[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tthe0:AAS81826.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3cgcA.bssp"
#ERROR : Can't open dsspfile "3cgbA.bssp"
#ERROR : Can't open dsspfile "2cduB.bssp"
#ERROR : Can't open dsspfile "2cduA.bssp"
#ERROR : Can't open dsspfile "2bc1A.bssp"
#ERROR : Can't open dsspfile "2bc0A.bssp"
#ERROR : Can't open dsspfile "1nhrA.bssp"
#ERROR : Can't open dsspfile "1nhpA.bssp"
#ERROR : Can't open dsspfile "1nhsA.bssp"
#ERROR : Can't open dsspfile "1nhqA.bssp"
#ERROR : Can't open dsspfile "1yqzA.bssp"
#ERROR : Can't open dsspfile "3iwaA.bssp"
#ERROR : Can't open dsspfile "1joaA.bssp"
#ERROR : Can't open dsspfile "1f8wA.bssp"
#ERROR : Can't open dsspfile "3ef6A.bssp"
#ERROR : Can't open dsspfile "1q1wB.bssp"
#ERROR : Can't open dsspfile "1q1wA.bssp"
#ERROR : Can't open dsspfile "1q1rA.bssp"
#ERROR : Can't open dsspfile "2rabB.bssp"
#ERROR : Can't open dsspfile "2rabA.bssp"
#ERROR : Can't open dsspfile "2r9zB.bssp"
#ERROR : Can't open dsspfile "2r9zA.bssp"
#ERROR : Can't open dsspfile "1zx9A.bssp"
#ERROR : Can't open dsspfile "1zk7A.bssp"
#ERROR : Can't open dsspfile "2v3aA.bssp"
#ERROR : Can't open dsspfile "1lvlA.bssp"
#ERROR : Can't open dsspfile "1gesB.bssp"
#ERROR : Can't open dsspfile "1gesA.bssp"
#ERROR : Can't open dsspfile "1xdiA.bssp"
#ERROR : Can't open dsspfile "1gerB.bssp"
#ERROR : Can't open dsspfile "1gerA.bssp"
#ERROR : Can't open dsspfile "3fg2P.bssp"
#ERROR : Can't open dsspfile "2eq6A.bssp"
#ERROR : Can't open dsspfile "1xhcA.bssp"
#ERROR : Can't open dsspfile "1dxlA.bssp"
#ERROR : Can't open dsspfile "1lpfA.bssp"
#ERROR : Can't open dsspfile "2a8xA.bssp"
#ERROR : Can't open dsspfile "1ebdA.bssp"
#ERROR : Can't open dsspfile "3ladA.bssp"
#ERROR : Can't open dsspfile "2grtA.bssp"
#ERROR : Can't open dsspfile "1grtA.bssp"
#ERROR : Can't open dsspfile "1grgA.bssp"
#ERROR : Can't open dsspfile "1grbA.bssp"
#ERROR : Can't open dsspfile "1dncA.bssp"
#ERROR : Can't open dsspfile "3dk9A.bssp"
#ERROR : Can't open dsspfile "2ve2B.bssp"
#ERROR : Can't open dsspfile "2ve2A.bssp"
#ERROR : Can't open dsspfile "2yquA.bssp"
#ERROR : Can't open dsspfile "2eq7A.bssp"
#ERROR : Can't open dsspfile "1gsnA.bssp"
#ERROR : Can't open dsspfile "1tytB.bssp"
#ERROR : Can't open dsspfile "1tytA.bssp"
#ERROR : Can't open dsspfile "1typB.bssp"
#ERROR : Can't open dsspfile "1typA.bssp"
#ERROR : Can't open dsspfile "2tprA.bssp"
#ERROR : Can't open dsspfile "1gxfA.bssp"
#ERROR : Can't open dsspfile "1fecB.bssp"
#ERROR : Can't open dsspfile "1fecA.bssp"
#ERROR : Can't open dsspfile "1feaB.bssp"
#ERROR : Can't open dsspfile "1feaA.bssp"
#ERROR : Can't open dsspfile "1bzlA.bssp"
#ERROR : Can't open dsspfile "1aogB.bssp"
#ERROR : Can't open dsspfile "1aogA.bssp"
#ERROR : Can't open dsspfile "1zkqA.bssp"
#ERROR : Can't open dsspfile "1zdlA.bssp"
#ERROR : Can't open dsspfile "1mo9A.bssp"
#ERROR : Can't open dsspfile "1ndaA.bssp"
#ERROR : Can't open dsspfile "1zy8A.bssp"
#ERROR : Can't open dsspfile "1zmdE.bssp"
#ERROR : Can't open dsspfile "1zmcD.bssp"
#ERROR : Can't open dsspfile "1zmcB.bssp"
#ERROR : Can't open dsspfile "1zmcA.bssp"
#ERROR : Can't open dsspfile "2f5zI.bssp"
#ERROR : Can't open dsspfile "2v6oA.bssp"
#ERROR : Can't open dsspfile "1onfA.bssp"
#ERROR : Can't open dsspfile "3h4kA.bssp"
#ERROR : Can't open dsspfile "2w0hB.bssp"
#ERROR : Can't open dsspfile "2w0hA.bssp"
#ERROR : Can't open dsspfile "2jk6A.bssp"
#ERROR : Can't open dsspfile "1gv4A.bssp"
#ERROR : Can't open dsspfile "3gd4B.bssp"
#ERROR : Can't open dsspfile "3gd4A.bssp"
#ERROR : Can't open dsspfile "3gd3D.bssp"
#ERROR : Can't open dsspfile "3gd3C.bssp"
#ERROR : Can't open dsspfile "3gd3B.bssp"
#ERROR : Can't open dsspfile "3gd3A.bssp"
#ERROR : Can't open dsspfile "2zzcA.bssp"
#ERROR : Can't open dsspfile "2zzbC.bssp"
#ERROR : Can't open dsspfile "2zz0B.bssp"
#ERROR : Can't open dsspfile "2j3nF.bssp"
#ERROR : Can't open dsspfile "2j3nD.bssp"
#ERROR : Can't open dsspfile "2j3nC.bssp"
#ERROR : Can't open dsspfile "2j3nB.bssp"
#ERROR : Can't open dsspfile "2j3nA.bssp"
#ERROR : Can't open dsspfile "2cfyA.bssp"
#ERROR : Can't open dsspfile "2hqmA.bssp"
#ERROR : Can't open dsspfile "1m6iA.bssp"
#ERROR : Can't open dsspfile "1h6vE.bssp"
#ERROR : Can't open dsspfile "1h6vC.bssp"
#ERROR : Can't open dsspfile "1h6vB.bssp"
#ERROR : Can't open dsspfile "1h6vA.bssp"
#ERROR : Can't open dsspfile "3eanF.bssp"
#ERROR : Can't open dsspfile "3eanD.bssp"
#ERROR : Can't open dsspfile "3eanC.bssp"
#ERROR : Can't open dsspfile "3eanA.bssp"
#ERROR : Can't open dsspfile "2nvkX.bssp"
#ERROR : Can't open dsspfile "3dh9A.bssp"
#ERROR : Can't open dsspfile "3dghB.bssp"
#ERROR : Can't open dsspfile "3dghA.bssp"
#ERROR : Can't open dsspfile "2yvjA.bssp"
#ERROR : Can't open dsspfile "2qaeA.bssp"
#ERROR : Can't open dsspfile "2gr3A.bssp"
#ERROR : Can't open dsspfile "2gqwA.bssp"
#ERROR : Can't open dsspfile "1d7yA.bssp"
#ERROR : Can't open dsspfile "3f8rB.bssp"
#ERROR : Can't open dsspfile "3f8rA.bssp"
#ERROR : Can't open dsspfile "3f8pD.bssp"
#ERROR : Can't open dsspfile "3f8pC.bssp"
#ERROR : Can't open dsspfile "3f8pB.bssp"
#ERROR : Can't open dsspfile "3f8pA.bssp"
#ERROR : Can't open dsspfile "3f8dC.bssp"
#ERROR : Can't open dsspfile "3f8dB.bssp"
#ERROR : Can't open dsspfile "3f8dA.bssp"
#ERROR : Can't open dsspfile "3ctyB.bssp"
#ERROR : Can't open dsspfile "3ctyA.bssp"
#ERROR : Can't open dsspfile "1fl2A.bssp"
#ERROR : Can't open dsspfile "1ojtA.bssp"
#ERROR : Can't open dsspfile "1bhyA.bssp"
#ERROR : Can't open dsspfile "1hyuA.bssp"
#ERROR : Can't open dsspfile "3d8xA.bssp"
#ERROR : Can't open dsspfile "2vdcG.bssp"
#ERROR : Can't open dsspfile "3f8rD.bssp"
#ERROR : Can't open dsspfile "3f8dD.bssp"
#ERROR : Can't open dsspfile "2q0lA.bssp"
#ERROR : Can't open dsspfile "2q0kA.bssp"
#ERROR : Can't open dsspfile "2iidA.bssp"
#ERROR : Can't open dsspfile "1f8sA.bssp"
#ERROR : Can't open dsspfile "3ic9C.bssp"
#ERROR : Can't open dsspfile "3ic9A.bssp"
#ERROR : Can't open dsspfile "1ps9A.bssp"
#ERROR : Can't open dsspfile "1vdcA.bssp"
#ERROR : Can't open dsspfile "1reoA.bssp"
#ERROR : Can't open dsspfile "1sezA.bssp"
#ERROR : Can't open dsspfile "3fbsB.bssp"
#ERROR : Can't open dsspfile "3fbsA.bssp"

## Summary of PDB Search
:443
    1e-79  38%  3cgcA  [x.x.x] PYRIDINE NUCLEOTIDE-DISULFIDE OXIDOREDUCTASE,
    2e-66  39%  3cgbA  [x.x.x] PYRIDINE NUCLEOTIDE-DISULFIDE OXIDOREDUCTASE,
    3e-50  29%  2cduB  [x.x.x] NADPH OXIDASE
    3e-50  29%  2cduA  [x.x.x] NADPH OXIDASE
    7e-49  29%  2bc1A  [x.x.x] NADH OXIDASE
    1e-47  29%  2bc0A  [x.x.x] NADH OXIDASE
    2e-47  28%  1nhrA  [x.x.x] NADH PEROXIDASE
    3e-46  28%  1nhpA  [x.x.x] NADH PEROXIDASE
    4e-46  28%  1nhsA  [x.x.x] NADH PEROXIDASE
    4e-46  28%  1nhqA  [x.x.x] NADH PEROXIDASE
    3e-45  29%  1yqzA  [x.x.x] COENZYME A DISULFIDE REDUCTASE
    5e-45  35%  3iwaA  [x.x.x] FAD-DEPENDENT PYRIDINE NUCLEOTIDE-DISULPHIDE
    6e-45  28%  1joaA  [x.x.x] NADH PEROXIDASE
    1e-44  28%  1f8wA  [c.3.1 - c.3.1 - d.87.1] NADH PEROXIDASE
    3e-25  40%  3ef6A  [x.x.x] TOLUENE 1,2-DIOXYGENASE SYSTEM FERREDOXIN--
    1e-24  34%  1q1wB  [c.3.1 - c.3.1 - d.87.1] PUTIDAREDOXIN REDUCTASE
    1e-24  34%  1q1wA  [c.3.1 - c.3.1 - d.87.1] PUTIDAREDOXIN REDUCTASE
    1e-24  34%  1q1rA  [c.3.1 - c.3.1 - d.87.1] PUTIDAREDOXIN REDUCTASE
    8e-24  37%  2rabB  [x.x.x] GLUTATHIONE AMIDE REDUCTASE
    8e-24  37%  2rabA  [x.x.x] GLUTATHIONE AMIDE REDUCTASE
    1e-23  37%  2r9zB  [x.x.x] GLUTATHIONE AMIDE REDUCTASE
    1e-23  37%  2r9zA  [x.x.x] GLUTATHIONE AMIDE REDUCTASE
    5e-23  31%  1zx9A  [x.x.x] MERCURIC REDUCTASE
    5e-23  31%  1zk7A  [x.x.x] MERCURIC REDUCTASE
    5e-23  35%  2v3aA  [x.x.x] RUBREDOXIN REDUCTASE
    2e-21  38%  1lvlA  [x.x.x] DIHYDROLIPOAMIDE DEHYDROGENASE
    1e-20  38%  1gesB  [c.3.1 - c.3.1 - d.87.1] GLUTATHIONE REDUCTASE
    1e-20  38%  1gesA  [c.3.1 - c.3.1 - d.87.1] GLUTATHIONE REDUCTASE
    8e-19  32%  1xdiA  [c.3.1 - d.87.1] RV3303C-LPDA
    1e-18  37%  1gerB  [c.3.1 - c.3.1 - d.87.1] GLUTATHIONE REDUCTASE
    1e-18  37%  1gerA  [c.3.1 - c.3.1 - d.87.1] GLUTATHIONE REDUCTASE
    1e-18  30%  3fg2P  [x.x.x] PUTATIVE RUBREDOXIN REDUCTASE
    1e-18  33%  2eq6A  [x.x.x] PYRUVATE DEHYDROGENASE COMPLEX, DIHYDROLIPOAMIDE
    2e-18  29%  1xhcA  [c.3.1 - c.3.1 - d.87.1] NADH OXIDASE /NITRITE REDUCTASE
    1e-17  35%  1dxlA  [c.3.1 - c.3.1 - d.87.1] DIHYDROLIPOAMIDE DEHYDROGENASE
    1e-17  32%  1lpfA  [c.3.1 - c.3.1 - d.87.1] DIHYDROLIPOAMIDE DEHYDROGENASE
    3e-17  34%  2a8xA  [x.x.x] DIHYDROLIPOYL DEHYDROGENASE
    4e-17  30%  1ebdA  [c.3.1 - c.3.1 - d.87.1] DIHYDROLIPOAMIDE DEHYDROGENASE
    3e-16  32%  3ladA  [c.3.1 - c.3.1 - d.87.1] DIHYDROLIPOAMIDE DEHYDROGENASE
    3e-16  39%  2grtA  [x.x.x] GLUTATHIONE REDUCTASE
    3e-16  39%  1grtA  [x.x.x] GLUTATHIONE REDUCTASE
    3e-16  39%  1grgA  [x.x.x] GLUTATHIONE REDUCTASE
    3e-16  39%  1grbA  [c.3.1 - c.3.1 - d.87.1 (1bwcA)] GLUTATHIONE REDUCTASE
    3e-16  39%  1dncA  [x.x.x] GLUTATHIONE REDUCTASE
    3e-16  39%  3dk9A  [x.x.x] GLUTATHIONE REDUCTASE
    6e-16  34%  2ve2B  [x.x.x] TRYPANOTHIONE REDUCTASE
    6e-16  34%  2ve2A  [x.x.x] TRYPANOTHIONE REDUCTASE
    3e-15  31%  2yquA  [x.x.x] 2-OXOGLUTARATE DEHYDROGENASE E3 COMPONENT
    3e-15  31%  2eq7A  [x.x.x] 2-OXOGLUTARATE DEHYDROGENASE E3 COMPONENT
    3e-14  39%  1gsnA  [x.x.x] GLUTATHIONE REDUCTASE
    4e-13  38%  1tytB  [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE, OXIDIZED
    4e-13  38%  1tytA  [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE, OXIDIZED
    4e-13  38%  1typB  [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE
    4e-13  38%  1typA  [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE
    4e-13  38%  2tprA  [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE
    4e-13  33%  1gxfA  [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE (OXIDIZED
    4e-13  38%  1fecB  [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE
    4e-13  38%  1fecA  [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE
    4e-13  38%  1feaB  [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE
    4e-13  38%  1feaA  [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE
    4e-13  33%  1bzlA  [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE (OXIDIZED
    4e-13  33%  1aogB  [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE
    4e-13  33%  1aogA  [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE
    6e-13  31%  1zkqA  [x.x.x] THIOREDOXIN REDUCTASE 2, MITOCHONDRIAL
    6e-13  31%  1zdlA  [x.x.x] THIOREDOXIN REDUCTASE 2, MITOCHONDRIAL
    2e-12  28%  1mo9A  [c.3.1 - c.3.1 - d.87.1] ORF3
    2e-12  32%  1ndaA  [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE OXIDOREDUCTASE
    7e-12  32%  1zy8A  [x.x.x] DIHYDROLIPOYL DEHYDROGENASE, MITOCHONDRIAL
    7e-12  32%  1zmdE  [x.x.x] DIHYDROLIPOYL DEHYDROGENASE
    7e-12  32%  1zmcD  [x.x.x] DIHYDROLIPOYL DEHYDROGENASE
    7e-12  32%  1zmcB  [x.x.x] DIHYDROLIPOYL DEHYDROGENASE
    7e-12  32%  1zmcA  [x.x.x] DIHYDROLIPOYL DEHYDROGENASE
    2e-11  33%  2f5zI  [x.x.x] DIHYDROLIPOYL DEHYDROGENASE
    4e-11  29%  2v6oA  [x.x.x] THIOREDOXIN GLUTATHIONE REDUCTASE
    4e-11  26%  1onfA  [c.3.1 - c.3.1 - d.87.1] GLUTATHIONE REDUCTASE
    4e-11  29%  3h4kA  [x.x.x] THIOREDOXIN GLUTATHIONE REDUCTASE
    2e-10  29%  2w0hB  [x.x.x] TRYPANOTHIONE REDUCTASE
    2e-10  29%  2w0hA  [x.x.x] TRYPANOTHIONE REDUCTASE
    2e-10  29%  2jk6A  [x.x.x] TRYPANOTHIONE REDUCTASE
    5e-10  28%  1gv4A  [c.3.1 - c.3.1 - d.87.1] PROGRAMED CELL DEATH PROTEIN 8
    5e-10  28%  3gd4B  [x.x.x] APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
    5e-10  28%  3gd4A  [x.x.x] APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
    5e-10  28%  3gd3D  [x.x.x] APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
    5e-10  28%  3gd3C  [x.x.x] APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
    5e-10  28%  3gd3B  [x.x.x] APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
    5e-10  28%  3gd3A  [x.x.x] APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
    7e-10  31%  2zzcA  [x.x.x] THIOREDOXIN REDUCTASE 1, CYTOPLASMIC
    7e-10  31%  2zzbC  [x.x.x] THIOREDOXIN REDUCTASE 1, CYTOPLASMIC
    7e-10  31%  2zz0B  [x.x.x] THIOREDOXIN REDUCTASE 1, CYTOPLASMIC
    7e-10  31%  2j3nF  [x.x.x] THIOREDOXIN REDUCTASE 1
