[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tthe0:pilT.2

[Show Plain Result]

#ERROR : Can't open dsspfile "2ewvA.bssp"
#ERROR : Can't open dsspfile "2ewwA.bssp"
#ERROR : Can't open dsspfile "2eyuA.bssp"
#ERROR : Can't open dsspfile "1p9wA.bssp"
#ERROR : Can't open dsspfile "1p9rA.bssp"
#ERROR : Can't open dsspfile "2pt7C.bssp"
#ERROR : Can't open dsspfile "2pt7B.bssp"
#ERROR : Can't open dsspfile "2pt7A.bssp"
#ERROR : Can't open dsspfile "2oap1.bssp"
#ERROR : Can't open dsspfile "1nlzE.bssp"
#ERROR : Can't open dsspfile "1nlzD.bssp"
#ERROR : Can't open dsspfile "1nlzC.bssp"
#ERROR : Can't open dsspfile "1nlzB.bssp"
#ERROR : Can't open dsspfile "1g6oA.bssp"
#ERROR : Can't open dsspfile "2oap2.bssp"
#ERROR : Can't open dsspfile "2gzaA.bssp"
#ERROR : Can't open dsspfile "2gzaC.bssp"
#ERROR : Can't open dsspfile "2gzaB.bssp"

## Summary of PDB Search
:361
    2e-96  55%  2ewvA  [x.x.x] TWITCHING MOTILITY PROTEIN PILT
    9e-87  55%  2ewwA  [x.x.x] TWITCHING MOTILITY PROTEIN PILT
    2e-63  57%  2eyuA  [x.x.x] TWITCHING MOTILITY PROTEIN PILT
    4e-21  42%  1p9wA  [c.37.1] GENERAL SECRETION PATHWAY PROTEIN E
    4e-21  42%  1p9rA  [c.37.1] GENERAL SECRETION PATHWAY PROTEIN E
    7e-10  29%  2pt7C  [x.x.x] CAG-ALFA
    7e-10  29%  2pt7B  [x.x.x] CAG-ALFA
    7e-10  29%  2pt7A  [x.x.x] CAG-ALFA
    3e-08  33%  2oap1  [x.x.x] TYPE II SECRETION SYSTEM PROTEIN
    1e-07  30%  1nlzE  [c.37.1] VIRB11 HOMOLOG
    1e-07  30%  1nlzD  [c.37.1] VIRB11 HOMOLOG
    1e-07  30%  1nlzC  [c.37.1] VIRB11 HOMOLOG
    1e-07  30%  1nlzB  [c.37.1] VIRB11 HOMOLOG
    1e-07  30%  1g6oA  [c.37.1] CAG-ALPHA
    1e-06  34%  2oap2  [x.x.x] TYPE II SECRETION SYSTEM PROTEIN
    2e-04  26%  2gzaA  [x.x.x] TYPE IV SECRETION SYSTEM PROTEIN VIRB11
    3e-04  25%  2gzaC  [x.x.x] TYPE IV SECRETION SYSTEM PROTEIN VIRB11
    3e-04  25%  2gzaB  [x.x.x] TYPE IV SECRETION SYSTEM PROTEIN VIRB11
:361

