[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tthe0:AAS81992.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1xdyG.bssp"
#ERROR : Can't open dsspfile "1xdyF.bssp"
#ERROR : Can't open dsspfile "1xdyD.bssp"
#ERROR : Can't open dsspfile "1xdyB.bssp"
#ERROR : Can't open dsspfile "1xdyA.bssp"
#ERROR : Can't open dsspfile "1xdqC.bssp"
#ERROR : Can't open dsspfile "1xdqB.bssp"
#ERROR : Can't open dsspfile "1xdqA.bssp"
#ERROR : Can't open dsspfile "2ca4A.bssp"
#ERROR : Can't open dsspfile "2ca3A.bssp"
#ERROR : Can't open dsspfile "2blfA.bssp"
#ERROR : Can't open dsspfile "2biiA.bssp"
#ERROR : Can't open dsspfile "2bihA.bssp"
#ERROR : Can't open dsspfile "2c9xA.bssp"

## Summary of PDB Search
:220
    3e-08  32%  1xdyG  [d.176.1] BACTERIAL SULFITE OXIDASE
    3e-08  32%  1xdyF  [d.176.1] BACTERIAL SULFITE OXIDASE
    3e-08  32%  1xdyD  [d.176.1] BACTERIAL SULFITE OXIDASE
    3e-08  32%  1xdyB  [d.176.1] BACTERIAL SULFITE OXIDASE
    3e-08  32%  1xdyA  [d.176.1] BACTERIAL SULFITE OXIDASE
    3e-08  32%  1xdqC  [d.176.1] BACTERIAL SULFITE OXIDASE
    3e-08  32%  1xdqB  [d.176.1] BACTERIAL SULFITE OXIDASE
    3e-08  32%  1xdqA  [d.176.1] BACTERIAL SULFITE OXIDASE
    3e-04  35%  2ca4A  [x.x.x] SULFITE\:CYTOCHROME C OXIDOREDUCTASE SUBUNIT A
    3e-04  35%  2ca3A  [x.x.x] SULFITE\:CYTOCHROME C OXIDOREDUCTASE SUBUNIT A
    3e-04  35%  2blfA  [x.x.x] SULFITE\:CYTOCHROME C OXIDOREDUCTASE SUBUNIT A
    4e-04  34%  2biiA  [x.x.x] NITRATE REDUCTASE [NADPH]
    4e-04  34%  2bihA  [x.x.x] NITRATE REDUCTASE [NADPH]
    8e-04  33%  2c9xA  [x.x.x] SULFITE\:CYTOCHROME C OXIDOREDUCTASE SUBUNIT A
:220