    7e-10  31%  2j3nD  [x.x.x] THIOREDOXIN REDUCTASE 1
    7e-10  31%  2j3nC  [x.x.x] THIOREDOXIN REDUCTASE 1
    7e-10  31%  2j3nB  [x.x.x] THIOREDOXIN REDUCTASE 1
    7e-10  31%  2j3nA  [x.x.x] THIOREDOXIN REDUCTASE 1
    7e-10  31%  2cfyA  [x.x.x] THIOREDOXIN REDUCTASE 1
    9e-10  29%  2hqmA  [x.x.x] GLUTATHIONE REDUCTASE
    3e-09  28%  1m6iA  [c.3.1 - c.3.1 - d.87.1] PROGRAMMED CELL DEATH PROTEIN 8
    4e-09  31%  1h6vE  [c.3.1 - c.3.1 - d.87.1] THIOREDOXIN REDUCTASE
    4e-09  31%  1h6vC  [c.3.1 - c.3.1 - d.87.1] THIOREDOXIN REDUCTASE
    4e-09  31%  1h6vB  [c.3.1 - c.3.1 - d.87.1] THIOREDOXIN REDUCTASE
    4e-09  31%  1h6vA  [c.3.1 - c.3.1 - d.87.1] THIOREDOXIN REDUCTASE
    4e-09  31%  3eanF  [x.x.x] THIOREDOXIN REDUCTASE 1
    4e-09  31%  3eanD  [x.x.x] THIOREDOXIN REDUCTASE 1
    4e-09  31%  3eanC  [x.x.x] THIOREDOXIN REDUCTASE 1
    4e-09  31%  3eanA  [x.x.x] THIOREDOXIN REDUCTASE 1
    1e-08  31%  2nvkX  [x.x.x] THIOREDOXIN REDUCTASE
    1e-08  31%  3dh9A  [x.x.x] THIOREDOXIN REDUCTASE 1
    1e-08  31%  3dghB  [x.x.x] THIOREDOXIN REDUCTASE 1, MITOCHONDRIAL
    1e-08  31%  3dghA  [x.x.x] THIOREDOXIN REDUCTASE 1, MITOCHONDRIAL
    3e-08  35%  2yvjA  [x.x.x] FERREDOXIN REDUCTASE
    3e-08  29%  2qaeA  [x.x.x] DIHYDROLIPOYL DEHYDROGENASE
    3e-08  35%  2gr3A  [x.x.x] FERREDOXIN REDUCTASE
    3e-08  35%  2gqwA  [x.x.x] FERREDOXIN REDUCTASE
    3e-08  35%  1d7yA  [c.3.1 - c.3.1 - d.87.1] FERREDOXIN REDUCTASE
    2e-07  30%  3f8rB  [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)
    2e-07  30%  3f8rA  [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)
    2e-07  30%  3f8pD  [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)
    2e-07  30%  3f8pC  [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)
    2e-07  30%  3f8pB  [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)
    2e-07  30%  3f8pA  [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)
    2e-07  30%  3f8dC  [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)
    2e-07  30%  3f8dB  [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)
    2e-07  30%  3f8dA  [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)
    2e-07  45%  3ctyB  [x.x.x] THIOREDOXIN REDUCTASE
    2e-07  45%  3ctyA  [x.x.x] THIOREDOXIN REDUCTASE
    4e-07  30%  1fl2A  [c.3.1 - c.3.1] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT F
    2e-06  48%  1ojtA  [x.x.x] SURFACE PROTEIN
    2e-06  48%  1bhyA  [x.x.x] P64K
    4e-06  29%  1hyuA  [c.47.1 - c.47.1 - c.3.1 - c.3.1] ALKYL HYDROPEROXIDE
    4e-06  29%  3d8xA  [x.x.x] THIOREDOXIN REDUCTASE 1
    6e-06  34%  2vdcG  [x.x.x] GLUTAMATE SYNTHASE [NADPH] SMALL CHAIN
    8e-06  38%  3f8rD  [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)
    8e-06  38%  3f8dD  [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)
    2e-05  30%  2q0lA  [x.x.x] THIOREDOXIN REDUCTASE
    2e-05  30%  2q0kA  [x.x.x] THIOREDOXIN REDUCTASE
    3e-05  40%  2iidA  [c.3.1 - d.16.1 (1f8rA)] L-AMINO-ACID OXIDASE
    3e-05  40%  1f8sA  [c.3.1 - d.16.1] L-AMINO ACID OXIDASE
    5e-05  31%  3ic9C  [x.x.x] DIHYDROLIPOAMIDE DEHYDROGENASE
    5e-05  31%  3ic9A  [x.x.x] DIHYDROLIPOAMIDE DEHYDROGENASE
    8e-05  29%  1ps9A  [c.1.4 - c.4.1 - c.3.1] 2,4-DIENOYL-COA REDUCTASE
    3e-04  29%  1vdcA  [x.x.x] NADPH DEPENDENT THIOREDOXIN REDUCTASE
    4e-04  44%  1reoA  [c.3.1 - d.16.1] AHPLAAO
    7e-04  46%  1sezA  [c.3.1 - d.16.1] PROTOPORPHYRINOGEN OXIDASE, MITOCHONDRIAL
    7e-04  32%  3fbsB  [x.x.x] OXIDOREDUCTASE
    7e-04  32%  3fbsA  [x.x.x] OXIDOREDUCTASE
:443

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxRENPELEVVVYEKSGWVSYGACGLPYVLSGEIPRLERLVARTPEEFRK
3cgcA           ----------------------RNDENANVVTLEKGEIYSYAQCGLPYVISGAIASTEKLIARNVKTFRK
3cgbA           ----------------------RNDENANVVTLEKGEIYSYAQCGLPYVISGAIASTEKLIARNVKTFRK
2cduB           -----------------------DHPDADVTAYEMNDNISF-LSGIALYLGKEIKNNDPLFYSSPEELSN
2cduA           -----------------------DHPDADVTAYEMNDNISF-LSGIALYLGKEIKNNDPLFYSSPEELSN
2bc1A           ----------------------------EIVVFDQNSNISFLGSGMALWIGEQIAGPEGLFYSDKEELES
2bc0A           ----------------------------EIVVFDQNSNISFLG-GMALWIGEQIAGPEGLFYSDKEELES
1nhrA           ------------------------HPDAEIQWYEKGDFISFCSCGMQLYLEGKVKDVNSVRYMTGEKMES
1nhpA           ------------------------HPDAEIQWYEKGDFISFLSAGMQLYLEGKVKDVNSVRYMTGEKMES
1nhsA           ------------------------HPDAEIQWYEKGDFISF-LCGMQLYLEGKVKDVNSVRYMTGEKMES
1nhqA           ------------------------HPDAEIQWYEKGDFISFLSSGMQLYLEGKVKDVNSVRYMTGEKMES
1yqzA           ----------------------RLDKESDIIIFEKDRDMSFANCALPYVIGEVVEDRRYALAYTPEKFRK
3iwaA           ----------------------------------------------------------------------
1joaA           ------------------------HPDAEIQWYEKGDFISF-LSGMQLYLEGKVKDVNSVRYMTGEKMES
1f8wA           ------------------------HPDAEIQWYEKGDFISF-LSGMQLYLEGKVKDVNSVRYMTGEKMES
3ef6A           ----------------------------------------------------------------------
1q1wB           ---------------------------------------------------------ESLYLRTPDAYAA
1q1wA           ---------------------------------------------------------ESLYLRTPDAYAA
1q1rA           ---------------------------------------------------------ESLYLRTPDAYAA
2rabB           ----------------------------------------------------------------------
2rabA           ----------------------------------------------------------------------
2r9zB           ----------------------------------------------------------------------
2r9zA           ----------------------------------------------------------------------
1zx9A           ----------------------------------------------------------------------
1zk7A           ----------------------------------------------------------------------
2v3aA           ----------------------------------------------------------------------
1lvlA           ----------------------------------------------------------------------
1gesB           ----------------------------------------------------------------------
1gesA           ----------------------------------------------------------------------
1xdiA           ----------------------------------------------------------------------
1gerB           ----------------------------------------------------------------------
1gerA           ----------------------------------------------------------------------
3fg2P           ----------------------------------------------------------------PEKFFQ
2eq6A           ----------------------------------------------------------------------
1xhcA           ----------------------------EVTVIDKEPVPYYSKPMLSHYIAGFIPR-NRLFPYSLDWYRK
1dxlA           ----------------------------------------------------------------------
1lpfA           ----------------------------------------------------------------------
2a8xA           -------------------------------------------------------------SRKVAEGRV
1ebdA           ----------------------------------------------------------------------
3ladA           ----------------------------------------------------------------------
2grtA           ----------------------------------------------------------------------
1grtA           ----------------------------------------------------------------------
1grgA           ----------------------------------------------------------------------
1grbA           ----------------------------------------------------------------------
1dncA           ----------------------------------------------------------------------
3dk9A           ----------------------------------------------------------------------
2ve2B           ----------------------------------------------------------------------
2ve2A           ----------------------------------------------------------------------
2yquA           -------------------------------------------------------------------FKK
2eq7A           -------------------------------------------------------------------FKK
1gsnA           ----------------------------------------------------------------------
1tytB           ----------------------------------------------------------------------
1tytA           ----------------------------------------------------------------------
1typB           ----------------------------------------------------------------------
1typA           ----------------------------------------------------------------------
2tprA           ----------------------------------------------------------------------
1gxfA           ----------------------------------------------------------------------
1fecB           ----------------------------------------------------------------------
1fecA           ----------------------------------------------------------------------
1feaB           ----------------------------------------------------------------------
1feaA           ----------------------------------------------------------------------
1bzlA           ----------------------------------------------------------------------
1aogB           ----------------------------------------------------------------------
1aogA           ----------------------------------------------------------------------
1zkqA           ----------------------------------------------------------------------
1zdlA           ----------------------------------------------------------------------
1mo9A           ----------------------------------------------------------------------
1ndaA           ----------------------------------------------------------------------
1zy8A           ----------------------------------------------------------------------
1zmdE           ----------------------------------------------------------------------
1zmcD           ----------------------------------------------------------------------
1zmcB           ----------------------------------------------------------------------
1zmcA           ----------------------------------------------------------------------
2f5zI           ----------------------------------------------------------------------
2v6oA           ----------------------------------------------------------------------
1onfA           ----------------------------------------------------------------------
3h4kA           ----------------------------------------------------------------------
2w0hB           ----------------------------------------------------------------------
2w0hA           ----------------------------------------------------------------------
2jk6A           ----------------------------------------------------------------------
1gv4A           -----------------------------------------------YVSAQDLPNIEN-----------
3gd4B           -----------------------------------------------YVSAQDLPNIEN-----------
3gd4A           -----------------------------------------------YVSAQDLPNIEN-----------
3gd3D           -----------------------------------------------YVSAQDLPNIEN-----------
3gd3C           -----------------------------------------------YVSAQDLPNIEN-----------
3gd3B           -----------------------------------------------YVSAQDLPNIEN-----------
3gd3A           -----------------------------------------------YVSAQDLPNIEN-----------
2zzcA           ----------------------------------------------------------------------
2zzbC           ----------------------------------------------------------------------
2zz0B           ----------------------------------------------------------------------
2j3nF           ----------------------------------------------------------------------
2j3nD           ----------------------------------------------------------------------
2j3nC           ----------------------------------------------------------------------
2j3nB           ----------------------------------------------------------------------
2j3nA           ----------------------------------------------------------------------
2cfyA           ----------------------------------------------------------------------
2hqmA           ----------------------------------------------------------------------
1m6iA           -----------------------------------------------YVSAQDLPHIEN-----------
1h6vE           ----------------------------------------------------------------------
1h6vC           ----------------------------------------------------------------------