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxGASDLVITVGLPPMLKIDGEFHPTEYEPLTPQETRRLMYALMDEKQQRIFEEE
2ewvA           -----------------GASDIHLTAGAPPAVRIDGYIKLKDFPRLTPEDTQKLAYSVMSEKHRQKLEEN
2ewwA           -----------------GASDIHLTAGAPPAVRIDGYIKLKDFPRLTPEDTQKLAYSVSEKHRQKL-EEN
2eyuA           ----------------------------------------------------------------------
1p9wA           ----------------------------------------------------------------------
1p9rA           ----------------------------------------------------------------------
2pt7C           ---------------------------------------------------------------------D
2pt7B           ---------------------------------------------------------------------D
2pt7A           ---------------------------------------------------------------------D
2oap1           ----------------------------------------------------------------------
1nlzE           ---------------------------------------------------------------------D
1nlzD           ---------------------------------------------------------------------D
1nlzC           ---------------------------------------------------------------------D
1nlzB           ---------------------------------------------------------------------D
1g6oA           ---------------------------------------------------------------------D
2oap2           ----------------------------------------------------------------------
2gzaA           ----------------------------------------------------------------------
2gzaC           ----------------------------------------------------------------------
2gzaB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KELDFSFSLPGKGRYRVNVFLQRGSVGGVLRVVPSAVKSFEELGLPKNIAEIAMSPRGLVLVTGPTGSGK
2ewvA           GQVDFSFGVRGVGRFRANVFYQRGSVAAALRSLPAEIPEFKKLGLPDKVLELCHRKMGLILVTGPTGSGK
2ewwA           GQVDFSFGVRGVGRFRANVFYQRGSVAAALRSLPAEIPEFKKLGLPDKVLELCHR-KGLILVTGPTGSGK
2eyuA           ---------------------------------------FKKLGLPDKVLELCHR-KGLILVTGPTGSGK
1p9wA           -----------------------------------------------NFRRLIKRPHGIILVTGPTGSGK
1p9rA           -----------------------------------------------NFRRLIKRPHGIILVTGPTGSGK
2pt7C           ETISISIRIPSKTTYPHSFFEEQGFYN-LLDNKEQAISAIKDIAIGKN-----------VIVCGGTGSGK
2pt7B           ETISISIRIPSKTTYPHSFFEEQGFYN-LLDNKEQAISAIKDIAIGKN-----------VIVCGGTGSGK
2pt7A           ETISISIRIPSKTTYPHSFFEEQGFYN-LLDNKEQAISAIKDIAIGKN-----------VIVCGGTGSGK
2oap1           ---------------------------------------------------LAIEHKFSAIVVGETASGK
1nlzE           ETISISIRIPSKTTYPHSFFEEQGFYN-LLDNKEQAISAIKDIAIGKN-----------VIVCGGTGSGK
1nlzD           ETISISIRIPSKTTYPHSFFEEQGFYN-LLDNKEQAISAIKDIAIGKN-----------VIVCGGTGSGK
1nlzC           ETISISIRIPSKTTYPHSFFEEQGFYN-LLDNKEQAISAIKDIAIGKN-----------VIVCGGTGSGK
1nlzB           ETISISIRIPSKTTYPHSFFEEQGFYN-LLDNKEQAISAIKDIAIGKN-----------VIVCGGTGSGK
1g6oA           ETISISIRIPSKTTYPHSFFEEQGFYN-LLDNKEQAISAIKDIAIGKN-----------VIVCGGTGSGK
2oap2           ---------------------------------------------------LAIEHKFSAIVVGETASGK
2gzaA           --------------------------------------ALKEAGDYMSFLRRAVQLERVIVVAGETGSGK
2gzaC           --------------------------------------ALKEAGDYMSFLRRAVQLERVIVVAGETGSGK
2gzaB           --------------------------------------ALKEAGDYMSFLRRAVQLERVIVVAGETGSGK


                         +         .         .         .         .         *         .:210
query           STTLASMIDYINERKACHIVTIEDPIEFFHKHKRAIVNQREIGSDTKSFHKALRSVLRQAPDVILVGEMR
2ewvA           STTIASMIDYINQTKSYHIITIEDPIEYVFKHKKSIVNQREVGEDTKSFADALRAALREDPDVIFVGEMR
2ewwA           STTIAS-IDYINQTKSYHIITIEDPIEYVFKHKKSIVNQREVGEDTKSFADALRAALREDPDVIFVGE-R
2eyuA           STTIAS-IDYINQTKSYHIITIEDPIEYVFKHKKSIVNQREVGEDTKSFADALRAALREDPDVIFVGE-R
1p9wA           STTLYAGLQELNSSER-NILTVEDPIEFDIDG----IGQTQVNPRVDTFARGLRAILRQDPDVV-VGEIR
1p9rA           STTLYAGLQELNSSER-NILTVEDPIEFDIDG----IGQTQVNPRVDTFARGLRAILRQDPDVV-VGEIR
2pt7C           TTYIKSIMEFIPKEE--RIISIEDTEEIVFKHHKNYTQLFFGGNITSA--DCLKSCLRMRPDRIILGELR
2pt7B           TTYIKSIMEFIPKEE--RIISIEDTEEIVFKHHKNYTQLFFGGNITSA--DCLKSCLRMRPDRIILGELR
2pt7A           TTYIKSIMEFIPKEE--RIISIEDTEEIVFKHHKNYTQLFFGGNITSA--DCLKSCLRMRPDRIILGELR
2oap1           TTTLNAIFIPPDAK----VVSIEDTREIKLYHENWIAEVTRTGGEGEIDYDLLRAALRQRPDYIIVGEVR
1nlzE           TTYIKS-IEFIPKEE--RIISIEDTEEIVFKHHKNYTQLFFGGNITSA--DCLKSCLRR-PDRIILGELR
1nlzD           TTYIKS-IEFIPKEE--RIISIEDTEEIVFKHHKNYTQLFFGGNITSA--DCLKSCLRR-PDRIILGELR
1nlzC           TTYIKS-IEFIPKEE--RIISIEDTEEIVFKHHKNYTQLFFGGNITSA--DCLKSCLRR-PDRIILGELR
1nlzB           TTYIKS-IEFIPKEE--RIISIEDTEEIVFKHHKNYTQLFFGGNITSA--DCLKSCLRR-PDRIILGELR
1g6oA           TTYIKS-IEFIPKEE--RIISIEDTEEIVFKHHKNYTQLFFGGNITSA--DCLKSCLRR-PDRIILGELR
2oap2           TTTLNAIFIPPDAK----VVSIEDTREIKLYHENWIAEVTRTGEID---YDLLRAALRQRPDYIIVGEVR
2gzaA           TTLMKALMQEIPFDQ--RLITIEDPELFLPDHPNHVHLFYPVTAAT-----LLRSCLRMKPTRILLAELR
2gzaC           TTLMKALMQEIPFDQ--RLITIEDVPELFLPDH---PNHVHLFYPPVTAATLLRSCLRMKPTRILLAELR
2gzaB           TTLMKALMQEIPFDQ--RLITIEDVPELFLPDH---PNHVHLFYPPVTAATLLRSCLRMKPTRILLAELR


