[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tthe0:AAS80359.1

[Show Plain Result]


## Summary of Sequence Search
    1::417
   21::429     1e-26  30%  438 aa  UGPB_SALCH RecName: Full=sn-glycerol-3-phosphate-binding
   21::429     2e-26  30%  438 aa  UGPB_SALTY RecName: Full=sn-glycerol-3-phosphate-binding
   21::429     2e-26  30%  438 aa  UGPB_SALTI RecName: Full=sn-glycerol-3-phosphate-binding
   21::429     2e-26  30%  438 aa  UGPB_SALPA RecName: Full=sn-glycerol-3-phosphate-binding
   21::431     1e-25  30%  439 aa  UGPB_YERPS RecName: Full=sn-glycerol-3-phosphate-binding
   21::431     2e-25  30%  439 aa  UGPB_YERPN RecName: Full=sn-glycerol-3-phosphate-binding
   21::431     2e-25  30%  439 aa  UGPB_YERPE RecName: Full=sn-glycerol-3-phosphate-binding
   21::431     2e-25  30%  439 aa  UGPB_YERPA RecName: Full=sn-glycerol-3-phosphate-binding
   25::416     2e-24  30%  430 aa  UGPB_RHIME RecName: Full=sn-glycerol-3-phosphate-binding
   29::429     8e-24  28%  438 aa  UGPB_ECOLI RecName: Full=sn-glycerol-3-phosphate-binding
   29::429     8e-24  28%  438 aa  UGPB_ECO57 RecName: Full=sn-glycerol-3-phosphate-binding
   29::429     2e-23  28%  438 aa  UGPB_SHIF8 RecName: Full=sn-glycerol-3-phosphate-binding
   23::423     2e-23  30%  433 aa  UGPB_BRUSU RecName: Full=sn-glycerol-3-phosphate-binding
   23::423     2e-23  30%  433 aa  UGPB_BRUME RecName: Full=sn-glycerol-3-phosphate-binding
   23::423     2e-23  30%  433 aa  UGPB_BRUAB RecName: Full=sn-glycerol-3-phosphate-binding
   23::423     2e-23  30%  433 aa  UGPB_BRUA2 RecName: Full=sn-glycerol-3-phosphate-binding
   29::429     2e-23  28%  438 aa  UGPB_SHIDS RecName: Full=sn-glycerol-3-phosphate-binding
   29::429     4e-23  28%  438 aa  UGPB_SHIFL RecName: Full=sn-glycerol-3-phosphate-binding
   29::429     4e-23  28%  438 aa  UGPB_ECOUT RecName: Full=sn-glycerol-3-phosphate-binding
   29::429     4e-23  28%  438 aa  UGPB_ECOL6 RecName: Full=sn-glycerol-3-phosphate-binding
   29::429     4e-23  28%  438 aa  UGPB_ECOL5 RecName: Full=sn-glycerol-3-phosphate-binding
   29::429     4e-23  28%  438 aa  UGPB_ECOK1 RecName: Full=sn-glycerol-3-phosphate-binding
   21::431     3e-22  29%  439 aa  UGPB_YERE8 RecName: Full=sn-glycerol-3-phosphate-binding
  120::394     1e-20  33%  411 aa  Y3748_BRUSU RecName: Full=Putative binding protein BRA0748;Flags:
  120::394     1e-20  33%  411 aa  Y2991_BRUA2 RecName: Full=Putative binding protein BAB2_0491;Flags:
  120::394     1e-20  33%  411 aa  Y2784_BRUAB RecName: Full=Putative binding protein
   24::421     7e-20  28%  436 aa  UGPB_AGRT5 RecName: Full=sn-glycerol-3-phosphate-binding
   28::436     3e-17  27%  444 aa  UGPB_ERWCT RecName: Full=sn-glycerol-3-phosphate-binding
  137::417     2e-12  30%  421 aa  CYCB_BACSU RecName: Full=Cyclodextrin-binding protein;Flags:
   45::194     1e-10  31%  441 aa  Y1214_PYRHO RecName: Full=Uncharacterized ABC transporter
  139::330     4e-10  28%  433 aa  ARAN_BACSU RecName: Full=Probable arabinose-binding protein;Flags:
  138::420     5e-10  27%  423 aa  MALX_STRR6 RecName: Full=Maltose/maltodextrin-binding
  138::420     6e-10  27%  423 aa  MALX_STRPN RecName: Full=Maltose/maltodextrin-binding
  121::391     9e-09  31%  396 aa  MALE_ECOLI RecName: Full=Maltose-binding periplasmic
