAVFTFVAVDNNGRTIP--------
1yliB           CLKVGRSSXXXXXXXXSEPIGE---RYCVTDAVFTFVAVDNNG------------
1yliA           CLKVGRSSXXXXXXXXSEPIGE---RYCVTDAVFTFVAVDNNG------------
1nngA           CLKVGRSSXXXXXXXXSEPIGE---RYCVTDAVFTFVAVDNNG------------
3bjkD           CLKVGRSSXXXXXXXXSEPIGE---RYCVTDAVFTFVAVDNNG------------
3bjkC           CLKVGRSSXXXXXXXXSEPIGE---RYCVTDAVFTFVAVDNNG------------
3bjkB           CLKVGRSSXXXXXXXXSEPIGE---RYCVTDAVFTFVAVDNNG------------
3bjkA           CLKVGRSSXXXXXXXXSEPIGE---RYCVTDAVFTFVAVDNNG------------
3b7kA           VNNTFQTCVEVGVRVEAQEWAEGRGRHI-NSAFLIYNAADDK-------------
3b7kC           VTRAFSTSMEISIKV----------------------------------------
3b7kB           VTRAFSTSMEISIKV----------------------------------------