[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tthe0:AAS81982.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1o5zA.bssp"
#ERROR : Can't open dsspfile "1jbwA.bssp"
#ERROR : Can't open dsspfile "1w7kA.bssp"
#ERROR : Can't open dsspfile "1w78A.bssp"
#ERROR : Can't open dsspfile "2gcaA.bssp"
#ERROR : Can't open dsspfile "1jbvA.bssp"
#ERROR : Can't open dsspfile "2gcbA.bssp"
#ERROR : Can't open dsspfile "2gc5A.bssp"
#ERROR : Can't open dsspfile "2gc6A.bssp"
#ERROR : Can't open dsspfile "1fgsA.bssp"
#ERROR : Can't open dsspfile "2vorA.bssp"
#ERROR : Can't open dsspfile "2vosA.bssp"

## Summary of PDB Search
:414
    2e-56  39%  1o5zA  [c.72.2 - c.59.1] FOLYLPOLYGLUTAMATE SYNTHASE/DIHYDROFOLATE
    2e-39  34%  1jbwA  [c.72.2 - c.59.1] FOLYLPOLYGLUTAMATE SYNTHASE
    9e-38  36%  1w7kA  [x.x.x] FOLC BIFUNCTIONAL PROTEIN
    8e-37  37%  1w78A  [x.x.x] FOLC BIFUNCTIONAL PROTEIN
    2e-36  33%  2gcaA  [x.x.x] FOLYLPOLYGLUTAMATE SYNTHASE
    4e-36  34%  1jbvA  [c.72.2 - c.59.1] FOLYLPOLYGLUTAMATE SYNTHASE
    4e-35  33%  2gcbA  [x.x.x] FOLYLPOLYGLUTAMATE SYNTHASE
    2e-34  33%  2gc5A  [x.x.x] FOLYLPOLYGLUTAMATE SYNTHASE
    4e-34  33%  2gc6A  [x.x.x] FOLYLPOLYGLUTAMATE SYNTHASE
    2e-30  32%  1fgsA  [x.x.x] FOLYLPOLYGLUTAMATE SYNTHETASE
    7e-19  30%  2vorA  [x.x.x] FOLYLPOLYGLUTAMATE SYNTHASE PROTEIN FOLC
    7e-17  32%  2vosA  [x.x.x] FOLYLPOLYGLUTAMATE SYNTHASE PROTEIN FOLC
:414

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDPLSWLYARQGRFAPGLERIRALLARLGHPEEAYPVALVGGTNGKGTTARTLAAILEEAGFRVGLYTSP
1o5zA           LEVLRYLYHK---VKPGLERISMLLSKLGNPHLEYKTIHIGGTNGKGSVANMVSNILVSQGYRVGSYYSP
1jbwA           -------------------RILTLLHALGNPQQQGRYIHVTGTNGKGSAANAIAHVLEASGLTVGLYTSP
1w7kA           ----SWLSYLENLIDLGLERVSLVAARLGVLKPAPFVFTVAGTNGKGTTCRTLESILMAAGYKVGVYSSP
1w78A           ----------------GLERVSLVAARLGVLKPAPFVFTVAGTNGKGTTCRTLESILMAAGYKVGVYSSP
2gcaA           -------------------RILTLLHALGNPQQQGRYIHVTGTNGKGSAANAIAHVLEASGLTVGLYTSP
1jbvA           -------------------RILTLLHALGNPQQQGRYIHVTGTNGKGSAANAIAHVLEASGLTVGLYTSP
2gcbA           -------------------RILTLLHALGNPQQQGRYIHVTGTNGKSTAANAIAHVLEASGLTVGLYTSP
2gc5A           ------------RLAKDHRRILTLLHALGNPQQQGRYIHVTGTNGKSSAANAIAHVLEASGLTVGLYTSP
2gc6A           -------------------RILTLLHALGNPQQQGRYIHVTGTNGKGSAANAIAHVLEASGLTVGLYTAP
1fgsA           ------------RLAGDHRRILTLLHALGNPQQQGRYIHVTGTNGKGSAANAIAHVLEASGLTVGLYTSP
2vorA           ---------------PSLTRISALMDLLGSPQRSYPSIHIAGTNGKTSVARMVDALVTALHRRTGRTTSP
2vosA           ------LLDQRWRIDPSLTRISAL-DLLGSPQRSYPSIHIAGTNGKTSVAR-VDALVTALHRRTGRTTSP