  121::391     9e-09  31%  396 aa  MALE_ECO57 RecName: Full=Maltose-binding periplasmic
  149::372     9e-09  30%  445 aa  ARAN_BACHD RecName: Full=Probable arabinose-binding protein;Flags:
   26::322     2e-08  27%  430 aa  YCJN_ECOLI RecName: Full=Putative ABC transporter
  117::386     5e-08  27%  453 aa  MALE_PYRAB RecName: Full=Maltotriose-binding protein;AltName:
   44::354     2e-07  29%  451 aa  YOE2_STRAT RecName: Full=Uncharacterized lipoprotein in oleD
  124::378     2e-07  25%  417 aa  MDXE_BACSU RecName: Full=Maltodextrin-binding protein mdxE;Flags:
  121::391     3e-07  29%  396 aa  MALE_ENTAE RecName: Full=Maltose-binding periplasmic
   74::183     9e-07  27%  420 aa  MSME_STRMU RecName: Full=Multiple sugar-binding protein;Flags:
  121::395     3e-06  29%  396 aa  MALE_SALTY RecName: Full=Maltose-binding periplasmic
   28::205     7e-06  26%  422 aa  YURO_BACSU RecName: Full=Uncharacterized ABC transporter
   98::367     7e-06  25%  434 aa  MALE_PYRFU RecName: Full=Maltotriose-binding protein;AltName:
  124::230     3e-05  36%  420 aa  UE38_DEIRA RecName: Full=Probable ABC transporter-binding protein
  140::227     6e-05  30%  420 aa  Y1039_PYRHO RecName: Full=Uncharacterized ABC transporter
  133::245     1e-04  31%  422 aa  LACE_RHIRD RecName: Full=Lactose-binding protein;       
    6::43      0.001  64%  386 aa  SUCC_BORPD RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit
  289::327     0.001  44%  357 aa  IDIA_SYNP6 RecName: Full=Iron deficiency-induced protein A;Flags:
  289::327     0.001  44%  357 aa  IDIA_SYNE7 RecName: Full=Iron deficiency-induced protein A;Flags:
    1::417

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxARAKVVAEFWHGFTGGAPKAALENLVVEFNKAQQGRCVRPV
UGPB_SALCH      -----------------------------ALAVTTIPFWHSMEGELGKE-VDSLAQRFNQANPDYKIVPV
UGPB_SALTY      -----------------------------ALAVTTIPFWHSMEGELGKE-VDSLAQRFNQANPDYKIVPV
UGPB_SALTI      -----------------------------ALAVTTIPFWHSMEGELGKE-VDSLAQRFNQANPDYKIVPV
UGPB_SALPA      -----------------------------ALAVTTIPFWHSMEGELGKE-VDSLAQRFNQANPDYKIVPV
UGPB_YERPS      -----------------------------ANAMAVTEFWHSMEGELGKE-VDSIADRFNQSQPDYKIVPV
UGPB_YERPN      -----------------------------ANAMAVTEFWHSMEGELGKE-VDSIADRFNQSQPDYKIVPV
UGPB_YERPE      -----------------------------ANAMAVTEFWHSMEGELGKE-VDSIADRFNQSQPDYKIVPV
UGPB_YERPA      -----------------------------ANAMAVTEFWHSMEGELGKE-VDSIADRFNQSQPDYKIVPV
UGPB_RHIME      ------------------------------------QWWHAMTG-ANNEMIEELTKEFNESQSTYKVVPV
UGPB_ECOLI      -------------------------------------FWHSMEGELGKE-VDSLAQRFNAENPDYKIVPT
UGPB_ECO57      -------------------------------------FWHSMEGELGKE-VDSLAQRFNAENPDYKIVPT
UGPB_SHIF8      -------------------------------------FWHSMEGELGKE-VDSLAQRFNAENPDYKIVPT
UGPB_BRUSU      -----------------------------AFAQTELAWWHGMTG-ANNEMVNELSKEFNESQSEYKIVPV
UGPB_BRUME      -----------------------------AFAQTELAWWHGMTG-ANNEMVNELSKEFNESQSEYKIVPV
UGPB_BRUAB      -----------------------------AFAQTELAWWHGMTG-ANNEMVNELSKEFNESQSEYKIVPV
UGPB_BRUA2      -----------------------------AFAQTELAWWHGMTG-ANNEMVNELSKEFNESQSEYKIVPV
UGPB_SHIDS      -------------------------------------FWHSMEGELGKE-VDSLAQRFNAENPDYKIVPT
UGPB_SHIFL      -------------------------------------FWHSMEGELGKE-VDSLAQRFNAENPDYKIVPT
UGPB_ECOUT      -------------------------------------FWHSMEGELGKE-VDSLAQRFNAENPDYKIVPT
