[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tthe0:AAS82166.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2k4kA.bssp"
#ERROR : Can't open dsspfile "2oceA.bssp"
#ERROR : Can't open dsspfile "3bzkA.bssp"
#ERROR : Can't open dsspfile "3bzcA.bssp"
#ERROR : Can't open dsspfile "1sroA.bssp"
#ERROR : Can't open dsspfile "1yz6A.bssp"
#ERROR : Can't open dsspfile "2eqsA.bssp"
#ERROR : Can't open dsspfile "2pmzE.bssp"
#ERROR : Can't open dsspfile "2cqoA.bssp"
#ERROR : Can't open dsspfile "2waqE.bssp"
#ERROR : Can't open dsspfile "1go3E.bssp"
#ERROR : Can't open dsspfile "2vmkA.bssp"
#ERROR : Can't open dsspfile "2k52A.bssp"
#ERROR : Can't open dsspfile "1go3M.bssp"
#ERROR : Can't open dsspfile "2k4kA.bssp"
#ERROR : Can't open dsspfile "2k4kA.bssp"
#ERROR : Can't open dsspfile "2k4kA.bssp"
#ERROR : Can't open dsspfile "2oceA.bssp"
#ERROR : Can't open dsspfile "2oceA.bssp"
#ERROR : Can't open dsspfile "2oceA.bssp"
#ERROR : Can't open dsspfile "3bzkA.bssp"
#ERROR : Can't open dsspfile "3bzkA.bssp"
#ERROR : Can't open dsspfile "3bzkA.bssp"
#ERROR : Can't open dsspfile "3bzcA.bssp"
#ERROR : Can't open dsspfile "3bzcA.bssp"
#ERROR : Can't open dsspfile "3bzcA.bssp"
#ERROR : Can't open dsspfile "1sroA.bssp"
#ERROR : Can't open dsspfile "1sroA.bssp"
#ERROR : Can't open dsspfile "1sroA.bssp"
#ERROR : Can't open dsspfile "1yz6A.bssp"
#ERROR : Can't open dsspfile "1yz6A.bssp"
#ERROR : Can't open dsspfile "1yz6A.bssp"
#ERROR : Can't open dsspfile "2eqsA.bssp"
#ERROR : Can't open dsspfile "2cqoA.bssp"

## Summary of PDB Search
:536
    1e-11  41%  2k4kA  [x.x.x] GENERAL STRESS PROTEIN 13
    3e-11  48%  2oceA  [x.x.x] HYPOTHETICAL PROTEIN PA5201
    3e-11  48%  3bzkA  [x.x.x] TEX
    3e-11  48%  3bzcA  [x.x.x] TEX
    1e-10  49%  1sroA  [x.x.x] PNPASE
    4e-08  37%  1yz6A  [x.x.x] PROBABLE TRANSLATION INITIATION FACTOR 2 ALPHA
    1e-07  42%  2eqsA  [x.x.x] ATP-DEPENDENT RNA HELICASE DHX8
    1e-06  49%  2pmzE  [x.x.x] DNA-DIRECTED RNA POLYMERASE SUBUNIT E
    4e-06  36%  2cqoA  [x.x.x] NUCLEOLAR PROTEIN OF 40 KDA
    9e-06  59%  2waqE  [x.x.x] DNA-DIRECTED RNA POLYMERASE RPO7 SUBUNIT
    2e-05  34%  1go3E  [d.230.1 - b.40.4] DNA-DIRECTED RNA POLYMERASE SUBUNIT E
    3e-04  25%  2vmkA  [x.x.x] RIBONUCLEASE E
    3e-04  32%  2k52A  [x.x.x] UNCHARACTERIZED PROTEIN MJ1198
    9e-04  34%  1go3M  [d.230.1 - b.40.4] DNA-DIRECTED RNA POLYMERASE SUBUNIT E
    1e-09  39%  2k4kA  [x.x.x] GENERAL STRESS PROTEIN 13(query 374->439)
    4e-07  38%  2k4kA  [x.x.x] GENERAL STRESS PROTEIN 13(query 33->102)
    4e-06  46%  2k4kA  [x.x.x] GENERAL STRESS PROTEIN 13(query 233->278)
    1e-09  42%  2oceA  [x.x.x] HYPOTHETICAL PROTEIN PA5201(query 294->366)
    6e-07  34%  2oceA  [x.x.x] HYPOTHETICAL PROTEIN PA5201(query 3->104)
    4e-05  33%  2oceA  [x.x.x] HYPOTHETICAL PROTEIN PA5201(query 203->277)
    1e-09  42%  3bzkA  [x.x.x] TEX(query 294->366)
    6e-07  34%  3bzkA  [x.x.x] TEX(query 3->104)
    4e-05  33%  3bzkA  [x.x.x] TEX(query 203->277)
    1e-09  42%  3bzcA  [x.x.x] TEX(query 294->366)
    6e-07  34%  3bzcA  [x.x.x] TEX(query 3->104)
    4e-05  33%  3bzcA  [x.x.x] TEX(query 203->277)
    3e-08  39%  1sroA  [x.x.x] PNPASE(query 293->365)
    8e-07  38%  1sroA  [x.x.x] PNPASE(query 30->105)
    4e-04  44%  1sroA  [x.x.x] PNPASE(query 229->277)
    3e-07  39%  1yz6A  [x.x.x] PROBABLE TRANSLATION INITIATION FACTOR 2 ALPHA(query 288->365)
    1e-04  31%  1yz6A  [x.x.x] PROBABLE TRANSLATION INITIATION FACTOR 2 ALPHA(query 377->440)
    1e-04  43%  1yz6A  [x.x.x] PROBABLE TRANSLATION INITIATION FACTOR 2 ALPHA(query 232->277)
    2e-07  50%  2eqsA  [x.x.x] ATP-DEPENDENT RNA HELICASE DHX8(query 381->437)
    1e-04  34%  2cqoA  [x.x.x] NUCLEOLAR PROTEIN OF 40 KDA(query 295->363)
:536

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxDKATQTPEQTFSMEAALQETEARLEKRVRPGQILTGKVVLVGSEGVAVDIGAKTEGIIPFNQLTTKPL
2k4kA           ----------------------------------------------------------------------
2oceA           ----------------------------------------------------------------------
3bzkA           ----------------------------------------------------------------------
3bzcA           ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
1yz6A           ----------------------------------------------------------------------
