[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tthe0:AAS82289.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2qieA.bssp"
#ERROR : Can't open dsspfile "2q5wE.bssp"
#ERROR : Can't open dsspfile "2qieH.bssp"
#ERROR : Can't open dsspfile "1nvjD.bssp"
#ERROR : Can't open dsspfile "2omdB.bssp"
#ERROR : Can't open dsspfile "1nvjB.bssp"
#ERROR : Can't open dsspfile "1fm0E.bssp"
#ERROR : Can't open dsspfile "2omdA.bssp"
#ERROR : Can't open dsspfile "1nvjC.bssp"
#ERROR : Can't open dsspfile "1nvjA.bssp"
#ERROR : Can't open dsspfile "1nvjF.bssp"
#ERROR : Can't open dsspfile "1nvjE.bssp"
#ERROR : Can't open dsspfile "1jwbD.bssp"
#ERROR : Can't open dsspfile "1fm0D.bssp"
#ERROR : Can't open dsspfile "1nviD.bssp"
#ERROR : Can't open dsspfile "3biiD.bssp"
#ERROR : Can't open dsspfile "1vjkA.bssp"
#ERROR : Can't open dsspfile "1v8cA.bssp"
#ERROR : Can't open dsspfile "2q5wD.bssp"
#ERROR : Can't open dsspfile "1rwsA.bssp"

## Summary of PDB Search
:223
    2e-25  42%  2qieA  [x.x.x] MOLYBDOPTERIN-CONVERTING FACTOR SUBUNIT 2
    2e-25  42%  2q5wE  [x.x.x] MOLYBDOPTERIN-CONVERTING FACTOR SUBUNIT 2
    2e-23  40%  2qieH  [x.x.x] MOLYBDOPTERIN-CONVERTING FACTOR SUBUNIT 2
    3e-23  43%  1nvjD  [d.41.5] MOLYBDOPTERIN CONVERTING FACTOR SUBUNIT 2
    8e-23  41%  2omdB  [x.x.x] MOLYBDOPTERIN-CONVERTING FACTOR SUBUNIT 2
    1e-22  42%  1nvjB  [d.41.5] MOLYBDOPTERIN CONVERTING FACTOR SUBUNIT 2
    2e-22  43%  1fm0E  [d.41.5] MOLYBDOPTERIN CONVERTIN FACTOR, SUBUNIT 2
    1e-21  41%  2omdA  [x.x.x] MOLYBDOPTERIN-CONVERTING FACTOR SUBUNIT 2
    2e-21  43%  1nvjC  [d.41.5] MOLYBDOPTERIN CONVERTING FACTOR SUBUNIT 2
    3e-19  43%  1nvjA  [d.41.5] MOLYBDOPTERIN CONVERTING FACTOR SUBUNIT 2
    5e-19  42%  1nvjF  [d.41.5] MOLYBDOPTERIN CONVERTING FACTOR SUBUNIT 2
    9e-19  43%  1nvjE  [d.41.5] MOLYBDOPTERIN CONVERTING FACTOR SUBUNIT 2
    1e-11  49%  1jwbD  [d.15.3] MOLYBDOPTERIN [MPT] CONVERTING FACTOR, SUBUNIT 1
    1e-11  49%  1fm0D  [d.15.3] MOLYBDOPTERIN CONVERTIN FACTOR, SUBUNIT 1
    2e-11  47%  1nviD  [d.15.3] MOLYBDOPTERIN CONVERTING FACTOR SUBUNIT 1
    7e-11  48%  3biiD  [x.x.x] MOLYBDOPTERIN-CONVERTING FACTOR SUBUNIT 1
    1e-08  38%  1vjkA  [d.15.3] MOLYBDOPTERIN CONVERTING FACTOR, SUBUNIT 1
    1e-04  41%  1v8cA  [d.15.3 - d.129.5] MOAD RELATED PROTEIN
    2e-04  32%  2q5wD  [x.x.x] MOLYBDOPTERIN CONVERTING FACTOR, SUBUNIT 1
    4e-04  38%  1rwsA  [d.15.3] HYPOTHETICAL PROTEIN PF1061
:223

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRIEVRLFALYREQAGTDRLALELPEGARVREAQKALEERFPGLRLEGGMAAVNQALAGAETPLKEGDEV
2qieA           ----------------------------------------------------------------------
2q5wE           ----------------------------------------------------------------------
2qieH           ----------------------------------------------------------------------
1nvjD           ----------------------------------------------------------------------