1h6vB           ----------------------------------------------------------------------
1h6vA           ----------------------------------------------------------------------
3eanF           ----------------------------------------------------------------------
3eanD           ----------------------------------------------------------------------
3eanC           ----------------------------------------------------------------------
3eanA           ----------------------------------------------------------------------
2nvkX           ----------------------------------------------------------------------
3dh9A           ----------------------------------------------------------------------
3dghB           ----------------------------------------------------------------------
3dghA           ----------------------------------------------------------------------
2yvjA           ----------------------------------------------------------------------
2qaeA           ----------------------------------------------------------------------
2gr3A           ----------------------------------------------------------------------
2gqwA           ----------------------------------------------------------------------
1d7yA           ----------------------------------------------------------------------
3f8rB           ----------------------------------------------------------------------
3f8rA           ----------------------------------------------------------------------
3f8pD           ----------------------------------------------------------------------
3f8pC           ----------------------------------------------------------------------
3f8pB           ----------------------------------------------------------------------
3f8pA           ----------------------------------------------------------------------
3f8dC           ----------------------------------------------------------------------
3f8dB           ----------------------------------------------------------------------
3f8dA           ----------------------------------------------------------------------
3ctyB           ----------------------------------------------------------------------
3ctyA           ----------------------------------------------------------------------
1fl2A           ----------------------------------------------------------------------
1ojtA           ----------------------------------------------------------------------
1bhyA           ----------------------------------------------------------------------
1hyuA           ----------------------------------------------------------------------
3d8xA           ----------------------------------------------------------------------
2vdcG           ----------------------------------------------------------------------
3f8rD           ----------------------------------------------------------------------
3f8dD           ----------------------------------------------------------------------
2q0lA           ----------------------------------------------------------------------
2q0kA           ----------------------------------------------------------------------
2iidA           ----------------------------------------------------------------------
1f8sA           ----------------------------------------------------------------------
3ic9C           ----------------------------------------------------------------------
3ic9A           ----------------------------------------------------------------------
1ps9A           ----------------------------------------------------------------------
1vdcA           ----------------------------------------------------------------------
1reoA           ----------------------------------------------------------------------
1sezA           ----------------------------------------------------------------------
3fbsB           ----------------------------------------------------------------------
3fbsA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           QGVLVHTRHEVVDVDYELRTLTVHDHAEGRTFQDRFDHLVLATGARPSLPPIPGTEQEGVYTLRTMEDGE
3cgcA           YGIDAKVRHEVTKVDTEKKIVYAEHTKTKDVFEFSYDRLLIATGVRPVMPEWEGRDLQGVHLLKTIPDAE
3cgbA           YGIDAKVRHEVTKVDTEKKIVYAEHTKTKDVFEFSYDRLLIATGVRP-VPEWEGRDLQGVHLLKTIPDAE
2cduB           LGANVQMRHQVTNVDPETKTIKVKDLITNEEKTEAYDKLIMTTGSKPTVPPIPGIDSSRVYLCKNYNDAK
2cduA           LGANVQMRHQVTNVDPETKTIKVKDLITNEEKTEAYDKLIMTTGSKPTVPPIPGIDSSRVYLCKNYNDAK
2bc1A           LGAKVYMESPVQSIDYDAKTVTAL--VDGKNHVETYDKLIFATGSQPILPPIKGAEKEGSLEFEATLENL
2bc0A           LGAKVYMESPVQSIDYDAKTVTAL--VDGKNHVETYDKLIFATGSQPILPPIKGAEKEGSLEFEATLENL
1nhrA           RGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAI
1nhpA           RGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAI
1nhsA           RGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAI
1nhqA           RGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAI
1yqzA           Q-ITVKTYHEVIAINDERQTVSVLNRKTNEQFEESYDKLILSPGASANSL---GFESDITFTLRNLEDTD
3iwaA           ---LVETRAHAID--RAAHTVEIENLRTGERRTLKYDKLVLALGSKANRPPVEGMDLAGVTPVTNLDEAE
1joaA           RGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAI
1f8wA           RGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAI
3ef6A           ------TGPEVTALDVQTRTISLDD---GTTLSA--DAIVIATGSRARTMALPGSQLPGVVTLRTYGDVQ
1q1wB           QNIQLLGGTQVTAINRDRQQVILSD---GRALD--YDRLVLATGGRPRLPVASGAKANNFRYLRTLEDAE
1q1wA           QNIQLLGGTQVTAINRDRQQVILSD---GRALD--YDRLVLATGGRPRLPVASGAKANNFRYLRTLEDAE
1q1rA           QNIQLLGGTQVTAINRDRQQVILSD---GRALD--YDRLVLATGGRPRLPVASGAKANNFRYLRTLEDAE
2rabB           ----------ITRVDGHARFVDAHTEVEGQRLSA--DHIVIATGGRPIVPRLPGAE------LGITSDGF
2rabA           ----------ITRVDGHARFVDAHTEVEGQRLSA--DHIVIATGGRPIVPRLPGAE------LGITSDGF
2r9zB           ----------ITRVDGHARFVDAHTEVEGQRLSA--DHIVIATGGRPIVPRLPGAE------LGITSDGF
2r9zA           ----------ITRVDGHARFVDAHTEVEGQRLSA--DHIVIATGGRPIVPRLPGAE------LGITSDGF
1zx9A           -----------------------------------FDRCLVATGASPAVPPIPGLKESPYWT------ST
1zk7A           -----------------------------------FDRCLVATGASPAVPPIPGLKESPYWT------ST
2v3aA           --ILTHTR--VTGIDPGHQRIWIGEE------EVRYRDLVLAWGAEPIRVPVEGDAQDALYPINDLEDYA
1lvlA           ------------------------------------EHLLLATGSSSELPMLP----LGGPVISSTE--A
1gesB           ------------------------------------DHILIATGGRPSHPDIPGVEY-GIDS-----DGF
1gesA           ------------------------------------DHILIATGGRPSHPDIPGVEY-GIDS-----DGF
1xdiA           --------------------------ADGSTSEHEADVVLVATGASPRILPSAQPDGERILTWRQLYD--
1gerB           ------------------------------------DHILIATGGRPSHPDIPGVEY-GIDS-----DGF
1gerA           ------------------------------------DHILIATGGRPSHPDIPGVEY-GIDS-----DGF
3fg2P           DQAIELISDRMVSIDREGRKLLL---ASGTAIE--YGHLVLATGARNRMLDVPNASLPDVLYLRTLDESE
2eq6A           --------------------------------------LILATGSEP-------LELKGFPFGEDVWDST
1xhcA           RGIEIRLAEEAKLIDRG-RKVVITEKGEVP-----YDTLVLATGARAREPQIKG--KEYLLTLRTIFDAD
1dxlA           ------------------------DTIEGENTVVKGKHIIIATGSDKSLPGVTIDEKKIVSST-----GA
1lpfA           ---------------------------DGKTQVLEAENVIIASGSRPEIPPAPLSDDIIVDSTGALE---
2a8xA           AGVHFLKKNKITEIHADANTLLV-DLNDGGTESVTFDNAIIATGSSTRL--VPGTSSANVVTYEEQILSR
1ebdA           EGLLKGNKVEIVKGEVDANTVRVVNGDSAQTYT--FKNAIIATGSRPELPNFK-------FSNRILDSGA
3ladA           ------------------------------------ENVILASGSKPEIPPAPVDQD-------VIVDST
2grtA           -------------------------------------HILIATGGMPSTPQIPGA------SLGITSDGF
1grtA           -------------------------------------HILIATGGMPSTPQIPGA------SLGITSDGF
1grgA           -------------------------------------HILIATGGMPSTPQIPGA------SLGITSDGF
1grbA           -------------------------------------HILIATGGMPSTPQIPGA------SLGITSDGF
1dncA           -------------------------------------HILIATGGMPSTPQIPGA------SLGITSDGF
3dk9A           -------------------------------------HILIATGGMPSTPQIPGA------SLGITSDGF
2ve2B           ------------------------------------DHILLATGSWPQMPAIPGIEH-------CISSNE
2ve2A           ------------------------------------DHILLATGSWPQMPAIPGIEH-------CISSNE
2yquA           NGI---ARHQGTARFLSERKVLVEE--TGEELEARY--ILIATGSAPLIPPWAQVDYERVVT------ST
2eq7A           NGI---ARHQGTARFLSERKVLVEE--TGEELEARY--ILIATGSAPLIPPWAQVDYERVVT------ST
1gsnA           -------------------------------------HILIATGGMPSTPQIPGA------SLGITSDGF
1tytB           ------------------------------------EYILLATGSWPQHLGIEGTSNEAFY---------
1tytA           ------------------------------------EYILLATGSWPQHLGIEGTSNEAFY---------
1typB           ------------------------------------EYILLATGSWPQHLGIEGTSNEAFY---------
1typA           ------------------------------------EYILLATGSWPQHLGIEGTSNEAFY---------
2tprA           ------------------------------------EYILLATGSWPQHLGIEGTSNEAFY---------
1gxfA           ------------------------------------EHILLASGSWPHMPNIPGIEH-------CISSNE
1fecB           ------------------------------------EYILLATGSWPQHLGIEGTSNEAFY---------
1fecA           ------------------------------------EYILLATGSWPQHLGIEGTSNEAFY---------
1feaB           ------------------------------------EYILLATGSWPQHLGIEGTSNEAFY---------
1feaA           ------------------------------------EYILLATGSWPQHLGIEGTSNEAFY---------
1bzlA           ------------------------------------EHILLASGSWPHMPNIPGIEH-------CISSNE
1aogB           ------------------------------------EHILLASGSWPHMPNIPGIEH-------CISSNE
1aogA           ------------------------------------EHILLASGSWPHMPNIPGIEH-------CISSNE
1zkqA           ------------------------------------EHIVIATGGRPRYP----TQVKGALEYGITSDDI
1zdlA           ------------------------------------EHIVIATGGRPRYP----TQVKGALEYGITSDDI
1mo9A           -GIMNFQSKEQLNLEYILNAKVIDNHAAGKVFKAK--NLILAVGAGPGTLDVPGVNAKGVFDHATLVEE-
1ndaA           ------------------------------------ENILLASGSWPHMPNIPGIEH-------CISSNE
1zy8A           --------------------------ADGGTQVIDTKNILIATGSE--VTPFPGTIDEDTIVSST---GA
1zmdE           --------------------------ADGGTQVIDTKNILIATGSE--VTPFPGTIDEDTIVSST---GA
1zmcD           --------------------------ADGGTQVIDTKNILIATGSE--VTPFPGTIDEDTIVSST---GA
1zmcB           --------------------------ADGGTQVIDTKNILIATGSE--VTPFPGTIDEDTIVSST---GA
1zmcA           --------------------------ADGGTQVIDTKNILIATGSE--VTPFPGTIDEDTIVSST---GA
2f5zI           --------------------------ADGGTQVIDTKNILIATGSE--VTPFPGTIDEDTIVSST---GA
2v6oA           --------------------------------------IILATGERPKYPEIPGAVEYGI----TSDD--
1onfA           -------------------------------------NILIAVGNKPVFPPVKGIEN-------TISSDE
3h4kA           --------------------------------------IILATGERPKYPEIPGAVEYGI----TSDD--
2w0hB           ------------------------------------EYILIATGSWPTRLGVPGTSNEAFY----LEDAP
2w0hA           ------------------------------------EYILIATGSWPTRLGVPGTSNEAFY----LEDAP
2jk6A           ------------------------------------EYILIATGSWPTRLGVPGTSNEAFY----LEDAP
1gv4A           GGVAVLTGKKVVHLDVRGNMVKLNDGS-----QITFEKCLIATGGTPSLSAIDGAEVKSRTTLRKIGDFR
3gd4B           GGVAVLTGKKVVHLDVRGNMVKLNDGS-----QITFEKCLIATGGTPSLSAIDGAEVKSRTTLRKIGDFR
3gd4A           GGVAVLTGKKVVHLDVRGNMVKLNDGS-----QITFEKCLIATGGTPSLSAIDGAEVKSRTTLRKIGDFR
3gd3D           GGVAVLTGKKVVHLDVRGNMVKLNDGS-----QITFEKCLIATGGTPSLSAIDGAEVKSRTTLRKIGDFR
3gd3C           GGVAVLTGKKVVHLDVRGNMVKLNDGS-----QITFEKCLIATGGTPSLSAIDGAEVKSRTTLRKIGDFR
3gd3B           GGVAVLTGKKVVHLDVRGNMVKLNDGS-----QITFEKCLIATGGTPSLSAIDGAEVKSRTTLRKIGDFR
3gd3A           GGVAVLTGKKVVHLDVRGNMVKLNDGS-----QITFEKCLIATGGTPSLSAIDGAEVKSRTTLRKIGDFR
2zzcA           ------------------------------------ERFLIATGERPRYLGIPGDKE---YCISSDD---
2zzbC           ------------------------------------ERFLIATGERPRYLGIPGDKE---YCISSDD---
2zz0B           ------------------------------------ERFLIATGERPRYLGIPGDKE---YCISSDD---
2j3nF           ------------------------------------ERFLIATGERPRYLGIPGDKE---YCISSDD---
2j3nD           ------------------------------------ERFLIATGERPRYLGIPGDKE---YCISSDD---
2j3nC           ------------------------------------ERFLIATGERPRYLGIPGDKE---YCISSDD---
2j3nB           ------------------------------------ERFLIATGERPRYLGIPGDKE---YCISSDD---
2j3nA           ------------------------------------ERFLIATGERPRYLGIPGDKE---YCISSDD---