2eqsA           ----------------------------------------------------------------------
2pmzE           ----------------------------------------------------------------------
2cqoA           ----------------------------------------------------------------------
2waqE           ----------------------------------------------------------------------
1go3E           ----------------------------------------------------------------------
2vmkA           ----ATQQEELRVALVDGQRLYDLDIESEQKKANIYKGKITRISLEAAFVDYGAERHGFLPLKEIAREYF
2k52A           ----------------------------------------------------------------------
1go3M           ----------------------------------------------------------------------
2k4kA           ----------------------------------------------------------------------
2k4kA           --------------------------------GSVYTGKVTGLQAYGAFVALDEETQGLVHISEVTHGFV
2k4kA           ----------------------------------------------------------------------
2oceA           ----------------------------------------------------------------------
2oceA           --DKPGRDPRPEFKT-AEFQEGVESL-KDLKPGMVLEGVVTNVTNFGAFVDIGVHQDGLVHISALSEKFV
2oceA           ----------------------------------------------------------------------
3bzkA           ----------------------------------------------------------------------
3bzkA           --DKPGRDPRPEFKT-AEFQEGVESL-KDLKPGMVLEGVVTNVTNFGAFVDIGVHQDGLVHISALSEKFV
3bzkA           ----------------------------------------------------------------------
3bzcA           ----------------------------------------------------------------------
3bzcA           --DKPGRDPRPEFKT-AEFQEGVESL-KDLKPGMVLEGVVTNVTNFGAFVDIGVHQDGLVHISALSEKFV
3bzcA           ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
1sroA           -----------------------------IEVGRVYTGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRV
1sroA           ----------------------------------------------------------------------
1yz6A           ----------------------------------------------------------------------
1yz6A           ----------------------------------------------------------------------
1yz6A           ----------------------------------------------------------------------
2eqsA           ----------------------------------------------------------------------
2cqoA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SEEELRNLLSPGDEVKVQVLRVDPETGQILLSRKKxxxxxxxxxxQELYEKGEPVTVTIKERVKGGVVAE
2k4kA           ----------------------------------------------------------------------
2oceA           ----------------------------------------------------------------------
3bzkA           ----------------------------------------------------------------------
3bzcA           ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
1yz6A           ---------------------------------------------REYPEEGEFVVATVKRIHNYGAFLE
2eqsA           ----------------------------------------------------------------------
2pmzE           ----------------------------------------------------------------------
2cqoA           ----------------------------------------------------------------------
2waqE           ----------------------------------------------------------------------
1go3E           ----------------------------------------------------------------------
2vmkA           PRPNIKDVLREGQEVIVQI---------------------------------------------------
2k52A           ----------------------------------------------------------------------
1go3M           ----------------------------------------------------------------------
2k4kA           ----------------------------------------------------------------------
2k4kA           --KDINEHLSVGDEVQVKVLAVDEEKGKISLS--------------------------------------
2k4kA           ----------------------------------------------------------------------
2oceA           ----------------------------------------------------------------------
2oceA           KDP--YEVVKAGDIVKVKVMEVDIPRNRVGLSMR------------------------------------
2oceA           ----------------------------------------------------------------------
3bzkA           ----------------------------------------------------------------------
3bzkA           KDP--YEVVKAGDIVKVKVMEVDIPRNRVGLSMR------------------------------------
3bzkA           ----------------------------------------------------------------------