2omdB           --------------------------------------------------------------------EV
1nvjB           ----------------------------------------------------------------------
1fm0E           ----------------------------------------------------------------------
2omdA           --------------------------------------------------------------------EV
1nvjC           ----------------------------------------------------------------------
1nvjA           ----------------------------------------------------------------------
1nvjF           ----------------------------------------------------------------------
1nvjE           ----------------------------------------------------------------------
1jwbD           --IKVLFFAQVRELVGTDEVAADFPTVEALRQHMAAQSDRW-ALALEDGLAAVNQTLVSFDHPLTDGDEV
1fm0D           --IKVLFFAQVRELVGTDEVAADFPTVEALRQHMAAQSDRW-ALALEDGLAAVNQTLVSFDHPLTDGDEV
1nviD           --VKVLFFAQVRELVGTDEVAADFPTVEALRQHMAAQSDRW-ALALEDGLAAVNQTLVSFDHPLTDGDEV
3biiD           --IKVLFFAQVRELVGTDEVAADFPTVEALRQHMAAQSDRW-ALALEDGLAAVNQTLVSFDHPLTDGDEV
1vjkA           VKVKVKYFARFRQLAGVDEEEIELPEGARVRDLIEEIKKRHEKFKEEDVNIAVNGRYVSWDEELKDGDVV
1v8cA           ---KVNLYATFRDLTGKSQL--ELP-GATVGEVLENLVRAYPALKFEGEGLAERVSLQGLSTPLSPGATL
2q5wD           -----------------------LEQALTVQQFEDLLFERYPQINNKKFQVAVNEEFVQKSDFIQPNDTV
1rwsA           ---------------------IEWREGMKVRDILRAV-----GFNTESAIAKVNGKVVLEDDEVKDGDFV


                         .         .         *         .         .         .         .:140
query           AFLPPVSGGQDSYGLTQEPLDLEALVAWATAPEYGAVVSFLGTTRSPNRGEEVAFLEYEAYPEMAEKVMA
2qieA           -----------------EPIQTEQYREFTINEYQGAVVVFTGHVREWTKGVKTEYLEYEAYIPMAEKKLA
2q5wE           -----------------EPIQTEQYREFTINEYQGAVVVFTGHVREWTKGVKTEYLEYEAYIPMAEKKLA
2qieH           -----------------EPIQTEQYREFTINEYQGAVVVFTGHVREWTKGVKTEYLEYEAYIPMAEKKLA
1nvjD           -----------------QPFSVGEEYPWAERDEDGAVVTFTGKVRNHN----VNALTLEHYPGMTEKALA
2omdB           GMIPRVYLGHEWFGAER------ILSEYQVPEDCGAQVLFLGIPRNPEDGGNIEALEYEAYPEMAIKEME
1nvjB           -----------------QPFSVGEEYPWAERDEDGAVVTFTGKVRNHNLGDSVNALTLEHYPGMTEKALA
1fm0E           -----------------QPFSVGEEYPWAERDEDGAVVTFTGKVR-------VNALTLEHYPGMTEKALA
2omdA           GMIPRVYLGHEWFGAER------ILSEYQVPEDCGAQVLFLGIPRNPEDGGNIEALEYEAYPEMAIKEME
1nvjC           -----------------QPFSVGEEYPWAERDEDGAVVTFTGKVRNHNLGNA---LTLEHYPGMTEKALA
1nvjA           -----------------QPFSVGEEYPWAERDEDGAVVTFTGKVRNA--------LTLEHYPGMTEKALA
1nvjF           -----------------QPFSVGEEYPWAERDEDGAVVTFTGKVRNNA-------LTLEHYPGMTEKALA
1nvjE           -----------------QPFSVGEEYPWAERDEDGAVVTFTGKVRNNA-------LTLEHYPGMTEKALA
1jwbD           AFFPPVTGG-------------------------------------------------------------
1fm0D           AFFPPVTGG-------------------------------------------------------------
1nviD           AFFPPVTGG-------------------------------------------------------------