                         .         .         *         .         .         .         .:140
query           HLVDFRERIQVQGRPIXXXXXXXXXXXXXXXXXXXXXSFFEAATALALLHFAREGVEFAVLEVGLGGRLD
1o5zA           HLSTFRERIRLNEEYISEEDVVKIYETMEPILNELDKSFFEVVTAMAFLYFAEKNVDIAVLEVGLGGRLD
1jbwA           FIMRFNERIMIDHEPIPDAALVNAVAFVRAALERLXXXXFEFITALAYWYFRQRQVDVAVIEVGIGGDTD
1w7kA           HLVRYTERVRVQGQELPESAHTASFAEIESARGDISLTYFEYGTLSALWLFKQAQLDVVILEVGLGGRLD
1w78A           HLVRYTERVRVQGQELPESAHTASFAEIESARGDISLTYFEYGTLSALWLFKQAQLDVVILEVGLGGRLD
2gcaA           FIMRFNERIMIDHEPIPDAALVNAVAFVRAALERLXXXXFEFITALGYWYFRQRQVDVAVIEVGIGGDTD
1jbvA           FIMRFNERIMIDHEPIPDAALVNAVAFVRAALERLXXXXFEFITALAYWYFRQRQVDVAVIEVGIGGDTD
2gcbA           FIMRFNERIMIDHEPIPDAALVNAVAFVRAALERLXXXXFEFITALGYWYFRQRQVDVAVIEVGIGGDTD
2gc5A           FIMRFNERIMIDHEPIPDAALVNAVAFVRAALERLXXXXFEFITALGYWYFRQRQVDVAVIEVGIGGDTD
2gc6A           FIMRFNERIMIDHEPIPDAALVNAVAFVRAALERLXXXXFEFITALGYWYFRQRQVDVAVIEVGIGGDTD
1fgsA           FIMRFNERIMIDHEPIPDAALVNAVAFVRAALERLXXXXFEFITALAYWYFRQRQVDVAVIEVG-----D
2vorA           HLQSPVERISIDGKPIYREIEPLVALIDQQSQASPAMSKFEVLTXXXXXXXXXXXXXXXXXXXXXXGRWD
2vosA           HLQSPVERISIDGKPITYREIEPLVALIDQQSQASPASKFEVLT-XXXXXXXXXXXXXXXXEVG-GGRWD


                         +         .         .         .         .         *         .:210
query           ATNATEPVLSVVTNVGHDHLEVLGPTLKDVAREKAGIFRGGVPALTAAQGEGLGVLRAEALARKTPLWVL
1o5zA           ATNVVFPLCSTIVTVDR-------YTIEQIAWEKSGIIKERVPLVTGRKREALKVMEDVARKKSSRMYVI
1jbwA           STNVITPVVSVLTEVALDHQKLLGHTITAIAKH-AGIIKRGIPVVTGNLVPDXXXXXXXXXXTTGSQWLF
1w7kA           ATNIVDADVAVVTSIALDHTDWLGPDRESIGRE-AGIFRSEKPAIVGSTIADVAQEKGALLQRRGVEWVT
1w78A           ATNIVDADVAVVTSIALDHTDWLGPDRESIGRE-AGIFRSEKPAIVGSTIADVAQEKGALLQRRGVEWVT
2gcaA           STNVITPVVSVLTEVALDHQKLLGHTITAIAKHKAGIIKRGIPVVTGNLVPDXXXXXXXXXXTTGSQWLF
1jbvA           STNVITPVVSVLTEVALDHQKLLGHTITAIAKH-AGIIKRGIPVVTGNLVPDXXXXXXXXXXTTGSQWLF
2gcbA           STNVITPVVSVLTSVALDHQKLLGHTITAIAKHKAGIIKRGIPVVTGNLVPDXXXXXXXXXXTTGSQWLF
2gc5A           STNVITPVVSVLTEVALDHQKLLGHTITAIAKH-AGIIKRGIPVVTGNLVPDXXXXXXXXXXTTGSQWLF
2gc6A           STNVITPVVSVLTEVALDHQKLLGHTITAIAKH-AGIIKRGIPVVTGNLVPDXXXXXXXXXXTTGSQWLF
1fgsA           STNVITPVVSVLTEVALD-------TITAIAKHKAGIIKRGIPVVTGNLVPDXXXXXXXXXXTTGSQWLF
2vorA           ATNVINAPVAVITPISIDHVDYLXXXXXXXXXXXXXXXRAPSPDTVAVIGRQV---------PKVMEVLL
2vosA           ATNVINAPVAVITPISIDHVDYLXXXXXXXXXXXXXXXRAPSPDTVAVIGR--QVPKVEVL--------L