3bzcA           ----------------------------------------------------------------------
3bzcA           KDP--YEVVKAGDIVKVKVMEVDIPRNRVGLSMR------------------------------------
3bzcA           ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
1sroA           --EKVTDYLQMGQEVPVKVLEVDRQ-GRIRLSIKE-----------------------------------
1sroA           ----------------------------------------------------------------------
1yz6A           ----------------------------------------------------------------------
1yz6A           ----------------------------------------------------------------------
1yz6A           ----------------------------------------------------------------------
2eqsA           ----------------------------------------------------------------------
2cqoA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LDGIQGFMPASQLDLRRVPNLDEFVGQQVLAKIIEFHRRKGRVILSRRAVLEEEQKKAREAFLKSLEPGQ
2k4kA           ----------------------------------------------------------------------
2oceA           ----------------------------------------------------------------------
3bzkA           ----------------------------------------------------------------------
3bzcA           ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
1yz6A           LDGKEAFMHISEVASTWVRNIRDYLGQKVVAKVIRVDPRKGHIDLSLRRVTQQQRKAKLQEF--------
2eqsA           ----------------------------------------------------------------------
2pmzE           ----------------------------------------------------------------------
2cqoA           ----------------------------------------------------------------------
2waqE           ----------------------------------------------------------------------
1go3E           ----------------------------------------------------------------------
2vmkA           ----------------------------------------------------------------------
2k52A           ----------------------------------------------------------------------
1go3M           ----------------------------------------------------------------------
2k4kA           ----------------------------------------------------------------------
2k4kA           ----------------------------------------------------------------------
2k4kA           ----------------------------------------------------------------------
2oceA           ----------------------------------------------------------------------
2oceA           ----------------------------------------------------------------------
2oceA           --------------------------------------------------------------LKDLKPGM
3bzkA           ----------------------------------------------------------------------
3bzkA           ----------------------------------------------------------------------
3bzkA           --------------------------------------------------------------LKDLKPGM
3bzcA           ----------------------------------------------------------------------
3bzcA           ----------------------------------------------------------------------
3bzcA           --------------------------------------------------------------LKDLKPGM
1sroA           ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
1yz6A           ----------------------------------------------------------------------
1yz6A           ----------------------------------------------------------------------
1yz6A           ----------------------------------------------------------------------
2eqsA           ----------------------------------------------------------------------
2cqoA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           XXXXXXXXXXXXXXXXNLGPVDGLVHRSEITWGRFNHPREVIQKGQKVKAQVLSVDPEKERVNLSIKAxx
2k4kA           ----------------------------------------------------------------------
2oceA           ----------------------------------------------------------------------
3bzkA           ----------------------------------------------------------------------
3bzcA           ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
1yz6A           ----------------------------------------------------------------------
2eqsA           ----------------------------------------------------------------------
2pmzE           ----------------NLGPMDGLVHISQITDDTLKYSKKVIQKGDKVRARVISVASTVPRIALTMR---
2cqoA           ----------------------------------------------------------------------