2cfyA           ------------------------------------ERFLIATGERPRYLGIPGDKE---YCISSDD---
2hqmA           ------------------------------------NHILVATGGKAIFPEIPGFE------LGTDSDGF
1m6iA           GGVAVLTGKKVVQLDVRDNMVKLNDGS-----QITYEKCLIATGGTPSLSAIDGAEVKSRTTLRKIGDFR
1h6vE           ------------------------------------ERFLIATGERPRYLGIPGDKE---YCISSDD---
1h6vC           ------------------------------------ERFLIATGERPRYLGIPGDKE---YCISSDD---
1h6vB           ------------------------------------ERFLIATGERPRYLGIPGDKE---YCISSDD---
1h6vA           ------------------------------------ERFLIATGERPRYLGIPGDKE---YCISSDD---
3eanF           ------------------------------------ERFLIATGERPRYLGIPGDKE---YCISSDD---
3eanD           ------------------------------------ERFLIATGERPRYLGIPGDKE---YCISSDD---
3eanC           ------------------------------------ERFLIATGERPRYLGIPGDKE---YCISSDD---
3eanA           ------------------------------------ERFLIATGERPRYLGIPGDKE---YCISSDD---
2nvkX           ---------------------------------------VIAVGGRPRYPDIPGAVEYGI----TSDD--
3dh9A           ---------------------------------------VIAVGGRPRYPDIPGAVEYGI----TSDD--
3dghB           ---------------------------------------VIAVGGRPRYPDIPGAVEYGI----TSDD--
3dghA           ---------------------------------------VIAVGGRPRYPDIPGAVEYGI----TSDD--
2yvjA           --------------------------SDGRTLP--YGTLVLATGAAPALPTLQGATMP-VHTLRTLEDAR
2qaeA           ---------------------------------------IIATGSEPTLPFLPFDEKVVLSSTGAL----
2gr3A           --------------------------SDGRTLP--YGTLVLATGAAPALPTLQGATMP-VHTLRTLEDAR
2gqwA           --------------------------SDGRTLP--YGTLVLATGAAPALPTLQGATMP-VHTLRTLEDAR
1d7yA           --------------------------SDGRTLP--YGTLVLATGAAPALPTLQGATMP-VHTLRTLEDAR
3f8rB           ------------------------------------DSVILGIGVKRRKLGVPG-EQE--FAGRGISYCS
3f8rA           ------------------------------------DSVILGIGVKRRKLGVPG-EQE--FAGRGISYCS
3f8pD           ------------------------------------DSVILGIGVKRRKLGVPG-EQE--FAGRGISYCS
3f8pC           ------------------------------------DSVILGIGVKRRKLGVPG-EQE--FAGRGISYCS
3f8pB           ------------------------------------DSVILGIGVKRRKLGVPG-EQE--FAGRGISYCS
3f8pA           ------------------------------------DSVILGIGVKRRKLGVPG-EQE--FAGRGISYCS
3f8dC           ------------------------------------DSVILGIGVKRRKLGVPG-EQE--FAGRGISYCS
3f8dB           ------------------------------------DSVILGIGVKRRKLGVPG-EQE--FAGRGISYCS
3f8dA           ------------------------------------DSVILGIGVKRRKLGVPG-EQE--FAGRGISYCS
3ctyB           ----------------------------------------------------------------------
3ctyA           ----------------------------------------------------------------------
1fl2A           --------------------------------------IIVATGAKWRNMNVPGEDQ---YRTKGVTYCP
1ojtA           ----------------------------------------------------------------------
1bhyA           ----------------------------------------------------------------------
1hyuA           --------------------------------------IIIATGAKWRNMNVPGEDQ---YRTKGVTYCP
3d8xA           ------------------------------------DAIILATGASAKRMHLPGEEQKGISACAVCDGAV
2vdcG           ----------------------------------------------------------------------
3f8rD           ----------------------------------------------------------------------
3f8dD           ----------------------------------------------------------------------
2q0lA           ---------------------------DGKTFEAK--SVIIATGGSPKRTGIKGESEKGVSTCATCDG--
2q0kA           ---------------------------DGKTFEAK--SVIIATGGSPKRTGIKGESEKGVSTCATCDG--
2iidA           --------------------------------------------------PLAECFQENDYE-EFLEIAR
1f8sA           --------------------------------------------------PLAECFQENDYE-EFLEIAR
3ic9C           -------------------TLQVDDHS-----QVIAKRIVIATGSRPNYPEFLAAAGSRLLT----NDNL
3ic9A           -------------------TLQVDDHS-----QVIAKRIVIATGSRPNYPEFLAAAGSRLLT----NDNL
1ps9A           -----------------------------------FDETILASGIVPRTPPIDGIDHPKVLSYLDV----
1vdcA           ----------------------------------------------------------------------
1reoA           ----------------------------------------------------------------------
1sezA           ----------------------------------------------------------------------
3fbsB           ----------------------------------------------------------------------
3fbsA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           RLLKALPQARRAAILGAGYIGLEAAEAFRKRGLQVTLLEAKDRPLPHWDPEVGALLKEELERHGVEVWTG
3cgcA           RILKTLEKVEDVTIIGGGAIGLEMAETFVELGKKVRMIERNDHIGTIYDGDMAEYIYKEADKHHIEILTN
3cgbA           RILKTLEKVEDVTXXXXXXXXLEA-ETFVELGKKVRI-ERNDHIGTIYDGDAEYIYKEA-DKHHIEILTN
2cduB           KLFEEAPKAKTITIIGSGYIGAELAEAYSNQNYNVNLIDGHERVLKYFDKEFTDILAKDYEAHGVNLVLG
2cduA           KLFEEAPKAKTITIIGSGYIGAELAEAYSNQNYNVNLIDGHERVLKYFDKEFTDILAKDYEAHGVNLVLG
2bc1A           QFVKLYQNSKRVAVVGAGYIGVELAEAFQRKGKEVVLIDVVDTCLAYYDRDLTDLMAKNMEEHGIQLAFG
2bc0A           QFVKLYQNSKRVAVVGAGYIGVELAEAFQRKGKEVVLIDVVDTCLAYYDRDLTDLMAKNMEEHGIQLAFG
1nhrA           KLKQKTPEVNNVVVIGSGYXXXXXXXXXXXXXXKVTVIDILDRPLVYLDKEFTDVLTEEMEANNITIATG
1nhpA           KLKQKTPEVNNVVVIGSGYXXXXXXXXXXXXXXKVTVIDILDRPLVYLDKEFTDVLTEEMEANNITIATG
1nhsA           KLKQKTPEVNNVVVIGSGYXXXXXXXXXXXXXXKVTVIDILDRPLGYLDKEFTDVLTEEMEANNITIATG
1nhqA           KLKQKTPEVNNVVVIGSGYXXXXXXXXXXXXXXKVTVIDILDRPLVYLDKEFTDVLTEEMEANNITIATG
1yqzA           AIDQFIKQVDKVLVVGAGYVSLEVLENLYERGLHPTLIHRSDKINKLMDADMNQPILDELDKREIPY---
3iwaA           FVQHAISEVSKAVIVGGGFIGLEMAVSLADMGIDTTVVELADQIMPGFTSKLSQMLRHDLEKNDVVVHTG
1joaA           KLKQKTPEVNNVVVIGSGYXXXXXXXXXXXXXXKVTVIDILDRPLGYLDKEFTDVLTEEMEANNITIATG
1f8wA           KLKQKTPEVNNVVVIGSGYXXXXXXXXXXXXXXKVTVIDILDRPLGYLDKEFTDVLTEEMEANNITIATG
3ef6A           VLRDSWTSATRLLIVGGGLIGCEVATTARKLGLSVTILEAGDELLVRLGRRIGAWLRGLLTELGVQVELG
1q1wB           CIRRQLIADNRLVVIGGGYIGLEVAATAIKANMHVTLLDTAARVLERTAPPVSAFYEHLHREAGVDIRTG
1q1wA           CIRRQLIADNRLVVIGGGYIGLEVAATAIKANMHVTLLDTAARVLERTAPPVSAFYEHLHREAGVDIRTG
1q1rA           CIRRQLIADNRLVVIGGGYIGLEVAATAIKANMHVTLLDTAARVLERTAPPVSAFYEHLHREAGVDIRTG
2rabB           FALQQQP--KRVAIIGAGYIGIELAGLLRSFGSEVTVVALEDRLLFQFDPLLSATLAENMHAQGIETHLE
2rabA           FALQQQP--KRVAIIGAGYIGIELAGLLRSFGSEVTVVALEDRLLFQFDPLLSATLAENMHAQGIETHLE
2r9zB           FALQQQP--KRVAIIGAGYIGIELAGLLRSFGSEVTVVALEDRLLFQFDPLLSATLAENMHAQGIETHLE
2r9zA           FALQQQP--KRVAIIGAGYIGIELAGLLRSFGSEVTVVALEDRLLFQFDPLLSATLAENMHAQGIETHLE
1zx9A           EALASDTIPERLAVIGSSVVALELAQAFARLGSKVTVL-ARNTLFFREDPAIGEAVTAAFRAEGIEVLEH
1zk7A           EALASDTIPERLAVIGSSVVALELAQAFARLGSKVTVL-ARNTLFFREDPAIGEAVTAAFRAEGIEVLEH
2v3aA           RFRQAAAGKRRVLLLGAGLIGCEFANDLSSGGYQLDVVAPCEQVMPGLHPAAAKAVQAGLEGLGVRFHLG
1lvlA           LAPKALPQ--HLVVVGGGYIGLELGIAYRKLGAQVSVVEARERILPTYDSELTAPVAESLKKLGIALHLG
1gesB           FALPALPE--RVAVVGAGYIGVELGGVINGLGAKTHLFEMFDAPLPSFDPMISETLVEVMNAEGPQLHTN
1gesA           FALPALPE--RVAVVGAGYIGVELGGVINGLGAKTHLFEMFDAPLPSFDPMISETLVEVMNAEGPQLHTN
1xdiA           --LDALPD--HLIVVGSGVTGAEFVDAYTELGVPVTVVASQDHVLPYEDADAALVLEESFAERGVRLFKN
1gerB           FALPALPE--RVAVVGAGYIAVELAGVINGLGAKTHLFVRKHAPLRSFDPMISETLVEVMNAEGPQLHTN
1gerA           FALPALPE--RVAVVGAGYIAVELAGVINGLGAKTHLFVRKHAPLRSFDPMISETLVEVMNAEGPQLHTN
3fg2P           VLRQRMPDKKHVVVIGAGFIGLEFAATARAKGLEVDVVELAPRVMARVTPEISSYFHDRHSGAGIRMHYG
2eq6A           RALKVLP--KRLLVIGGGAVGLELGQVYRRLGAEVTLIEYMPEILPQGDPETAALLRRALEKEGIRVRTK
1xhcA           RIKESIENSXXXXXXXXXXXXXXXXXNLAEAGYHVKLIH-RGAMFLGLDEELSNMIKDMLEETGVKFFLN
1dxlA           LALSEIP--KKLVVIGAGYIGLEMGSVWGRIGSEVTVVEFASEIVPTMDAEIRKQFQRSLEKQGMKFKLK
1lpfA           --FQAVP--KKLGVIGAGVIGLELGSVWARLGAEVTVLEALDKFLPAADEQIAKEALKVLTKQGLNIRLG
2a8xA           ELPKSXXXXXXXXXXEFGYV-------LKNYGVDVTIVEFLPRALPNEDADVSKEIEKQFKKLGVTILTA
1ebdA           LNLGEVPKS--LVVIGGGYIGIELGTAYANFGTKVTILEGAGEILSGFEKQMAAIIKKRLKKKGVEVVTN
3ladA           GALDFQNVPGKLGVIGAGVIGLELGSVWARLGAEVTVLEAMDKFLPAVDEQVAKEAQKILTKQGLKILLG
2grtA           FQLEELPG--RSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKF
1grtA           FQLEELPG--RSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKF
1grgA           FQLEELPG--RSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKF
1grbA           FQLEELPG--RSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKF
1dncA           FQLEELPG--RSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKF
3dk9A           FQLEELPG--RSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKF
2ve2B           AFYLPEPP-RRVLTVGGGFISVEFANAYKPPGGKVTLCYRNNLILRGFDETIREEVTKQLTANGIEIMTN
2ve2A           AFYLPEPP-RRVLTVGGGFISVEFANAYKPPGGKVTLCYRNNLILRGFDETIREEVTKQLTANGIEIMTN
2yquA           EALSFPEVPKRXXXXXXXXXXXXXXXXWHRLGAEVIVLEYMDRILPTMDLEVSRAAERVFKKQGLTIRTG
2eq7A           EALSFPEVPKRXXXXXXXXXXXXXXXXWHRLGAEVIVLEYMDRILPTMDLEVSRAAERVFKKQGLTIRTG
1gsnA           FQLEELPG--RSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLRSFDSMISTNT-EELENAGVEVLKF
1tytB           --LDEAP--KRALCVGGGYISIEFANAYKARGGQVDLAYRGDMILRGFDSELRKQLTEQLRANGINVRTH
1tytA           --LDEAP--KRALCVGGGYISIEFANAYKARGGQVDLAYRGDMILRGFDSELRKQLTEQLRANGINVRTH
1typB           --LDEAP--KRALCVGGGYISIEFANAYKARGGQVDLAYRGDMILRGFDSELRKQLTEQLRANGINVRTH
1typA           --LDEAP--KRALCVGGGYISIEFANAYKARGGQVDLAYRGDMILRGFDSELRKQLTEQLRANGINVRTH
2tprA           --LDEAP--KRALCVGGGYISIEFANAYKARGGQVDLAYRGDMILRGFDSELRKQLTEQLRANGINVRTH
1gxfA           AFYLPEPP-RRVLTVGGGFISVEFANAYKPKDGQVTLCYRGEMILRGFDHTLREELTKQLTANGIQILTK
1fecB           --LDEAP--KRALCVGGGYISIEFANAYKARGGQVDLAYRGDMILRGFDSELRKQLTEQLRANGINVRTH
1fecA           --LDEAP--KRALCVGGGYISIEFANAYKARGGQVDLAYRGDMILRGFDSELRKQLTEQLRANGINVRTH
1feaB           --LDEAP--KRALCVGGGYISIEFANAYKARGGQVDLAYRGDMILRGFDSELRKQLTEQLRANGINVRTH
1feaA           --LDEAP--KRALCVGGGYISIEFANAYKARGGQVDLAYRGDMILRGFDSELRKQLTEQLRANGINVRTH
1bzlA           AFYLPEPP-RRVLTVGGGFISVEFANAYKPKDGQVTLCYRGEMILRGFDHTLREELTKQLTANGIQILTK
1aogB           AFYLPEPP-RRVLTVGGGFISVEFANAYKPKDGQVTLCYRGEMILRGFDHTLREELTKQLTANGIQILTK
1aogA           AFYLPEPP-RRVLTVGGGFISVEFANAYKPKDGQVTLCYRGEMILRGFDHTLREELTKQLTANGIQILTK
1zkqA           FWLKESP--GKTLVVGASYVALECAGFLTGIGLDTTVM-MRSIPLRGFDQQMSSLVTEHMESHGTQFLKG
1zdlA           FWLKESP--GKTLVVGASYVALECAGFLTGIGLDTTVM-MRSIPLRGFDQQMSSLVTEHMESHGTQFLKG
1mo9A           --LDYEPGSTXXXXXXSK-TAVEYGCFFNATGRRTVMLVRTEPLKLIKDNETRAYVLDRMKEQGMEIISG
1ndaA           AFYLPEPP-RRVLTVGGGFISVEFANAYKPKDGQVTLCYRGEMILRGFDHTLREELTKQLTANGIQILTK
1zy8A           LSLKKVPE--KMVVIGAGVIGVELGSVWQRLGADVTAVEF----LGHVDMEISKNFQRILQKQGFKFKLN
1zmdE           LSLKKVPE--KMVVIGAGVIGVELGSVWQRLGADVTAVEF----LGHVDMEISKNFQRILQKQGFKFKLN
1zmcD           LSLKKVPE--KMVVIGAGVIGVELGSVWQRLGADVTAVEF----LGHVDMEISKNFQRILQKQGFKFKLN
1zmcB           LSLKKVPE--KMVVIGAGVIGVELGSVWQRLGADVTAVEF----LGHVDMEISKNFQRILQKQGFKFKLN
1zmcA           LSLKKVPE--KMVVIGAGVIGVELGSVWQRLGADVTAVEF----LGHVDMEISKNFQRILQKQGFKFKLN
2f5zI           LSLKKVPE--KMVVIGAGVIGVELGSVWQRLGADVTAVEF----LGHVDMEISKNFQRILQKQGFKFKLN
2v6oA           --LFSLPYPGKTLVIGASYVALECAGFLASLGGDVTVM-VRSILLRGFDQQMAEKVGDYMENHGVKFAKL
1onfA           FF--NIKESKKIGIVGSGYIAVELINVIKRLGIDSYIFARGNRILRKFDESVINVLENDMKKNNINIVTF
3h4kA           --LFSLPYPGKTLVIGASYVALECAGFLASLGGDVTVM-VRSILLRGFDQQMAEKVGDYMENHGVKFAKL
2w0hB           K---------RMLCVGGGYIAVEFAGIFKPCGGYVDLCYRGDLILRGFDTEVRKSLTKQLGANGIRVRTN
2w0hA           K---------RMLCVGGGYIAVEFAGIFKPCGGYVDLCYRGDLILRGFDTEVRKSLTKQLGANGIRVRTN
2jk6A           K---------RMLCVGGGYIAVEFAGIFKPCGGYVDLCYRGDLILRGFDTEVRKSLTKQLGANGIRVRTN
1gv4A           ALEKISREVKSITVIGGGFLGSELACALGRKGIEVIQLFPEKGNMGKILPQLSNWTMEKVKREGVKVMPN
3gd4B           ALEKISREVKSITVIGGGFLGSELACALGRKGIEVIQLFPEKGNMGKILPQLSNWTMEKVKREGVKVMPN
3gd4A           ALEKISREVKSITVIGGGFLGSELACALGRKGIEVIQLFPEKGNMGKILPQLSNWTMEKVKREGVKVMPN
3gd3D           ALEKISREVKSITVIGGGFLGSELACALGRKGIEVIQLFPEKGNMGKILPQLSNWTMEKVKREGVKVMPN
3gd3C           ALEKISREVKSITVIGGGFLGSELACALGRKGIEVIQLFPEKGNMGKILPQLSNWTMEKVKREGVKVMPN
3gd3B           ALEKISREVKSITVIGGGFLGSELACALGRKGIEVIQLFPEKGNMGKILPQLSNWTMEKVKREGVKVMPN
3gd3A           ALEKISREVKSITVIGGGFLGSELACALGRKGIEVIQLFPEKGNMGKILPQLSNWTMEKVKREGVKVMPN
2zzcA           --LFSLPYCPKTLVVGASYVALECAGFLAGIGLDVTVM-VRSILLRGFDQDMANKIGEHMEEHGIKFFVP
2zzbC           --LFSLPYCPKTLVVGASYVALECAGFLAGIGLDVTVM-VRSILLRGFDQDMANKIGEHMEEHGIKFFVP
2zz0B           --LFSLPYCPKTLVVGASYVALECAGFLAGIGLDVTVM-VRSILLRGFDQDMANKIGEHMEEHGIKFFVP