UGPB_ECOL6      -------------------------------------FWHSMEGELGKE-VDSLAQRFNAENPDYKIVPT
UGPB_ECOL5      -------------------------------------FWHSMEGELGKE-VDSLAQRFNAENPDYKIVPT
UGPB_ECOK1      -------------------------------------FWHSMEGELGKE-VDSLAQRFNAENPDYKIVPT
UGPB_YERE8      -----------------------------ANAMAVTEFWHSMEGELG-VEVNSLADRFNQSHSDYKIVPV
Y3748_BRUSU     ----------------------------------------------------------------------
Y2991_BRUA2     ----------------------------------------------------------------------
Y2784_BRUAB     ----------------------------------------------------------------------
UGPB_AGRT5      -----------------------------AFAATEIQWWHAMTG-ANNEVVDTLAKEFNDSQKDYKITPV
UGPB_ERWCT      -----------------------------AQAATDIPFWHSMEGELGKE-VNSLADRFNKEHTDVKIVPV
CYCB_BACSU      ----------------------------------------------------------------------
Y1214_PYRHO     ------------------------------------EIYHWWTAGGEKEAFDALAKKFEKKYPNIKIKPV
ARAN_BACSU      ----------------------------------------------------------------------
MALX_STRR6      ----------------------------------------------------------------------
MALX_STRPN      ----------------------------------------------------------------------
MALE_ECOLI      ----------------------------------------------------------------------
MALE_ECO57      ----------------------------------------------------------------------
ARAN_BACHD      ----------------------------------------------------------------------
YCJN_ECOLI      ------------------------------KTNVSIEFMHSSVEQERQAVISKLIARFEKENPGITVKQV
MALE_PYRAB      ----------------------------------------------------------------------
YOE2_STRAT      ------------------------------------------------AATKELVGEWNATHPDVKVEYI
MDXE_BACSU      ----------------------------------------------------------------------
MALE_ENTAE      ----------------------------------------------------------------------
MSME_STRMU      ----------------------------------------------------------------------
MALE_SALTY      ----------------------------------------------------------------------
YURO_BACSU      -----------------------------ADGKVTLKFFHRWPKEPEKSYFEEVVKEFEKDHPDIDIQAV
MALE_PYRFU      ----------------------------------------------------------------------
UE38_DEIRA      ----------------------------------------------------------------------
Y1039_PYRHO     ----------------------------------------------------------------------
LACE_RHIRD      ----------------------------------------------------------------------
SUCC_BORPD      ----------------------------------------------------------------------
IDIA_SYNP6      ----------------------------------------------------------------------
IDIA_SYNE7      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           PQGGYRDLSTKIKAAFAAGKVPAMAQAFENNIALYLEAKALLPIESLGVRLQGVNLTFLNAVRFGGVVYG
UGPB_SALCH      YKGNYEQNLSAGIAAFRTGNAPAILQVYEVGTATMMASKAIKPVYEV-FKDAGINFDFVPTVAGSGHLLS
UGPB_SALTY      YKGNYEQNLSAGIAAFRTGNAPAILQVYEVGTATMMASKAIKPVYEV-FKDAGINFDFVPTVAGSGHLLS
UGPB_SALTI      YKGNYEQNLSAGIAAFRTGNAPAILQVYEVGTATMMASKAIKPVYEV-FKDAGINFDFVPTVAGSGHLLS
UGPB_SALPA      YKGNYEQNLSAGIAAFRTGNAPAILQVYEVGTATMMASKAIKPVYEV-FKDAGINFDFVPTVAGSGHLLS
UGPB_YERPS      YKGNYEQSLAAGIAAFRSGKAPAILQVYEVGTATMMASKAIKPVYQV---FKDANIDFDESVFVPGRLLS