2waqE           ----------------NLGPMDGLVHISQITDDTLKYSKKVIQKGDKVRARVISV---------------
1go3E           ----------------------------------------------------------------------
2vmkA           ----------------------------------------------------------------------
2k52A           ----------------------------------------------------------------------
1go3M           ----------------------------------------------------------------------
2k4kA           ----------------------------------------------------------------------
2k4kA           ----------------------------------------------------------------------
2k4kA           ----------------------GLVHISEVTHGFVKDINEHLSVGDEVQVKVLAVDEEKGKISLSIRA--
2oceA           ----------------------------------------------------------------------
2oceA           ----------------------------------------------------------------------
2oceA           VLEGVVTNVTNFGAFVDIGVQDGLVHISALSEKFVKDPYEVVKAGDIVKVKVMEVDIPRNRVGLSMR---
3bzkA           ----------------------------------------------------------------------
3bzkA           ----------------------------------------------------------------------
3bzkA           VLEGVVTNVTNFGAFVDIGVQDGLVHISALSEKFVKDPYEVVKAGDIVKVKVMEVDIPRNRVGLSMR---
3bzcA           ----------------------------------------------------------------------
3bzcA           ----------------------------------------------------------------------
3bzcA           VLEGVVTNVTNFGAFVDIGVQDGLVHISALSEKFVKDPYEVVKAGDIVKVKVMEVDIPRNRVGLSMR---
1sroA           ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
1sroA           ------------------GGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVD-RQGRIRLSIK---
1yz6A           ----------------------------------------------------------------------
1yz6A           ----------------------------------------------------------------------
1yz6A           ---------------------EAFMHISEVTWVR--NIRDYLKEGQKVVAKVIRVDPRKGHIDLSLR---
2eqsA           ----------------------------------------------------------------------
2cqoA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxVAEKYPVGTRVRGKVVGLTQFGAFVEVEPGLEGLIHISELSWTKRPKHPSEVVKEGDEVEAVVL
2k4kA           ------MAAKFEVGSVYTGKVTGLQAYGAFVALDEETQGLVHISEVT-HGFVKDINEHLSVGDEVQVKVL
2oceA           ----------------------------------------------------------------------
3bzkA           ----------------------------------------------------------------------
3bzcA           ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
1yz6A           ----------------------------------------------------------------------
2eqsA           --------EEPTIGDIYNGKVTSIMQFGCFVQLE-GLEGLVHISELRREGRVANVADVVSKGQRVKVKVL
2pmzE           ----------------------------------------------------------------------
2cqoA           ----------------------------------------------------------------------
2waqE           ----------------------------------------------------------------------
1go3E           ----------------IEGEVVDVVEFGSFVRLGP-LDGLIHVSQISYDPKAKETGKVLEIGDYVRARIV
2vmkA           ----------------------------------------------------------------------
2k52A           ----------------------------------------------------------------------
1go3M           ----------------IEGEVVDVVEFGSFVRLGP-LDGLIHVSQISYDPKGKETGKVLEIGDYVRARIV
2k4kA           ----------------------------------------------------------------------
2k4kA           ----------------------------------------------------------------------
2k4kA           ----------------------------------------------------------------------
2oceA           -------------GMVLEGVVTNVTNFGAFVDIGVHQDGLVHISALS-EKFVKDPYEVVKAGDIVKVKVM
2oceA           ----------------------------------------------------------------------
2oceA           ----------------------------------------------------------------------
3bzkA           -------------GMVLEGVVTNVTNFGAFVDIGVHQDGLVHISALS-EKFVKDPYEVVKAGDIVKVKVM
3bzkA           ----------------------------------------------------------------------
3bzkA           ----------------------------------------------------------------------
3bzcA           -------------GMVLEGVVTNVTNFGAFVDIGVHQDGLVHISALS-EKFVKDPYEVVKAGDIVKVKVM
3bzcA           ----------------------------------------------------------------------
3bzcA           ----------------------------------------------------------------------