2j3nF           --LFSLPYCPKTLVVGASYVALECAGFLAGIGLDVTVM-VRSILLRGFDQDMANKIGEHMEEHGIKFFVP
2j3nD           --LFSLPYCPKTLVVGASYVALECAGFLAGIGLDVTVM-VRSILLRGFDQDMANKIGEHMEEHGIKFFVP
2j3nC           --LFSLPYCPKTLVVGASYVALECAGFLAGIGLDVTVM-VRSILLRGFDQDMANKIGEHMEEHGIKFFVP
2j3nB           --LFSLPYCPKTLVVGASYVALECAGFLAGIGLDVTVM-VRSILLRGFDQDMANKIGEHMEEHGIKFFVP
2j3nA           --LFSLPYCPKTLVVGASYVALECAGFLAGIGLDVTVM-VRSILLRGFDQDMANKIGEHMEEHGIKFFVP
2cfyA           --LFSLPYCPKTLVVGASYVALECAGFLAGIGLDVTVM-VRSILLRGFDQDMANKIGEHMEEHGIKFFVP
2hqmA           FRLEEQP--KKVVVVGAGYIGIELAGVFHGLGSETHLVIRGETVLRKFDECIQNTITDHYVKEGINVHKI
1m6iA           SLEKISREVKSITIIGGGFLGSELACALGRKGTEVIQLFPEKGNMGKILPELSNWTMEKVRREGVKVMPN
1h6vE           --LFSLPYCPKTLVVGASYVALECAGFLAGIGLDVTVM-VRSILLRGFDQDMANKIGEHMEEHGIKFFVP
1h6vC           --LFSLPYCPKTLVVGASYVALECAGFLAGIGLDVTVM-VRSILLRGFDQDMANKIGEHMEEHGIKFFVP
1h6vB           --LFSLPYCPKTLVVGASYVALECAGFLAGIGLDVTVM-VRSILLRGFDQDMANKIGEHMEEHGIKFFVP
1h6vA           --LFSLPYCPKTLVVGASYVALECAGFLAGIGLDVTVM-VRSILLRGFDQDMANKIGEHMEEHGIKFFVP
3eanF           --LFSLPYCPKTLVVGASYVALECAGFLAGIGLDVTVM-VRSILLRGFDQDMANKIGEHMEEHGIKFFVP
3eanD           --LFSLPYCPKTLVVGASYVALECAGFLAGIGLDVTVM-VRSILLRGFDQDMANKIGEHMEEHGIKFFVP
3eanC           --LFSLPYCPKTLVVGASYVALECAGFLAGIGLDVTVM-VRSILLRGFDQDMANKIGEHMEEHGIKFFVP
3eanA           --LFSLPYCPKTLVVGASYVALECAGFLAGIGLDVTVM-VRSILLRGFDQDMANKIGEHMEEHGIKFFVP
2nvkX           -LFSLDREPGKTLVVGAGYIGLECAGFLKGLGYEPTVM-VRSIVLRGFDQQMAELVAASMEERGIPFLRK
3dh9A           -LFSLDREPGKTLVVGAGYIGLECAGFLKGLGYEPTVM-VRSIVLRGFDQQMAELVAASMEERGIPFLRK
3dghB           -LFSLDREPGKTLVVGAGYIGLECAGFLKGLGYEPTVM-VRSIVLRGFDQQMAELVAASMEERGIPFLRK
3dghA           -LFSLDREPGKTLVVGAGYIGLECAGFLKGLGYEPTVM-VRSIVLRGFDQQMAELVAASMEERGIPFLRK
2yvjA           RIQAGLPQSRXXXXXXXXXXXXXAATA-RTAGVHVSLVETQPRLMSRAAP---ATLADFVARY--HAAQG
2qaeA           ----ALPRVPKTMXXXXXXXXLELGSVWARLGAEVTVVEFAPRCAPTLDEDVGALAKNEK----MKFMTS
2gr3A           RIQAGLPQSRXXXXXXXXXXXXXAATA-RTAGVHVSLVETQPRLMSRAAP---ATLADFVARY--HAAQG
2gqwA           RIQAGLPQSRXXXXXXXXXXXXXAATA-RTAGVHVSLVETQPRLMSRAAP---ATLADFVARY--HAAQG
1d7yA           RIQAGLPQSRXXXXXXXXXXXXXAATA-RTAGVHVSLVETQPRLMSRAAP---ATLADFVARY--HAAQG
3f8rB           VCDAPLFKNRVVAVIGGGDSALEGAEILSSYSTKVYLIHRRDKAQPIYKPNVEFVLNSVVEIKGDKVVKQ
3f8rA           VCDAPLFKNRVVAVIGGGDSALEGAEILSSYSTKVYLIHRRDKAQPIYKPNVEFVLNSVVEIKGDKVVKQ
3f8pD           VCDAPLFKNRVVAVIGGGDSALEGAEILSSYSTKVYLIHRRDKAQPIYKPNVEFVLNSVVEIKGDKVVKQ
3f8pC           VCDAPLFKNRVVAVIGGGDSALEGAEILSSYSTKVYLIHRRDKAQPIYKPNVEFVLNSVVEIKGDKVVKQ
3f8pB           VCDAPLFKNRVVAVIGGGDSALEGAEILSSYSTKVYLIHRRDKAQPIYKPNVEFVLNSVVEIKGDKVVKQ
3f8pA           VCDAPLFKNRVVAVIGGGDSALEGAEILSSYSTKVYLIHRRDKAQPIYKPNVEFVLNSVVEIKGDKVVKQ
3f8dC           VADAPLFKNRVVAVIGGGDSALEGAEILSSYSTKVYLIHRRDKAQPIYKPNVEFVLNSVVEIKGDKVVKQ
3f8dB           VADAPLFKNRVVAVIGGGDSALEGAEILSSYSTKVYLIHRRDKAQPIYKPNVEFVLNSVVEIKGDKVVKQ
3f8dA           VADAPLFKNRVVAVIGGGDSALEGAEILSSYSTKVYLIHRRDKAQPIYKPNVEFVLNSVVEIKGDKVVKQ
3ctyB           --------------------------------------------------------------------TG
3ctyA           --------------------------------------------------------------------TG
1fl2A           HCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLLE--------FAPEMKAVLQDKLRSKNVDIILN
1ojtA           ----------------------------------------------------------------------
1bhyA           ----------------------------------------------------------------------
1hyuA           HCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLLE--------FAPEMKAVLQDKVRSKNVDIILN
3d8xA           PIFRNKP----LAVIGGGDSACEEAQFLTKYGSKVFMLVRKDHLRASTIMQKRAEKNEKIEI----LYNT
2vdcG           ---------KHVVVLGGGDTAMDCVRAIRQGATSVKCLYRRDRKMPGSQREVAHAEEEGVEFTGDTVVTG
3f8rD           ----------------------------------------------------------------------
3f8dD           ----------------------------------------------------------------------
2q0lA           ----FFYKNKEVAVLGGGDTAVEEAIYLANICKKVYLIHRRDRCAP-------ITLEHAKNNDKIEFLTP
2q0kA           ----FFYKNKEVAVLGGGDTAVEEAIYLANICKKVYLIHRRDRCAP-------ITLEHAKNNDKIEFLTP
2iidA           NGLKATSNPKHVVIVGAGMAGLSAAYVLAGAGHQVTVLEASERP--------------------------
1f8sA           NGLKATSNPKHVVIVGAGMAGLSAAYVLAGAGHQVTVLEASERP--------------------------
3ic9C           FELNDLPKS--VAVFGPGVIGLELGQALSRLGVIVKVFGRSGSVANLQDEE-----KRYAEKFNEEFYFD
3ic9A           FELNDLPKS--VAVFGPGVIGLELGQALSRLGVIVKVFGRSGSVANLQDEE-----KRYAEKFNEEFYFD
1ps9A           -LRDKAPVGNKVAIIGCGGIGFDTAMYLSQPGRQIVMLQRKSKPGQGLGKTTGWIHRTTLLSRGVKMIPG
1vdcA           ------------AVIGGGDSAMEEANFLTKYGSKVYIIHRRDAFRASKIMQQRALSNPKID----VIWNS
1reoA           --LKATSNPKHVVVVGAGMSGLSAAYVLSGAGHQVTVLEASER---------------------------
1sezA           --------AKRVAVIGAGVSGLAAAYKLKIHGLNVTVFEAEGK---------------------------
3fbsB           --------------------------------------------LPDWGETTNGIVEPDADQHALLAARG
3fbsA           --------------------------------------------LPDWGETTNGIVEPDADQHALLAARG


                         .         .         .         +         .         .         .:280
query           VKVEAFRGMGRVEAVETSEGVVPADLVLLATGIRPNTELAQAMGVALGPTGAIATDERMRTNLEGVYAAG
3cgcA           ENVKAFKGNERVEAVETDKGTYKADLVLVSVGVKPNTDFLEGTNIRTNHKGAIEVNAYMQTNVQDVYAAG
3cgbA           ENVKAFKGNERVEAVETDKGTYKADLVLVSVGVKPNTDFLEGTNIRTNHKGAIEVN-AYQTNVQDVYAAG
2cduB           SKVAAFEEVDDEIITKTLDGEIKSDIAILCIGFRPNTELLKGK-VAMLDNGAIITDEYMHSSNRDIFAAG
2cduA           SKVAAFEEVDDEIITKTLDGEIKSDIAILCIGFRPNTELLKGK-VAMLDNGAIITDEYMHSSNRDIFAAG
2bc1A           ETVKEVAGNGKVEKIITDKNEYDVDMVILAVGFRPNTTLGNGK-IDLFRNGAFLVNKRQETSIPGVYAIG
2bc0A           ETVKEVAGNGKVEKIITDKNEYDVDMVILAVGFRPNTTLGNGK-IDLFRNGAFLVNKRQETSIPGVYAIG
1nhrA           ETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGT-LELHPNGLIKTDEYMRTSEPDVFAVG
1nhpA           ETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGT-LELHPNGLIKTDEYMRTSEPDVFAVG
1nhsA           ETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGT-LELHPNGLIKTDEYMRTSEPDVFAVG
1nhqA           ETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGT-LELHPNGLIKTDEYMRTSEPDVFAVG
1yqzA           -RLXXXXXXXXXXXXTFKSGKVEHDMIIEGVGTHPNSKFIESSNIKLDRKGFIPVNDKFETNVPNIYAIG
3iwaA           EKVVRLEGEGKVARVITDKRTLDADLVILAAGVSPNTQLARDAGLELDPRGAIIVDTRMRTSDPDIFAGG
1joaA           ETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGT-LELHPNGLIKTDEYMRTSEPDVFAVG
1f8wA           ETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGT-LELHPNGLIKTDEYMRTSEPDVFAVG
3ef6A           TGVVGFSGEGQLEQVMASDGSFVADSALICVGAEPADQLARQAGLAC--DRGVIVDHCGATLAKGVFAVG
1q1wB           TQVCGFEDQQKVTAVLCEDGTLPADLVIAGIGLIPNCELASAAGLQV--DNGIVINEHMQTSDPLIMAVG
1q1wA           TQVCGFEDQQKVTAVLCEDGTLPADLVIAGIGLIPNCELASAAGLQV--DNGIVINEHMQTSDPLIMAVG
1q1rA           TQVCGFEDQQKVTAVLCEDGTLPADLVIAGIGLIPNCELASAAGLQV--DNGIVINEHMQTSDPLIMAVG
2rabB           FAVAALERDAQGTTLVAQDGTLGFDSVIWAVGRAPNTRGLEAAGIEVQSNGMVPTDAYQNTNVPGVYALG
2rabA           FAVAALERDAQGTTLVAQDGTLGFDSVIWAVGRAPNTRGLEAAGIEVQSNGMVPTDAYQNTNVPGVYALG
2r9zB           FAVAALEAQGTTLVAQDGTRLEGFDSVIWAVGRAPNTRGLEAAGIEVQSNGMVPTDAYQNTNVPGVYALG
2r9zA           FAVAALEAQGTTLVAQDGTRLEGFDSVIWAVGRAPNTRGLEAAGIEVQSNGMVPTDAYQNTNVPGVYALG
1zx9A           TQASQVAHMDGEFVLTTTHGELRADKLLVATGRTPNTRALDAAGVTVNAQGAIVIDQGMRTSNPNIYAAG
1zk7A           TQASQVAHMDGEFVLTTTHGELRADKLLVATGRTPNTRALDAAGVTVNAQGAIVIDQGMRTSNPNIYAAG
2v3aA           PVLASLKKAGEGLEAHLSDGVIPCDLVVSAVGLRPRTELAFAAGLAV--NRGIVVDRSLRTSHANIYALG
1lvlA           HSVEGYEN-GCLLANDGKGGQLEADRVLVAVGRRPRTKGFNLECLDLKMNGAIAIDERCQTSMHNVWAIG
1gesB           AIPKAVKNTDGSLTLELEDGSETVDCLIWAIGREPANDNLEAAGVKTNEKGYIVVDKYQNTNIEGIYAVG
1gesA           AIPKAVKNTDGSLTLELEDGSETVDCLIWAIGREPANDNLEAAGVKTNEKGYIVVDKYQNTNIEGIYAVG
1xdiA           ARAASVTRTGAGVLVTMTDGTVEGSHALMTIGSVPNTSGLERVGIQLGRGNYLTVDRVSRTLATGIYAAG
1gerB           AIPKAVKNTDGSLTLELEDGSETVDCLIWAIGREPANDNLEAAGVKTNEKGYIVVDKYQNTNIEGIYAVG
1gerA           AIPKAVKNTDGSLTLELEDGSETVDCLIWAIGREPANDNLEAAGVKTNEKGYIVVDKYQNTNIEGIYAVG
3fg2P           VRATEIAAEGRVTGVVLSDGTLPCDLXXXXXXXIPNVEXXXXXXXXXXXXXXV--DQQLLTSDPHISAIG
2eq6A           TKAVGYEKKKRLEPAXXXXXXXXXXXXXXXXXXRPRTEGLEKAGVKVDERGFIRVNARMETSVPGVYAIG
1xhcA           SELLE----ANEEGVLTNSGFIEGKVKICAIGIVPNVDLARRSGIHTG--RGILIDDNFRTSAKDVYAIG
1dxlA           TKVVGVSGDGVKLTVEPSAGIIEADVVLVSAGRTPFTSNLDKIGVETDKLGRILVNERFSTNVSGVYAIG
1lpfA           ARVTASEVKKKQVTVANGEQKETFDKLIVAVGRRPVTTLAADSGVTLDERGFIYVDDHCKTSVPGVFAIG
2a8xA           TKVESIAGGSQVTVTVTKDGVLKAEKVLQAIGFAPNVELDKA-GVALTDRKAIGVDD-YRTNVGHIYAIG
1ebdA           ALAEREDGVTVTYEANGETKTIDADYVLVTVGRRPNTDELEQIGIKMTNRGLIEVDQQCRTSVPNIFAIG
3ladA           ARVTGTEVKNKQVTVKEGEKSQAFDKLIVAVGRRPVTTLAADSGVTLDERGFIYVDDYCATSVPGVYAIG
2grtA           SQVKEVKGL-EVSMVTAVPGRLPVDCLLWAIGRVPNTKSLNKLGIQTDDKGHIIVDEFQNTNVKGIYAVG
1grtA           SQVKEVKGL-EVSMVTAVPGRLPVDCLLWAIGRVPNTKSLNKLGIQTDDKGHIIVDEFQNTNVKGIYAVG
1grgA           SQVKEVKGL-EVSMVTAVPGRLPVDCLLWAIGRVPNTKSLNKLGIQTDDKGHIIVDEFQNTNVKGIYAVG
1grbA           SQVKEVKGL-EVSMVTAVPGRLPVDCLLWAIGRVPNTKSLNKLGIQTDDKGHIIVDEFQNTNVKGIYAVG
1dncA           SQVKEVKGL-EVSMVTAVPGRLPVDCLLWAIGRVPNTKSLNKLGIQTDDKGHIIVDEFQNTNVKGIYAVG
3dk9A           SQVKEVKGL-EVSMVTAVPGRLPVDCLLWAIGRVPNTKSLNKLGIQTDDKGHIIVDEFQNTNVKGIYAVG
2ve2B           AKV-SLNTDGSKHVTFESGKTLDVDVVMMAIGRIPRTNDLQLVGVKLTPKGGVQVDEFSRTNVPNIYAIG
2ve2A           AKV-SLNTDGSKHVTFESGKTLDVDVVMMAIGRIPRTNDLQLVGVKLTPKGGVQVDEFSRTNVPNIYAIG
2yquA           VRVTAVVPEAKGARVELEGGVLEADRVLVAVGRRPYTESLENAGLSTDERGRIPVDEHLRTRVPHIYAIG
2eq7A           VRVTAVVPEAKGARVELEGGVLEADRVLVAVGRRPYTESLENAGLSTDERGRIPVDEHLRTRVPHIYAIG
1gsnA           SQVKEVKGL-EVSMVTAVPGRLPVDVDLLAIGRVPNTKSLNKLGIQTDDKGHIIVDEFQNTNVKGIYAVG
1tytB           AKVTK-NADGTRHVVFESGAEADYDVVMLAIGRVPRSQTLQLAGVEVAKNGAIKVDAYSKTNVDNIYAIG
1tytA           AKVTK-NADGTRHVVFESGAEADYDVVMLAIGRVPRSQTLQLAGVEVAKNGAIKVDAYSKTNVDNIYAIG
1typB           AKVTK-NADGTRHVVFESGAEADYDVVMLAIGRVPRSQTLQLAGVEVAKNGAIKVDAYSKTNVDNIYAIG
1typA           AKVTK-NADGTRHVVFESGAEADYDVVMLAIGRVPRSQTLQLAGVEVAKNGAIKVDAYSKTNVDNIYAIG
2tprA           AKVTK-NADGTRHVVFESGAEADYDVVMLAIGRVPRSQTLQLAGVEVAKNGAIKVDAYSKTNVDNIYAIG
1gxfA           AKVE-LNADGSKSVTFESGKKMDFDLVMMAIGRSPRTKDLQLQNAGVMKNGGVQVDEYSRTNVSNIYAIG
1fecB           AKVTK-NADGTRHVVFESGAEADYDVVMLAIGRVPRSQTLQLAGVEVAKNGAIKVDAYSKTNVDNIYAIG
1fecA           AKVTK-NADGTRHVVFESGAEADYDVVMLAIGRVPRSQTLQLAGVEVAKNGAIKVDAYSKTNVDNIYAIG
1feaB           AKVTK-NADGTRHVVFESGAEADYDVVMLAIGRVPRSQTLQLAGVEVAKNGAIKVDAYSKTNVDNIYAIG
1feaA           AKVTK-NADGTRHVVFESGAEADYDVVMLAIGRVPRSQTLQLAGVEVAKNGAIKVDAYSKTNVDNIYAIG
1bzlA           AKVE-LNADGSKSVTFESGKKMDFDLVMMAIGRSPRTKDLQLQNAGVMKNGGVQVDEYSRTNVSNIYAIG
1aogB           AKVE-LNADGSKSVTFESGKKMDFDLVMMAIGRSPRTKDLQLQNAGVMKNGGVQVDEYSRTNVSNIYAIG
1aogA           AKVE-LNADGSKSVTFESGKKMDFDLVMMAIGRSPRTKDLQLQNAGVMKNGGVQVDEYSRTNVSNIYAIG
1zkqA           CVPSHIKKLPTNQLQVTKEDTGTFDTVLWAIGRVPETRTLEKAGISTNPKNKIIVDAQEATSVPHIYAIG
1zdlA           CVPSHIKKLPTNQLQVTKEDTGTFDTVLWAIGRVPETRTLEKAGISTNPKNKIIVDAQEATSVPHIYAIG
1mo9A           SNVTRIEANGRVQAVPNGEMRIETDFVFLGLGEQPRSELAKILGLDLGPKGEVLVNEYLQTSVPNVYAVG
1ndaA           AKVE-LNADGSKSVTFESGKKMDFDLVMMAIGRSPRTKDLQLQNAGVMKNGGVQVDEYSRTNVSNIYAIG
1zy8A           TKVTGAKSDGKIDSIEAASGVITCDVLLVCIGRRPFTKNLEELGIELDPRGRIPVNTRFQTKIPNIYAIG
1zmdE           TKVTGAKSDGKIDSIEAASGVITCDVLLVCIGRRPFTKNLEELGIELDPRGRIPVNTRFQTKIPNIYAIG
1zmcD           TKVTGAKSDGKIDSIEAASGVITCDVLLVCIGRRPFTKNLEELGIELDPRGRIPVNTRFQTKIPNIYAIG
1zmcB           TKVTGAKSDGKIDSIEAASGVITCDVLLVCIGRRPFTKNLEELGIELDPRGRIPVNTRFQTKIPNIYAIG
1zmcA           TKVTGAKSDGKIDSIEAASGVITCDVLLVCIGRRPFTKNLEELGIELDPRGRIPVNTRFQTKIPNIYAIG
2f5zI           TKVTGAKSDGKIEAASKAE-VITCDVLLVCIGRRPFTKNLEELGIELDPRGRIPVNTRFQTKIPNIYAIG
2v6oA           CVPDEIKQLKVVDTENNKPGLLEFETVIFAVGREPQLSLCETVGVKLDKNGRVVCTDDEQTTVSNVYAIG
1onfA           ADVEIKKVSDKNLSIHLSDGRIHFDHVIYCVGRSPDTEKLEKLNVETN-NNYIVVDENQRTSVNNIYAVG
3h4kA           CVPDEIKQLKVVDTENNKPGLLEFETVIFAVGREPQLSLCETVGVKLDKNGRVVCTDDEQTTVSNVYAIG
2w0hB           LNTKITKNEDGSNHVHFNDGTEEDDQVMLAIGRVPRSQALQLAGVRTGKNGAVQVDAYSKTSVDNIYAIG
2w0hA           LNTKITKNEDGSNHVHFNDGTEEDDQVMLAIGRVPRSQALQLAGVRTGKNGAVQVDAYSKTSVDNIYAIG
2jk6A           LNTKITKNEDGSNHVHFNDGTEEDDQVMLAIGRVPRSQALQLAGVRTGKNGAVQVDAYSKTSVDNIYAIG
1gv4A           AIVQSVGVSGGRLLIKLKDGKVETDHIVTAVGLEPNVELAKTGGLEISDFGGFRVNAELQAR-SNIWVAG
3gd4B           AIVQSVGVSGGRLLIKLKDGKVETDHIVTAVGLEPNVELAKTGGLEISDFGGFRVNAELQAR-SNIWVAG
3gd4A           AIVQSVGVSGGRLLIKLKDGKVETDHIVTAVGLEPNVELAKTGGLEISDFGGFRVNAELQAR-SNIWVAG