                         .         .         .         +         .         .         .:280
query           DYXXXXXXXXXXXXGHLVMGTLHTNSAPETIDRIVDVFPENQQEQVRVQLSNNLVAVLTQQLLPKAFGGG
2ewvA           DLETVETALRAAETGHLVFGTLHTNTAIDTIHRIVDIFPLNQQEQVRIVLSFILQGIISQRLLPK-IGGG
2ewwA           DLETVETALRAAETGHLVFGTLHTNTAIDTIHRIVDIFPLNQQEQVRIVLSFILQGIISQRLLPK-IGGG
2eyuA           DLETVETALRAAETGHLVFGTLHTNTAIDTIHRIVDIFPLNQQEQVRIVLSFILQGIISQRLLPK-IGGG
1p9wA           DLETAQIAVQASLTGHLV-STLHTNTAVGAVTRLRDGIEP-------FLISSSLLGVLAQRLV-------
1p9rA           DLETAQIAVQASLTGHLV-STLHTNTAVGAVTRLRDGIEP-------FLISSSLLGVLAQRLV-------
2pt7C           SSEAYDFYNVLCSGHKGTLTTLHAGSSEEAFIRL------------------------------------
2pt7B           SSEAYDFYNVLCSGHKGTLTTLHAGSSEEAFIRL------------------------------------
2pt7A           SSEAYDFYNVLCSGHKGTLTTLHAGSSEEAFIRL------------------------------------
2oap1           --GREAQTLFQASTGHASYSTLH-----------------------------------------------
1nlzE           SSEAYDFYNVLCSGHKGTLTTLHAGSSEEAFIRL------------------------------------
1nlzD           SSEAYDFYNVLCSGHKGTLTTLHAGSSEEAFIRL------------------------------------
1nlzC           SSEAYDFYNVLCSGHKGTLTTLHAGSSEEAFIRL------------------------------------
1nlzB           SSEAYDFYNVLCSGHKGTLTTLHAGSSEEAFIRL------------------------------------
1g6oA           SSEAYDFYNVLCSGHKGTLTTLHAGSSEEAFIRL------------------------------------
2oap2           --GREAQTLFQASTGHASYSTLH-----------------------------------------------
2gzaA           GGEAYDFINVAASGHGGSITSCHAGSCELTFERLALMVLQNRQ---------------------------
2gzaC           GGEAYDFINVAASGHGGSITSCHAGSCELTFERLALMVLQNRQ---------------------------
2gzaB           GGEAYDFINVAASGHGGSITSCHAGSCELTFERLALMVLQNRQ---------------------------


                         .         *         .         .         .         .         +:350
query           RVLAYELMIATPAVRALIREGKTHQLRSVIQTGGQYGMITMDACLADLYRRKLITYEMGLARAVDPKEFM
2ewvA           RVLAYELLIPNTAIRNLIRENKLQQVYSLMQ------MQTMNQTLYKLYKQGLITLEDAMEASPDPKELE
2ewwA           RVLAYELLIPNTAIRNLIRENKLQQVYSLQQT---------NQTLYKLYKQGLITLEDAEA-SPDPKELE
2eyuA           RVLAYGLLIPNTAIRNLIRENKLQQVYSL--QSGQAETGQTNQTLYKLYKQGLITLEDAEA-SPDPKELE
1p9wA           ----------------------------------------------------------------------
1p9rA           ----------------------------------------------------------------------
2pt7C           ----------------------------------------------------------------------
2pt7B           ----------------------------------------------------------------------
2pt7A           ----------------------------------------------------------------------
2oap1           ----------------------------------------------------------------------
1nlzE           ----------------------------------------------------------------------
1nlzD           ----------------------------------------------------------------------
1nlzC           ----------------------------------------------------------------------
1nlzB           ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
2oap2           ----------------------------------------------------------------------
2gzaA           ----------------------------------------------------------------------
2gzaC           ----------------------------------------------------------------------
2gzaB           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           RLxxxxxxxxx
2ewvA           RM---------
2ewwA           R----------
2eyuA           RI---------
1p9wA           -----------
1p9rA           -----------
2pt7C           -----------
2pt7B           -----------
2pt7A           -----------
2oap1           -----------
1nlzE           -----------
1nlzD           -----------
1nlzC           -----------
1nlzB           -----------
1g6oA           -----------
2oap2           -----------
2gzaA           -----------
2gzaC           -----------
2gzaB           -----------