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEAWRLEVTGLVETPLVLTYEDLLARP
1xdyG           --------------------------------------------DPWTLKISGEVAKPLTLDHDDLTRRP
1xdyF           --------------------------------------------DPWTLKISGEVAKPLTLDHDDLTRRP
1xdyD           --------------------------------------------DPWTLKISGEVAKPLTLDHDDLTRRP
1xdyB           --------------------------------------------DPWTLKISGEVAKPLTLDHDDLTRRP
1xdyA           --------------------------------------------DPWTLKISGEVAKPLTLDHDDLTRRP
1xdqC           --------------------------------------------DPWTLKISGEVAKPLTLDHDDLTRRP
1xdqB           --------------------------------------------DPWTLKISGEVAKPLTLDHDDLTRRP
1xdqA           --------------------------------------------DPWTLKISGEVAKPLTLDHDDLTRRP
2ca4A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
2blfA           ----------------------------------------------------------------------
2biiA           ----------------------------------------------------------------------
2bihA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           QVELTRDFHCVTRWSRLDVTWKGVRTRDLXXXXXXXXXXXXXXXESYGGYTTNXXXXXXXXXXXXXAHTL
1xdyG           LEERIYRMRCVEAWSMV-VPWIGFPLHKLLALAEPTSNAKYVAFETIGGYVEGLRLDEAMHPLTLMTVGV
1xdyF           LEERIYRMRCVEAWSMV-VPWIGFPLHKLLALAEPTSNAKYVAFETIGGYVEGLRLDEAMHPLTLMTVGV
1xdyD           LEERIYRMRCVEAWSMV-VPWIGFPLHKLLALAEPTSNAKYVAFETIGGYVEGLRLDEAMHPLTLMTVGV
1xdyB           LEERIYRMRCVEAWSMV-VPWIGFPLHKLLALAEPTSNAKYVAFETIGGYVEGLRLDEAMHPLTLMTVGV
1xdyA           LEERIYRMRCVEAWSMV-VPWIGFPLHKLLALAEPTSNAKYVAFETIGGYVEGLRLDEAMHPLTLMTVGV
1xdqC           LEERIYRMRCVEAWSMV-VPWIGFPLHKLLALAEPTSNAKYVAFETIGGYVEGLRLDEAMHPLTLMTVGV
1xdqB           LEERIYRMRCVEAWSMV-VPWIGFPLHKLLALAEPTSNAKYVAFETIGGYVEGLRLDEAMHPLTLMTVGV
1xdqA           LEERIYRMRCVEAWSMV-VPWIGFPLHKLLALAEPTSNAKYVAFETIGGYVEGLRLDEAMHPLTLMTVGV
2ca4A           ------------------------------------------------------------------AYSM
2ca3A           ------------------------------------------------------------------AYSM
2blfA           ------------------------------------------------------------------AYSM
2biiA           ----------------------------------------------------------------------
2bihA           ----------------------------------------------------------------------
2c9xA           ------------------------------------------------------------------AYSM


                         +         .         .         .         .         *         .:210
query           FGKPLPPERGGPVRLLVPHLYAWKSAKWVRRIVLLDHLELGFWERLGYxxxxxxxxxxxxxxxxxxxxxx
1xdyG           YGKALPPQNGAPVRLIVPWKYGFKGIKSIVSIKL------------------------------------
1xdyF           YGKALPPQNGAPVRLIVPWKYGFKGIKSIVSIKL------------------------------------
1xdyD           YGKALPPQNGAPVRLIVPWKYGFKGIKSIVSIKL------------------------------------
1xdyB           YGKALPPQNGAPVRLIVPWKYGFKGIKSIVSIKL------------------------------------
1xdyA           YGKALPPQNGAPVRLIVPWKYGFKGIKSIVSIKL------------------------------------
1xdqC           YGKALPPQNGAPVRLIVPWKYGFKGIKSIVSIKL------------------------------------
1xdqB           YGKALPPQNGAPVRLIVPWKYGFKGIKSIVSIKL------------------------------------
1xdqA           YGKALPPQNGAPVRLIVPWKYGFKGIKSIVSIKL------------------------------------
2ca4A           NGADLPWLNGYPLRLVVPGYYGTYWVKHLNEITVIDKEFDGFWMKTAY----------------------
2ca3A           NGADLPWLNGYPLRLVVPGYYGTYWVKHLNEITVIDKEFDGFWMKTAY----------------------
2blfA           NGADLPWLNGYPLRLVVPGYYGTYWVKHLNEITVIDKEFDGFWMKTAY----------------------
2biiA           -GEWLHPDHGKPLRVVIPGVIGGRSVKWLKKLVVSD----------------------------------
2bihA           -GEWLHPDHGKPLRVVIPGVIGGRSVKWLKKLVVSD----------------------------------
2c9xA           NGADLPWLNGYPLRLVVPGYYGTYWVKHLNEITVIDKEFDGFWMKTAF----------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxx
1xdyG           ----------
1xdyF           ----------
1xdyD           ----------
1xdyB           ----------
1xdyA           ----------
1xdqC           ----------
1xdqB           ----------
1xdqA           ----------
2ca4A           ----------
2ca3A           ----------
2blfA           ----------
2biiA           ----------
2bihA           ----------
2c9xA           ----------