3gd3D           AIVQSVGVSGGRLLIKLKDGKVETDHIVTAVGLEPNVELAKTGGLEISDFGGFRVNAELQAR-SNIWVAG
3gd3C           AIVQSVGVSGGRLLIKLKDGKVETDHIVTAVGLEPNVELAKTGGLEISDFGGFRVNAELQAR-SNIWVAG
3gd3B           AIVQSVGVSGGRLLIKLKDGKVETDHIVTAVGLEPNVELAKTGGLEISDFGGFRVNAELQAR-SNIWVAG
3gd3A           AIVQSVGVSGGRLLIKLKDGKVETDHIVTAVGLEPNVELAKTGGLEISDFGGFRVNAELQAR-SNIWVAG
2zzcA           IKVEQIEGRLRVVAQSTSEEIIEGEYVMLAIGRDACTRKIETVGVKINETGKIPVTDEEQTNVPYIYAIG
2zzbC           IKVEQIEGRLRVVAQSTSEEIIEGEYVMLAIGRDACTRKIETVGVKINETGKIPVTDEEQTNVPYIYAIG
2zz0B           IKVEQIEGRLRVVAQSTSEEIIEGEYVMLAIGRDACTRKIETVGVKINETGKIPVTDEEQTNVPYIYAIG
2j3nF           IKVEQIEGRLRVVAQSTSEEIIEGEYVMLAIGRDACTRKIETVGVKINETGKIPVTDEEQTNVPYIYAIG
2j3nD           IKVEQIEGRLRVVAQSTSEEIIEGEYVMLAIGRDACTRKIETVGVKINETGKIPVTDEEQTNVPYIYAIG
2j3nC           IKVEQIEGRLRVVAQSTSEEIIEGEYVMLAIGRDACTRKIETVGVKINETGKIPVTDEEQTNVPYIYAIG
2j3nB           IKVEQIEGRLRVVAQSTSEEIIEGEYVMLAIGRDACTRKIETVGVKINETGKIPVTDEEQTNVPYIYAIG
2j3nA           IKVEQIEGRLRVVAQSTSEEIIEGEYVMLAIGRDACTRKIETVGVKINETGKIPVTDEEQTNVPYIYAIG
2cfyA           IKVEQIEGRLRVVAQSTSEEIIEGEYVMLAIGRDACTRKIETVGVKINETGKIPVTDEEQTNVPYIYAIG
2hqmA           VKVEKNVTDKLKIHMNDSKSIDDVDELIWTIGRKSHLGMSENVGIKLNSHDQIIADEYQNTNVPNIYSLG
1m6iA           AIVQSVGVSSGKLLIKLKDGKVETDHIVAAVGLEPNVELAKTGGLEISDFGGFRVNAELQAR-SNIWVAG
1h6vE           TKIEQIEGRLKVTAKSTNSEETIEDTVLLAVGRDSCTRTIETVGVKINETGKIPVTDEEQTNVPYIYAIG
1h6vC           TKIEQIEGRLKVTAKSTNSEETIEDTVLLAVGRDSCTRTIETVGVKINETGKIPVTDEEQTNVPYIYAIG
1h6vB           TKIEQIEGRLKVTAKSTNSEETIEDTVLLAVGRDSCTRTIETVGVKINETGKIPVTDEEQTNVPYIYAIG
1h6vA           TKIEQIEGRLKVTAKSTNSEETIEDTVLLAVGRDSCTRTIETVGVKINETGKIPVTDEEQTNVPYIYAIG
3eanF           TKIEQIEGRLKVTAKSTNSEETIEDTVLLAVGRDSCTRTIETVGVKINETGKIPVTDEEQTNVPYIYAIG
3eanD           TKIEQIEGRLKVTAKSTNSEETIEDTVLLAVGRDSCTRTIETVGVKINETGKIPVTDEEQTNVPYIYAIG
3eanC           TKIEQIEGRLKVTAKSTNSEETIEDTVLLAVGRDSCTRTIETVGVKINETGKIPVTDEEQTNVPYIYAIG
3eanA           TKIEQIEGRLKVTAKSTNSEETIEDTVLLAVGRDSCTRTIETVGVKINETGKIPVTDEEQTNVPYIYAIG
2nvkX           TKQDDGKLLVKYKNVETGEESEDVDTVLWAKGLVDDLNLPNA-GVTV-QKDKIPVDSQEATNVANIYAVG
3dh9A           TKQDDGKLLVKYKNVETGEESEDVDTVLWAKGLVDDLNLPNA-GVTV-QKDKIPVDSQEATNVANIYAVG
3dghB           TKQDDGKLLVKYKNVETGEESEDVDTVLWAKGLVDDLNLPNA-GVTV-QKDKIPVDSQEATNVANIYAVG
3dghA           TKQDDGKLLVKYKNVETGEESEDVDTVLWAKGLVDDLNLPNA-GVTV-QKDKIPVDSQEATNVANIYAVG
2yvjA           VDLRFERSVGSVDGVVLDDGTIAADMVVV--GIXXXXXXXXXXXXXXXXXXXIFVDAYGRTTCPDVYALG
2qaeA           TKVVGGTNNGDSVSVEGKRETVTCEALLVSVGRRPFTGGLDKINVAKNERGFVKIGDHFETSIPDVYAIG
2gr3A           VDLRFERSVGSVDGVVLDDGTIAADMVVV--GIXXXXXXXXXXXXXXXXXXXIFVDAYGRTTCPDVYALG
2gqwA           VDLRFERSVGSVDGVVLDDGTIAADMVVV--GIXXXXXXXXXXXXXXXXXXXIFVDAYGRTTCPDVYALG
1d7yA           VDLRFERSVGSVDGVVLDDGTIAADMVVV--GIXXXXXXXXXXXXXXXXXXXIFVDAYGRTTCPDVYALG
3f8rB           VVVENLK-TGEIKELNVNG-------VFIEIGFDPPTDFAKSNGIETDTNGYIKVDEWMRTSVPGVFAAG
3f8rA           VVVENLK-TGEIKELNVNG-------VFIEIGFDPPTDFAKSNGIETDTNGYIKVDEWMRTSVPGVFAAG
3f8pD           VVVENLK-TGEIKELNVNG-------VFIEIGFDPPTDFAKSNGIETDTNGYIKVDEWMRTSVPGVFAAG
3f8pC           VVVENLK-TGEIKELNVNG-------VFIEIGFDPPTDFAKSNGIETDTNGYIKVDEWMRTSVPGVFAAG
3f8pB           VVVENLK-TGEIKELNVNG-------VFIEIGFDPPTDFAKSNGIETDTNGYIKVDEWMRTSVPGVFAAG
3f8pA           VVVENLK-TGEIKELNVNG-------VFIEIGFDPPTDFAKSNGIETDTNGYIKVDEWMRTSVPGVFAAG
3f8dC           VVVENLK-TGEIKELNVNG-------VFIEIGFDPPTDFAKSNGIETDTNGYIKVDEWMRTSVPGVFAAG
3f8dB           VVVENLK-TGEIKELNVNG-------VFIEIGFDPPTDFAKSNGIETDTNGYIKVDEWMRTSVPGVFAAG
3f8dA           VVVENLK-TGEIKELNVNG-------VFIEIGFDPPTDFAKSNGIETDTNGYIKVDEWMRTSVPGVFAAG
3ctyB           VKYKD-RTTGEEKLIET-------DGVFIYVGLIPQTSFLKDSGVKLDERGYIVVDSRQRTSVPGVYAAG
3ctyA           VKYKD-RTTGEEKLIET-------DGVFIYVGLIPQTSFLKDSGVKLDERGYIVVDSRQRTSVPGVYAAG
1fl2A           AQTTEVKGDGKVVGLEYRDRVIELAGIFVQIGLLPNTNWLEG-AVERNRMGEIIIDAKCETNVKGVFAAG
1ojtA           ------------------------DAVLVAAGRAPNGKLAEKAGVAVTDRGFIEVDKQMRTNVPHIYAIG
1bhyA           ------------------------DAVLVAAGRAPNGKLAEKAGVAVTDRGFIEVDKQMRTNVPHIYAIG
1hyuA           AQTTEVKGDGKVVGLEYRDRVVALAGIFVQIGLLPNTHWLEG-ALERNRMGEIIIDAKCETSVKGVFAAG
3d8xA           VALEA-KGDGKLNTKKNEETDLPVSGLFYAIGHTPATKIVAGQ-VDTDEAGYIKTPGSSLTSVPGFFAAG
2vdcG           VRVADATGRQTPQVIEGSEFTVQADLVIKALGFEPE-DLPNAFDLKVTRWGTLLVDHRTKTNMDGVFAAG
3f8rD           --------------------------VFIEIGFDPPTDFAKSNGIETDTNGYIKVDEWMRTSVPGVFAAG
3f8dD           --------------------------VFIEIGFDPPTDFAKSNGIETDTNGYIKVDEWMRTSVPGVFAAG
2q0lA           YVVEEIKGIKNTATNEKRELVVPGFFIFVGYDVN-NAVLKQSMLCKCDEYGSIVVDFSMKTNVQGLFAAG
2q0kA           YVVEEIKGIKNTATNEKRELVVPGFFIFVGYDVN-NAVLKQSMLCKCDEYGSIVVDFSMKTNVQGLFAAG
2iidA           ----------------------------------------------------------------------
1f8sA           ----------------------------------------------------------------------
3ic9C           AKARVISTIEKEDAVEVQKTTESFQYVLAATGRKANVDKLENTSIELDKKNSPLFDETLQTSVDHIFVAG
3ic9A           AKARVISTIEKEDAVEVQKTTESFQYVLAATGRKANVDKLENTSIELDKKNSPLFDETLQTSVDHIFVAG
1ps9A           VSYQKIDDDGLHVVINGETQVLAVDNVVICAGQEPNRALAQPL---------------------------
1vdcA           SVVEAY-GDGERDVLGKVKNVVTGDVLFFAIGHEPATKFLDG-GVELDSDGYVVTKPTTQTSVPGVFAAG
1reoA           ----------------------------------------------------------------------
1sezA           ----------------------------------------------------------------------
3fbsB           VRVETTR----IREIAGHADVVLADGRSIALALRITVDWIEKLGCAVGPMGSIVTDPMKQTTARGIFACG
3fbsA           VRVETTR----IREIAGHADVVLADGRSIALALRITVDWIEKLGCAVGPMGSIVTDPMKQTTARGIFACG


                         .         *         .         .         .         .         +:350
query           DVAESFHRVLKRPYWLPLGDVANKHGRTAGSVIAGREARFLGVVGTAIFKAFDLAVATTGLSLEGALKEG
3cgcA           DCATHYHVIKEIHDHIPIGTTANKQGRLAGLNMLDKRRAFKGTLGTGIIKFMNLTLARTGLNEKEAKGLH
3cgbA           DCATHYHVIKEIHDHIPIGTTANKQGRLAGLNLDKRRA-FKGTLGTGIIK-FNLTLARTGLNEKEAKGLH
2cduB           DSAAVHYNPTNSNAYIPLATNAVRQGRLVGLNLTEDKVKDMGTQSSSGLKLYGRTYVSTGINTALAKANN
2cduA           DSAAVHYNPTNSNAYIPLATNAVRQGRLVGLNLTEDKVKDMGTQSSSGLKLYGRTYVSTGINTALAKANN
2bc1A           DCATIYDNATRDTNYIALASNAVRTGIVAAHNACGTDLEGIGVQGSNGISIYGLHMVSTGLTLEKAKRLG
2bc0A           DCATIYDNATRDTNYIALASNAVRTGIVAAHNACGTDLEGIGVQGSNGISIYGLHMVSTGLTLEKAKRLG
1nhrA           DATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLG
1nhpA           DATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLG
1nhsA           DATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLG
1nhqA           DATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLG
1yqzA           DIATSHYRHVDLPASVPLAWGAHRAASIVAEQIAGNDTEFKGFLGNNIVKFFDYTFASVGVK-PNELKQ-
3iwaA           DCVTIPNLVTGKPGFFPLGSMANRQGRVIGTNLADGDATFPGAVGSWAVKLFEGSASGAGLTVEGALREG
1joaA           DATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLG
1f8wA           DATLIKYNPADTEVNIALATNAMKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLG
3ef6A           DVA-------------------------------------------------------------------
1q1wB           DCARFHSQLYDR--WVRIESVPNEQARKIAAILCGKVPR-------------------------------
1q1wA           DCARFHSQLYDR--WVRIESVPNEQARKIAAILCGKVPR-------------------------------
1q1rA           DCARFHSQLYDR--WVRIESVPNEQARKIAAILCGKVPR-------------------------------
2rabB           DI--------------------------------------------------------------------
2rabA           DI--------------------------------------------------------------------
2r9zB           DI--------------------------------------------------------------------
2r9zA           DI--------------------------------------------------------------------
1zx9A           DCTDQPQFVYVXXXXXXXXXI---------NMTGGDAALDLTAMPAVVFT--DPQVATVGYSEAEAHHDG
1zk7A           DCTDQPQFVYVXXXXXXXXXI---------NMTGGDAALDLTAMPAVVFT--DPQVATVGYSEAEAHHDG
2v3aA           DCAE------------------------------------------------------------------
1lvlA           DVAGE----------PMLAHRAMAQGEMVAEIIAGKARRFEPAAIAAVCFT-DPEVVVVGKTPEQASQQG
1gesB           D---------------------------------------------------------------------
1gesA           D---------------------------------------------------------------------
1xdiA           DCTG----------LLPLASVAAMQGRIA-----------------------------------------
1gerB           D---------------------------------------------------------------------
1gerA           D---------------------------------------------------------------------
3fg2P           DCA-------------------------------------------------------------------
2eq6A           DAA--------RPPL--LAHKAMREGLIAAENAAGKDSAFDYQVPSVVYTSPEW--AGVGLTEEEAKRAG
1xhcA           DCAEYSGII------AGTAKAAMEQARVLADILKGEPRRYNFKFRSTVFKFGKLQIAIIG----NTKGEG
1dxlA           DV--------------------------------------------------------------------
1lpfA           DVVRG----------AMLAHKASEEGVMVAERIAGHKAQ-------------------------------
2a8xA           DVNG----------LLQLAHVAEAQGVVAAETIAGAETLTLGDHRLPRATFCQPNVASFGLTEQQARNEG
1ebdA           DIVPG----------PALAHKASYEGKVAAEAIAG-----------------------------------
3ladA           DVVRG----------AMLAHKASEEGVVVAERIAGHKAQ-------------------------------
2grtA           DV--------------------------------------------------------------------
1grtA           DV--------------------------------------------------------------------
1grgA           DV--------------------------------------------------------------------
1grbA           DV--------------------------------------------------------------------
1dncA           DV--------------------------------------------------------------------
3dk9A           DV--------------------------------------------------------------------
2ve2B           DITD------------------------------------------------------------------
2ve2A           DITD------------------------------------------------------------------
2yquA           DV--------------------------------------------------------------------
2eq7A           DV--------------------------------------------------------------------
1gsnA           DV--------------------------------------------------------------------
1tytB           DVTD---RVMLTP---------------------------------------------------------
1tytA           DVTD---RVMLTP---------------------------------------------------------
1typB           DVTD---RVMLTP---------------------------------------------------------
1typA           DVTD---RVMLTP---------------------------------------------------------
2tprA           DVTD---RVMLTP---------------------------------------------------------
1gxfA           DVT---NRVMLTP---------------------------------------------------------
1fecB           DVTD---RVMLTP---------------------------------------------------------
1fecA           DVTD---RVMLTP---------------------------------------------------------
1feaB           DVTD---RVMLTP---------------------------------------------------------
1feaA           DVTD---RVMLTP---------------------------------------------------------
1bzlA           DVT---NRVMLTP---------------------------------------------------------
1aogB           DVT---NRVMLTP---------------------------------------------------------
1aogA           DVT---NRVMLTP---------------------------------------------------------
1zkqA           DVAEG------RPELTP---TAIKAGKLLAQRLFGKSSTLMDYVPTTVFT--PLEYGCVGLSEEEAV---
1zdlA           DVAEG------RPELTP---TAIKAGKLLAQRLFGKSSTLMDYVPTTVFT--PLEYGCVGLSEEEAV---
1mo9A           DL--------------------------------------------------------------------
1ndaA           DVT---NRVMLTP---------------------------------------------------------
1zy8A           DV--------------------------------------------------------------------
1zmdE           DV--------------------------------------------------------------------
1zmcD           DV--------------------------------------------------------------------
1zmcB           DV--------------------------------------------------------------------
1zmcA           DV--------------------------------------------------------------------
2f5zI           DV--------------------------------------------------------------------
2v6oA           DINAG------KPQLTPVAIQAGRY--LARRLFAGTELTDYSNVATTVFT--PLEYGACGLSEEDAIEK-
1onfA           DCC------MVKFYNVQLTPVAINAGRLLADRLFLKKTRKTNLIPTVIFS--HPPIGTIGLSEEAAIQ--
3h4kA           DINAG------KPQLTPVAIQAGRY--LARRLFAGTELTDYSNVATTVFT--PLEYGACGLSEEDAIEK-