1sroA           ------------VGRVYTGKVTRIVDFGAFVAIGGGKEGLVHISQIA-DKRVEKVTDYLQMGQEVPVKVL
1sroA           ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
1yz6A           -------AREYPEGEFVVATVKRIHNYGAFLELDPGKEAFMHISEVAWVRNIR---DYLKEGQKVVAKVI
1yz6A           ----------------------------------------------------------------------
1yz6A           ----------------------------------------------------------------------
2eqsA           ----------------------------------------------------------------------
2cqoA           --------------TIFQGEVAMVTDYGAFIKI-PGCQGLVHRTHMSSCRVDK-PSEIVDVGDKVWVKLI


                         .         .         .         .         *         .         .:420
query           RLDPEERRLSLGLKQTQPDPWQQLTEKYPPGTVLKGKVTGVTDFGVFVEIEPGIEGLVHVSELDHKRVEN
2k4kA           AVDEEKGKISLSIRATQ-----------------------------------------------------
2oceA           -----------------------------PGMVLEGVVTNVTNFGAFVDIGVHQDGLVHISALSEKFVKD
3bzkA           -----------------------------PGMVLEGVVTNVTNFGAFVDIGVHQDGLVHISALSEKFVKD
3bzcA           -----------------------------PGMVLEGVVTNVTNFGAFVDIGVHQDGLVHISALSEKFVKD
1sroA           ------------------------------GRVYTGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRVEK
1yz6A           ----------------------------------------------------------------------
2eqsA           SFTGTKTSLSM-----------------------------------------------------------
2pmzE           ----------------------------------------------------------------------
2cqoA           ----------------RPETMENLPALY---TIFQGEVAMVTDYGAFIKI-PGCQGLVHRTHMSSCRVDK
2waqE           ----------------------------------------------------------------------
1go3E           AISLKASKIALTMRQ-------------------------------------------------------
2vmkA           ----------------------------------------------------------------------
2k52A           -----------------------------PGKFYKGVVTRIEKYGAFINLNEQVRGLLRPRDMISLRLEN
1go3M           AISLSKIALTM-----------------------------------------------------------
2k4kA           -----------------------MAAKFEVGSVYTGKVTGLQAYGAFVALDEETQGLVHISEVTHGFVKD
2k4kA           ----------------------------------------------------------------------
2k4kA           ----------------------------------------------------------------------
2oceA           EVDIPRNRVGLSMRMS------------------------------------------------------
2oceA           ----------------------------------------------------------------------
2oceA           ----------------------------------------------------------------------
3bzkA           EVDIPRNRVGLSMRMS------------------------------------------------------
3bzkA           ----------------------------------------------------------------------
3bzkA           ----------------------------------------------------------------------
3bzcA           EVDIPRNRVGLSMRMS------------------------------------------------------
3bzcA           ----------------------------------------------------------------------
3bzcA           ----------------------------------------------------------------------
1sroA           EVD-RQGRIRLSIKE-------------------------------------------------------
1sroA           ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
1yz6A           RVDPRKGHIDLSLRR-------------------------------------------------------
1yz6A           --------------------------EYPEGEFVVATVKRIHNYGAFLELDPGKEAFMHISEVASTWVRN
1yz6A           ----------------------------------------------------------------------
2eqsA           ------------------------------GDIYNGKVTSIMQFGCFVQLE-GLEGLVHISELRRERVAN
2cqoA           GREMKNDRIKVSL---------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           PAALFKKGDEMEVVVLNIDPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2k4kA           ----------------------------------------------------------------------
2oceA           PYEVVKAGDIVKVKVMEVD---------------------------------------------------
3bzkA           PYEVVKAGDIVKVKVMEVD---------------------------------------------------
3bzcA           PYEVVKAGDIVKVKVMEVD---------------------------------------------------
1sroA           VTDYLQMGQEVPVKVLEVD---------------------------------------------------
1yz6A           ----------------------------------------------------------------------