                         .         .         .         +         .         .         .:280
query           GEDFHAEGVEALPEGLAFTLRLERTGEALRLTARLLGPHQAENXXXXXXXXXXXXXXWEAVKRGVARAEN
1o5zA           DKDFSVKVKSLKLHENRFDYCGENTFEDLVLT--MNGPHQIENAGVALKTLEATGLPLKAIREGLKNAKN
1jbwA           DRDFSVPKAKLHGWGQRFTYE-DQDGRISDLEVPLVGDYQQRNMAIAIQTAKVYAKQTENIRQGLAASHW
1w7kA           DHDWAFSDAHGTLENLPLPLVPQPNXXXXXXXXXXSGLEVSEN----------------AIRDGIASAIL
1w78A           DHDWAFSDAHGTLENLPLPLVPQPNXXXXXXXXXXSGLEVSEN----------------AIRDGIASAIL
2gcaA           DRDFSVPKAKLHGWGQRFTYE-DQDGRISDLEVPLVGDYQQRNMAIAIQTAKVYAKQTENIRQGLAASHW
1jbvA           DRDFSVPKAKLHGWGQRFTYE-DQDGRISDLEVPLVGDYQQRNMAIAIQTAKVYAKQTENIRQGLAASHW
2gcbA           DRDFSVPKAKLHGWGQRFTYE-DQDGRISDLEVPLVGDYQQRNMAIAIQTAKVYAKQTENIRQGLAASHW
2gc5A           DRDFSVPKAKLHGWGQRFTYE-DQDGRISDLEVPLVGDYQQRNMAIAIQTAKVYAKQTENIRQGLAASHW
2gc6A           DRDFSVPKAKLHGWGQRFTYE-DQDGRISDLEVPLVGDYQQRNMAIAIQTAKVYAKQTENIRQGLAASHW
1fgsA           DRDFSVPKAKLHGWGQRFTYE-DQDGRISDLEVPLVGDYQQRNMAIAIQTAKVYAKQTENIRQGLAASHW
2vorA           AESVRADASVAREDSEFAVLRRQIAXXXXXIYLPLHGEHQAHNALASVEAFFGAQLDGDAVRAGFAAVTS
2vosA           AESVRADASVAREDSEFAVLRRQIAXXXXXIYLPLHGEHQAHNALASVEAFFGAQLDGDAVRAGFAAVTS


                         .         *         .         .         .         .         +:350
query           PGRLQRLLWRGRELLLDGAHNPEGALALREALRFHGLLPAAFVLGFSRDKDHAAMAEALRGLGPVVLTRY
1o5zA           LGRFEILEKNGKMYILDGAHNPHGAESLVRSLKFNG-EPLSLVIGILDDKNREDILRKYTGIERVIVTRV
1jbwA           PARLEKIS-DTPLIVIDGAHNPDGINGLITALKQLFSQPITVIAGILADKDYAAMADRLTAAFSTVY---
1w7kA           PGRFQ-IVSESPRVIFDVAHNPHAAEYLMKALPKNGRVLA--VIGMLHDKDIAGTLAWLKSV--------
1w78A           PGRFQ-IVSESPRVIFDVAHNPHAAEYLMKALPKNGRVLA--VIGMLHDKDIAGTLAWLKSV--------
2gcaA           PARLEKIS-DTPLIVIDGAHNPDGINGLITALKQLFSQPITVIAGIL----YAAMADRLTA---AFSTVY
1jbvA           PARLEKIS-DTPLIVIDGAHNPDGINGLITALKQLFSQPITVIAGAMADRLTAAFSTVY--LVPVPGT--
2gcbA           PARLEKIS-DTPLIVIDGAHNPDGINGLITALKQLFSQPITVIAGILM-ADRLTAAFSTVYLVPVPGT--
2gc5A           PARLEKIS-DTPLIVIDGAHNPDGINGLITALKQLFSQPITVIAGI-----YAAMADRLTA---AFSTVY
2gc6A           PARLEKIS-DTPLIVIDGAHNPDGINGLITALKQLFSQPITVIAGIL----YAAMADRLTA---AFSTVY
1fgsA           PARLEKISDTPL-IVIDGAHNPDGINGLITALKQLFSQPITVIAGYAAMADRLTAAFSTVYLVPVPGTPR
2vorA           PGRLERMR-SAPTVFIDAAHNPAGASALAQTLAFRFLVGVLSVLG---DKDVDGILAALEPVDSVVVTHN
2vosA           PGRLERR--SAPTVFIDAAHNPAGASALAQTLAFRFLVGVLSVLG---DKDVDGILAALEPVDSVVVTHN


                         .         .         .         .         *         .         .:420
query           ASLRSEDPRALLPLFPGAKVVEDPLEALEEAFSREGRVVVAGSLYLVGEVLRRLEGLPAEERWQ
1o5zA           PSPRMKDMNSLVDMFKNVEVIEDPLEAIE---STERATVVTGSLFLVGYVREFLTTGKINEEWK
1jbwA           ----------LVPV-PGTRLKDSWQEALAASLNPDQPIVITGSLYLASAVRQTLLG--------
1w7kA           ----------------------------------------------------------------
1w78A           ----------------------------------------------------------------
2gcaA           LVPVPGTPRAL-------RLKDSWQEALAASLNPDQPIVITGSLYLASAVRQTLLG--------
1jbvA           -------PRAL----PEARLKDSWQEALAASLNPDQPIVITGSLYLASAVRQTLLG--------
2gcbA           -------PRAL-------RLKDSWQEALAASLNPDQPIVITGSLYLASAVRQTLLG--------
2gc5A           LVPVPGTPRAL------PRLKDSWQEALAASLNPDQPIVITGSLYLASAVRQTLLG--------
2gc6A           LVPVPGTPRAL-------RLKDSWQEALAASLNPDQPIVITGSLYLASAVRQTLLG--------
1fgsA           GRLKDSWQEAL-----AASLNDVP----------DQPIVITGSLYLASAVRQTLLG--------
2vorA           GSPRALDVEAL-----------------------------------------------------
2vosA           GSPRALDVEAL-----------------------------------------------------