2w0hB           DVT---NRVMLTP-------VAINEGAAFVETVFGGKPRATDHTKVACAVFSIPPIGTCGMTEEEAAK-N
2w0hA           DVT---NRVMLTP-------VAINEGAAFVETVFGGKPRATDHTKVACAVFSIPPIGTCGMTEEEAAK-N
2jk6A           DVT---NRVMLTP-------VAINEGAAFVETVFGGKPRATDHTKVACAVFSIPPIGTCGMTEEEAAK-N
1gv4A           DAA-CFYDIKLGRRRVEHHDHAVVSGRLAGENMTG-----------------------------------
3gd4B           DAA-CFYDIKLGRRRVEHHDHAVVSGRLAGENMTG-----------------------------------
3gd4A           DAA-CFYDIKLGRRRVEHHDHAVVSGRLAGENMTG-----------------------------------
3gd3D           DAA-CFYDIKLGRRRVEHHDHAVVSGRLAGENMTG-----------------------------------
3gd3C           DAA-CFYDIKLGRRRVEHHDHAVVSGRLAGENMTG-----------------------------------
3gd3B           DAA-CFYDIKLGRRRVEHHDHAVVSGRLAGENMTG-----------------------------------
3gd3A           DAA-CFYDIKLGRRRVEHHDHAVVSGRLAGENMTG-----------------------------------
2zzcA           DILED--KVELTPVAIQAGRLLAQRLYAGSTVKCDYEN-----VPTTVFT--PLEYGACGLSEEKAVEKY
2zzbC           DILED--KVELTPVAIQAGRLLAQRLYAGSTVKCDYEN-----VPTTVFT--PLEYGACGLSEEKAVEKY
2zz0B           DILED--KVELTPVAIQAGRLLAQRLYAGSTVKCDYEN-----VPTTVFT--PLEYGACGLSEEKAVEKY
2j3nF           DILED--KVELTPVAIQAGRLLAQRLYAGSTVKCDYEN-----VPTTVFT--PLEYGACGLSEEKAVEKY
2j3nD           DILED--KVELTPVAIQAGRLLAQRLYAGSTVKCDYEN-----VPTTVFT--PLEYGACGLSEEKAVEKY
2j3nC           DILED--KVELTPVAIQAGRLLAQRLYAGSTVKCDYEN-----VPTTVFT--PLEYGACGLSEEKAVEKY
2j3nB           DILED--KVELTPVAIQAGRLLAQRLYAGSTVKCDYEN-----VPTTVFT--PLEYGACGLSEEKAVEKY
2j3nA           DILED--KVELTPVAIQAGRLLAQRLYAGSTVKCDYEN-----VPTTVFT--PLEYGACGLSEEKAVEKY
2cfyA           DILED--KVELTPVAIQAGRLLAQRLYAGSTVKCDYEN-----VPTTVFT--PLEYGACGLSEEKAVEKY
2hqmA           DV--------------------------------------------------------------------
1m6iA           DAA-CFYDIKLGRRRVEHHDHAVVSGRLAGENMTG-----------------------------------
1h6vE           DILE------------------------------------------------------------------
1h6vC           DILE------------------------------------------------------------------
1h6vB           DILE------------------------------------------------------------------
1h6vA           DILE------------------------------------------------------------------
3eanF           DILE------------------------------------------------------------------
3eanD           DILE------------------------------------------------------------------
3eanC           DILE------------------------------------------------------------------
3eanA           DILE------------------------------------------------------------------
2nvkX           DI--------------------------------------------------------------------
3dh9A           DI--------------------------------------------------------------------
3dghB           DI--------------------------------------------------------------------
3dghA           DI--------------------------------------------------------------------
2yvjA           DV--------------------------------------------------------------------
2qaeA           DVVD------KGPM---LAHKAEDEGVACAEILAGKPGHVYGVIPAVIYTMPE--VASVGKSEDELKKEG
2gr3A           DV--------------------------------------------------------------------
2gqwA           DV--------------------------------------------------------------------
1d7yA           DV--------------------------------------------------------------------
3f8rB           DCTSAW----------------------------------------------------------------
3f8rA           DCTSAW----------------------------------------------------------------
3f8pD           DCTSAW----------------------------------------------------------------
3f8pC           DCTSAW----------------------------------------------------------------
3f8pB           DCTSAW----------------------------------------------------------------
3f8pA           DCTSAW----------------------------------------------------------------
3f8dC           DCTSAW----------------------------------------------------------------
3f8dB           DCTSAW----------------------------------------------------------------
3f8dA           DCTSAW----------------------------------------------------------------
3ctyB           DV--------------------------------------------------------------------
3ctyA           DV--------------------------------------------------------------------
1fl2A           D---------------------------------------------------------------------
1ojtA           DI--------------------------------------------------------------------
1bhyA           DI--------------------------------------------------------------------
1hyuA           D---------------------------------------------------------------------
3d8xA           DVQDSKYR--------------------------------------------------------------
2vdcG           DI--------------------------------------------------------------------
3f8rD           DCTSAW----------------------------------------------------------------
3f8dD           DCTSAW----------------------------------------------------------------
2q0lA           DI--------------------------------------------------------------------
2q0kA           DI--------------------------------------------------------------------
2iidA           ----------------------------------------------------------------------
1f8sA           ----------------------------------------------------------------------
3ic9C           DANNT----------LTLLHEAADDGKVAGTIAQGQRRAPLSVVFT------EPQVASVGLSLRQI--ED
3ic9A           DANNT----------LTLLHEAADDGKVAGTIAQGQRRAPLSVVFT------EPQVASVGLSLRQI--ED
1ps9A           ----------------------------------------------------------------------
1vdcA           DVQDKKYR--------------------------------------------------------------
1reoA           ----------------------------------------------------------------------
1sezA           ----------------------------------------------------------------------
3fbsB           DVA-------------------------------------------------------------------
3fbsA           DVA-------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           FWAKKVFIQSRDGAHYYPGSGPLWVELVYEEGTGRLLGGAVVARGHGALRIDVLAALLHREGSVEXXXXX
3cgcA           IPYKTVKVDSTNMAGYYPNAKPLYLKLLYRSDTKQLLGGQVIGEEGVDKRIDVIAMALFNKMSIHDLEDV
3cgbA           IPYKTVKVDSTN-AGYYPNAKPLYLKLLYRSDTKQLLGGQVIGEEGVDKRIDVIAALFNK--SIHDLEDV
2cduB           LKVSEVIIADNYRPEFMLSTDEVLMSLVYDPKTRVILGGALSSMHDVSQSANVLSVCIQNKNTIDDLAMV
2cduA           LKVSEVIIADNYRPEFMLSTDEVLMSLVYDPKTRVILGGALSSMHDVSQSANVLSVCIQNKNTIDDLAMV
2bc1A           FDAAVTYTDNQKPEFIEHGNFPVTIKIVYDKDSRRILGAQMAAREDVSMGIHMFSLAIQEGVTIEKLALT
2bc0A           FDAAVTYTDNQKPEFIEHGNFPVTIKIVYDKDSRRILGAQMAAREDVSMGIHMFSLAIQEGVTIEKLALT
1nhrA           KETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYA
1nhpA           KETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYA
1nhsA           KETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYA
1nhqA           KETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYA
1yqzA           FDYKMVEVTQGAHANYYPGNSPLHLRVYYDTSNRQILRAAAVGKEGADKRIDVLSMAMMNQLTVDELTEF
3iwaA           YDAVNVHVEQ-----------IMTLQLVVDRPTRRVLGIQGFSTLGDALRINAVATMLASKPTVE-----
1joaA           KETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYA
1f8wA           KETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYA
3ef6A           ----------------------------------------------------------------------
1q1wB           ----------------------------------------------------------------------
1q1wA           ----------------------------------------------------------------------
1q1rA           ----------------------------------------------------------------------
2rabB           ----------------------------------------------------------------------
2rabA           ----------------------------------------------------------------------
2r9zB           ----------------------------------------------------------------------
2r9zA           ----------------------------------------------------------------------
1zx9A           IETDSRTLTPRALANFDTRG---FIKLVIEEGSHRLIGVQAVAPEAGELIQTAALAIRNR----------
1zk7A           IETDSRTLTPRALANFDTRG---FIKLVIEEGSHRLIGVQAVAPEAGELIQTAALAIRNR----------
2v3aA           ----------------------------------------------------------------------
1lvlA           ----------------------------------------------------------------------
1gesB           ----------------------------------------------------------------------
1gesA           ----------------------------------------------------------------------
1xdiA           ----------------------------------------------------------------------
1gerB           ----------------------------------------------------------------------
1gerA           ----------------------------------------------------------------------
3fg2P           ----------------------------------------------------------------------
2eq6A           YKVKGKFPLAASGRALTLGGAEGMVKVVGDEETDLLLGVFIV----------------------------
1xhcA           KWIEKVF---------------------------------------------------------------
1dxlA           ----------------------------------------------------------------------
1lpfA           ----------------------------------------------------------------------
2a8xA           Y---------------------------------------------------------------------
1ebdA           ----------------------------------------------------------------------
3ladA           ----------------------------------------------------------------------
2grtA           ----------------------------------------------------------------------
1grtA           ----------------------------------------------------------------------
1grgA           ----------------------------------------------------------------------
1grbA           ----------------------------------------------------------------------
1dncA           ----------------------------------------------------------------------
3dk9A           ----------------------------------------------------------------------
2ve2B           ----------------------------------------------------------------------
2ve2A           ----------------------------------------------------------------------
2yquA           ----------------------------------------------------------------------
2eq7A           ----------------------------------------------------------------------
1gsnA           ----------------------------------------------------------------------
1tytB           ----------------------------------------------------------------------
1tytA           ----------------------------------------------------------------------
1typB           ----------------------------------------------------------------------
1typA           ----------------------------------------------------------------------
2tprA           ----------------------------------------------------------------------
1gxfA           ----------------------------------------------------------------------
1fecB           ----------------------------------------------------------------------
1fecA           ----------------------------------------------------------------------
1feaB           ----------------------------------------------------------------------
1feaA           ----------------------------------------------------------------------
1bzlA           ----------------------------------------------------------------------
1aogB           ----------------------------------------------------------------------
1aogA           ----------------------------------------------------------------------
1zkqA           ----------------------------------------------------------------------
1zdlA           ----------------------------------------------------------------------
1mo9A           ----------------------------------------------------------------------
1ndaA           ----------------------------------------------------------------------
1zy8A           ----------------------------------------------------------------------
1zmdE           ----------------------------------------------------------------------
1zmcD           ----------------------------------------------------------------------
1zmcB           ----------------------------------------------------------------------