2eqsA           ----------------------------------------------------------------------
2pmzE           ----------------------------------------------------------------------
2cqoA           PSEIVDVGDKVWVKLI------------------------------------------------------
2waqE           ----------------------------------------------------------------------
1go3E           ----------------------------------------------------------------------
2vmkA           ----------------------------------------------------------------------
2k52A           ----LNVGDEIIVQAIDVRP--------------------------------------------------
1go3M           ----------------------------------------------------------------------
2k4kA           INEHLSVGDEVQVKVLAVD---------------------------------------------------
2k4kA           ----------------------------------------------------------------------
2k4kA           ----------------------------------------------------------------------
2oceA           ----------------------------------------------------------------------
2oceA           ----------------------------------------------------------------------
2oceA           ----------------------------------------------------------------------
3bzkA           ----------------------------------------------------------------------
3bzkA           ----------------------------------------------------------------------
3bzkA           ----------------------------------------------------------------------
3bzcA           ----------------------------------------------------------------------
3bzcA           ----------------------------------------------------------------------
3bzcA           ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
1yz6A           ----------------------------------------------------------------------
1yz6A           IRDYLKEGQKVVAKVIRVDP--------------------------------------------------
1yz6A           ----------------------------------------------------------------------
2eqsA           VADVVSKGQRVKVKVLS-----------------------------------------------------
2cqoA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2k4kA           ----------------------------------------------
2oceA           ----------------------------------------------
3bzkA           ----------------------------------------------
3bzcA           ----------------------------------------------
1sroA           ----------------------------------------------
1yz6A           ----------------------------------------------
2eqsA           ----------------------------------------------
2pmzE           ----------------------------------------------
2cqoA           ----------------------------------------------
2waqE           ----------------------------------------------
1go3E           ----------------------------------------------
2vmkA           ----------------------------------------------
2k52A           ----------------------------------------------
1go3M           ----------------------------------------------
2k4kA           ----------------------------------------------
2k4kA           ----------------------------------------------
2k4kA           ----------------------------------------------
2oceA           ----------------------------------------------
2oceA           ----------------------------------------------
2oceA           ----------------------------------------------
3bzkA           ----------------------------------------------
3bzkA           ----------------------------------------------
3bzkA           ----------------------------------------------
3bzcA           ----------------------------------------------
3bzcA           ----------------------------------------------
3bzcA           ----------------------------------------------
1sroA           ----------------------------------------------
1sroA           ----------------------------------------------
1sroA           ----------------------------------------------
1yz6A           ----------------------------------------------
1yz6A           ----------------------------------------------
1yz6A           ----------------------------------------------
2eqsA           ----------------------------------------------
2cqoA           ----------------------------------------------