3biiD           AFFPPVTG--------------------------------------------------------------
1vjkA           GVFPPV----------------------------------------------------------------
1v8cA           DLFPPVAGG-------------------------------------------------------------
2q5wD           ALIPPVSGG-------------------------------------------------------------
1rwsA           EVIPVVSGG-------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           EILAEMRARWPLGRIALWHRLGRVDPGEASIAIVVSARHRKEAFAACQYAIDRVKQILPVWKKEHRKDGS
2qieA           QIGDEINEKWPGTITSIVHRIGPLQISDIAVLIAVSSPHRKDAYRANEYAIERIKEIVPIWKKEIWEDGS
2q5wE           QIGDEINEKWPGTITSIVHRIGPLQISDIAVLIAVSSPHRKDAYRANEYAIERIKEIVPIWKKEIWEDGS
2qieH           QIGDEINEKWPGTITSIVHRIGPLQISDIAVLIAVSSPHRKDAYRANEYAIERIKEIVPIWKKEIKWQG-
1nvjD           EIVDEARNRWPLGRVTVIHRIGELWPGDEIVFVGVTSAHRSSAFEAGQFIMDYLKTRAPFWKREATPEGD
2omdB           KIRQETIEKFGVKEVFIHHRLGLVKIGEPSFLVLAVGGHREETFKACRYAVDETKKRVPIWKKEIFKEGG
1nvjB           EIVDEARNRWPLGRVTVIHRIGELWPGDEIVFVGVTSAHRSSAFEAGQFIMDYLKTRAPFWKR-------
1fm0E           EIVDEARNRWPLGRVTVIHRIGELWPGDEIVFVGVTSAHRSSAFEAGQFIMDYLKTRAPFWKREATPEGD
2omdA           KIRQETIEKFGVKEVFIHHRLGLVKIGEPSFLVLAVGGHREETFKACRYAVDETKKRVPIWKKE------
1nvjC           EIVDEARNRWPLGRVTVIHRIGELWPGDEIVFVGVTSAHRSSAFEAGQFIMDYLKTRAPFWKRE------
1nvjA           EIVDEARNRWPLGRVTVIHRIGELWPGDEIVFVGVTSAHRSSAFEAGQFIMDYLKTRAPFWKR-------
1nvjF           EIVDEARNRWPLGRVTVIHRIGELWPGDEIVFVGVTSAHRSSAFEAGQFIMDYLKTRAPFWKR-------
1nvjE           EIVDEARNRWPLGRVTVIHRIGELWPGDEIVFVGVTSAHRSSAFEAGQFIMDYLKTRAPFWK--------
1jwbD           ----------------------------------------------------------------------
1fm0D           ----------------------------------------------------------------------
1nviD           ----------------------------------------------------------------------
3biiD           ----------------------------------------------------------------------
1vjkA           ----------------------------------------------------------------------
1v8cA           ----------------------------------------------------------------------
2q5wD           ----------------------------------------------------------------------
1rwsA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           FWVEGxxxxxxxx
2qieA           KW-----------
2q5wE           KW-----------
2qieH           -------------
1nvjD           RWVE---------
2omdB           EWVLG--------
1nvjB           -------------
1fm0E           RWVE---------
2omdA           -------------
1nvjC           -------------
1nvjA           -------------
1nvjF           -------------
1nvjE           -------------
1jwbD           -------------
1fm0D           -------------
1nviD           -------------
3biiD           -------------
1vjkA           -------------
1v8cA           -------------
2q5wD           -------------
1rwsA           -------------