1zmcA           ----------------------------------------------------------------------
2f5zI           ----------------------------------------------------------------------
2v6oA           ----------------------------------------------------------------------
1onfA           ----------------------------------------------------------------------
3h4kA           ----------------------------------------------------------------------
2w0hB           YETVAVYASSTPLMHNISGSKEFMIRIITNESNGEVLG--------------------------------
2w0hA           YETVAVYASSTPLMHNISGSKEFMIRIITNESNGEVLG--------------------------------
2jk6A           YETVAVYASSTPLMHNISGSKEFMIRIITNESNGEVLG--------------------------------
1gv4A           ----------------------------------------------------------------------
3gd4B           ----------------------------------------------------------------------
3gd4A           ----------------------------------------------------------------------
3gd3D           ----------------------------------------------------------------------
3gd3C           ----------------------------------------------------------------------
3gd3B           ----------------------------------------------------------------------
3gd3A           ----------------------------------------------------------------------
2zzcA           FWPLEWTIPSRDNNKCY-----------------------------------------------------
2zzbC           FWPLEWTIPSRDNNKCY-----------------------------------------------------
2zz0B           FWPLEWTIPSRDNNKCY-----------------------------------------------------
2j3nF           FWPLEWTIPSRDNNKCY-----------------------------------------------------
2j3nD           FWPLEWTIPSRDNNKCY-----------------------------------------------------
2j3nC           FWPLEWTIPSRDNNKCY-----------------------------------------------------
2j3nB           FWPLEWTIPSRDNNKCY-----------------------------------------------------
2j3nA           FWPLEWTIPSRDNNKCY-----------------------------------------------------
2cfyA           FWPLEWTIPSRDNNKCY-----------------------------------------------------
2hqmA           ----------------------------------------------------------------------
1m6iA           ----------------------------------------------------------------------
1h6vE           ----------------------------------------------------------------------
1h6vC           ----------------------------------------------------------------------
1h6vB           ----------------------------------------------------------------------
1h6vA           ----------------------------------------------------------------------
3eanF           ----------------------------------------------------------------------
3eanD           ----------------------------------------------------------------------
3eanC           ----------------------------------------------------------------------
3eanA           ----------------------------------------------------------------------
2nvkX           ----------------------------------------------------------------------
3dh9A           ----------------------------------------------------------------------
3dghB           ----------------------------------------------------------------------
3dghA           ----------------------------------------------------------------------
2yvjA           ----------------------------------------------------------------------
2qaeA           V-AYKVFPFNANSRAKAVSTEDGFVKVLVDKATDRILGVHIVCTTAGEL---------------------
2gr3A           ----------------------------------------------------------------------
2gqwA           ----------------------------------------------------------------------
1d7yA           ----------------------------------------------------------------------
3f8rB           ----------------------------------------------------------------------
3f8rA           ----------------------------------------------------------------------
3f8pD           ----------------------------------------------------------------------
3f8pC           ----------------------------------------------------------------------
3f8pB           ----------------------------------------------------------------------
3f8pA           ----------------------------------------------------------------------
3f8dC           ----------------------------------------------------------------------
3f8dB           ----------------------------------------------------------------------
3f8dA           ----------------------------------------------------------------------
3ctyB           ----------------------------------------------------------------------
3ctyA           ----------------------------------------------------------------------
1fl2A           ----------------------------------------------------------------------
1ojtA           ----------------------------------------------------------------------
1bhyA           ----------------------------------------------------------------------
1hyuA           ----------------------------------------------------------------------
3d8xA           ----------------------------------------------------------------------
2vdcG           ----------------------------------------------------------------------
3f8rD           ----------------------------------------------------------------------
3f8dD           ----------------------------------------------------------------------
2q0lA           ----------------------------------------------------------------------
2q0kA           ----------------------------------------------------------------------
2iidA           ----------------------------------------------------------------------
1f8sA           ----------------------------------------------------------------------
3ic9C           LYA------DQDAANYVVGQ-------VSFEGQGR-----------------------------------
3ic9A           LYA------DQDAANYVVGQ-------VSFEGQGR-----------------------------------
1ps9A           ----------------------------------------------------------------------
1vdcA           ----------------------------------------------------------------------
1reoA           ----------------------------------------------------------------------
1sezA           ----------------------------------------------------------------------
3fbsB           ----------------------------------------------------------------------
3fbsA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           XXXYAPPFSPVWDPLLIAAQQAR
3cgcA           DLSYAPPYNSVWDPIQQAARRA-
3cgbA           DLSYAPPYNSVWDPIQQAARRA-
2cduB           DMLFQPQFDRPFNYLNILGQAAQ
2cduA           DMLFQPQFDRPFNYLNILGQAAQ
2bc1A           DIFFLPHFNKPYNYITMAALGAK
2bc0A           DIFFLPHFNKPYNYITMAALGAK
1nhrA           DFFFQPAFDKPWNIINTAALEA-
1nhpA           DFFFQPAFDKPWNIINTAALEA-
1nhsA           DFFFQPAFDKPWNIINTAALEA-
1nhqA           DFFFQPAFDKPWNIINTAALEA-
1yqzA           EVAYAPPYSHPKDLINMIGYKAK
3iwaA           -----------------------
1joaA           DFFFQPAFDKPWNIINTAALEA-
1f8wA           DFFFQPAFDKPWNIINTAALEA-
3ef6A           -----------------------
1q1wB           -----------------------
1q1wA           -----------------------
1q1rA           -----------------------
2rabB           -----------------------
2rabA           -----------------------
2r9zB           -----------------------
2r9zA           -----------------------
1zx9A           -----------------------
1zk7A           -----------------------
2v3aA           -----------------------
1lvlA           -----------------------
1gesB           -----------------------
1gesA           -----------------------
1xdiA           -----------------------
1gerB           -----------------------
1gerA           -----------------------
3fg2P           -----------------------
2eq6A           -----------------------
1xhcA           -----------------------
1dxlA           -----------------------
1lpfA           -----------------------
2a8xA           -----------------------
1ebdA           -----------------------
3ladA           -----------------------
2grtA           -----------------------
1grtA           -----------------------
1grgA           -----------------------
1grbA           -----------------------
1dncA           -----------------------
3dk9A           -----------------------
2ve2B           -----------------------
2ve2A           -----------------------
2yquA           -----------------------
2eq7A           -----------------------
1gsnA           -----------------------
1tytB           -----------------------
1tytA           -----------------------
1typB           -----------------------
1typA           -----------------------
2tprA           -----------------------
1gxfA           -----------------------
1fecB           -----------------------
1fecA           -----------------------
1feaB           -----------------------
1feaA           -----------------------
1bzlA           -----------------------
1aogB           -----------------------
1aogA           -----------------------
1zkqA           -----------------------
1zdlA           -----------------------
1mo9A           -----------------------
1ndaA           -----------------------
1zy8A           -----------------------
1zmdE           -----------------------
1zmcD           -----------------------
1zmcB           -----------------------
1zmcA           -----------------------
2f5zI           -----------------------
2v6oA           -----------------------
1onfA           -----------------------
3h4kA           -----------------------
2w0hB           -----------------------
2w0hA           -----------------------
2jk6A           -----------------------
1gv4A           -----------------------
3gd4B           -----------------------
3gd4A           -----------------------
3gd3D           -----------------------
3gd3C           -----------------------
3gd3B           -----------------------
3gd3A           -----------------------
2zzcA           -----------------------
2zzbC           -----------------------
2zz0B           -----------------------
2j3nF           -----------------------
2j3nD           -----------------------
2j3nC           -----------------------
2j3nB           -----------------------
2j3nA           -----------------------
2cfyA           -----------------------
2hqmA           -----------------------
1m6iA           -----------------------
1h6vE           -----------------------
1h6vC           -----------------------
1h6vB           -----------------------
1h6vA           -----------------------
3eanF           -----------------------
3eanD           -----------------------
3eanC           -----------------------
3eanA           -----------------------
2nvkX           -----------------------
3dh9A           -----------------------
3dghB           -----------------------
3dghA           -----------------------
2yvjA           -----------------------
2qaeA           -----------------------
2gr3A           -----------------------
2gqwA           -----------------------
1d7yA           -----------------------
3f8rB           -----------------------
3f8rA           -----------------------
3f8pD           -----------------------
3f8pC           -----------------------
3f8pB           -----------------------
3f8pA           -----------------------
3f8dC           -----------------------
3f8dB           -----------------------
3f8dA           -----------------------
3ctyB           -----------------------
3ctyA           -----------------------
1fl2A           -----------------------
1ojtA           -----------------------
1bhyA           -----------------------
1hyuA           -----------------------
3d8xA           -----------------------
2vdcG           -----------------------
3f8rD           -----------------------
3f8dD           -----------------------
2q0lA           -----------------------
2q0kA           -----------------------
2iidA           -----------------------
1f8sA           -----------------------
3ic9C           -----------------------
3ic9A           -----------------------
1ps9A           -----------------------
1vdcA           -----------------------
1reoA           -----------------------
1sezA           -----------------------
3fbsB           -----------------------
3fbsA           -----------------------