UGPB_YERPN      YKGNYEQSLAAGIAAFRSGKAPAILQVYEVGTATMMASKAIKPVYQV---FKDANIDFDESVFVPGRLLS
UGPB_YERPE      YKGNYEQSLAAGIAAFRSGKAPAILQVYEVGTATMMASKAIKPVYQV---FKDANIDFDESVFVPGRLLS
UGPB_YERPA      YKGNYEQSLAAGIAAFRSGKAPAILQVYEVGTATMMASKAIKPVYQV---FKDANIDFDESVFVPGRLLS
UGPB_RHIME      FKGTYPETLNAGIAAFRSKQPPAIIQVFDAGSGTMMAAEAIVPAAEI---LQKGGFTFDKSQYLPGIVLS
UGPB_ECOLI      YKGNYEQNLSAGIAAFRTGNAPAILQVYEVGTATMMASKAIKPVKEAGIQFDESQFVPTVSGYYSGHLLS
UGPB_ECO57      YKGNYEQNLSAGIAAFRTGNAPAILQVYEVGTATMMASKAIKPVKEAGIQFDESQFVPTVSGYYSGHLLS
UGPB_SHIF8      YKGNYEQNLSAGIAAFRTGNAPAILQVYEVGTATMMASKAIKPVKEAGIQFDESQFVPTVSGYYSGHLLS
UGPB_BRUSU      YKGNYPETLNAGIAAFRSKQPPAILQVFDAGSGVMMAAEAIVPLEKGGYKLPGIVAYYSKP---DGTMLS
UGPB_BRUME      YKGNYPETLNAGIAAFRSKQPPAILQVFDAGSGVMMAAEAIVPLEKGGYKLPGIVAYYSKP---DGTMLS
UGPB_BRUAB      YKGNYPETLNAGIAAFRSKQPPAILQVFDAGSGVMMAAEAIVPLEKGGYKLPGIVAYYSKP---DGTMLS
UGPB_BRUA2      YKGNYPETLNAGIAAFRSKQPPAILQVFDAGSGVMMAAEAIVPLEKGGYKLPGIVAYYSKP---DGTMLS
UGPB_SHIDS      YKGNYEQNLSAGIAAFRTGNAPAILQVYEVGTATMMASKAIQPVKEAGIQFDESQFVPTVSGYYSGHLLS
UGPB_SHIFL      YKGNYEQNLSAGIAVFRTGNAPAILQVYEVGTATMMASKAIKPVKEAGIQFDESQFVPTVSGYYSGHLLS
UGPB_ECOUT      YKGNYEQNLSAGIAAFRTGNAPAILQVYEVGTATMMASKAIKPVKEAGIQFDESQFVPTVSGYYSGHLLS
UGPB_ECOL6      YKGNYEQNLSAGIAAFRTGNAPAILQVYEVGTATMMASKAIKPVKEAGIQFDESQFVPTVSGYYSGHLLS
UGPB_ECOL5      YKGNYEQNLSAGIAAFRTGNAPAILQVYEVGTATMMASKAIKPVKEAGIQFDESQFVPTVSGYYSGHLLS
UGPB_ECOK1      YKGNYEQNLSAGIAAFRTGNAPAILQVYEVGTATMMASKAIKPVKEAGIQFDESQFVPTVSGYYSGHLLS
UGPB_YERE8      YKGNYEQSLAAGIAAFRSGKAPAILQVYEVGTATMMASKAIKPVFQV---FKDANINFDESVFVPGHLLS
Y3748_BRUSU     --------------------------------------------------------TFLSPSVLDGKTYG
Y2991_BRUA2     --------------------------------------------------------TFLSPSVLDGKTYG
Y2784_BRUAB     --------------------------------------------------------TFLSPSVLDGKTYG
UGPB_AGRT5      FKGTYPETLNAGIAAFRAKQPPAIIQVFD--XXXXXXXXXXXXIKPVADVLKEGGYTFNKDEYLAGIVLS
UGPB_ERWCT      YKGNYEQNLXXXXXXXXXXXXXXXLQVYEVGTATMMASKAIKPVYEV-FKDAGINFVFVPTVSGSGHLLS
CYCB_BACSU      -------------------------------------------------------------------LYG
Y1214_PYRHO     SGGGGVNLKMVLQSLMLAGKPPDTFQVHAGEMARYIKANQLTPIDDIWTEDMKKNYVIQQMVIFNNHYYA
ARAN_BACSU      -----------------------------------------------------------------GKLYG
MALX_STRR6      -----------------------------------------------------------------GKVYG
MALX_STRPN      -----------------------------------------------------------------GKVYG
MALE_ECOLI      -----------------------------------------------------------DAVRYNGKLIA
MALE_ECO57      -----------------------------------------------------------DAVRYNGKLIA
ARAN_BACHD      -----------------------------------------------------------------GEYYG
YCJN_ECOLI      PEDAY---NTKVITLSRSGSLPEVIET-SHDYAKVMDKEQLIDRKAVATVISNVGEGVLRIVRTGSAWTG
MALE_PYRAB      ------DLENALKVAIPAGQGPDLFIWAHDWIGKFAEAGLLEPIDEYITDLQKFAPMAREAIEYKGHYYA
YOE2_STRAT      -QGSWDSVHDQLLTSFEGGEAPDVIHDASDDLADFAYGGYLADLSGLPARLASIPRGSWETATFGRGVYG
MDXE_BACSU      ----------------------------------------------------------MQQVTVDGKVYG
MALE_ENTAE      -----------------------------------------------------------DAVRYNGKLIA
MSME_STRMU      ------DAGTVLKTRVLSGDVPDVINIYPQNMDFQEWSKAGYFYNMTGAYLNHLKNHYANEYKVNQKVYS
MALE_SALTY      -----------------------------------------------------------DAVRYNGKLIA
YURO_BACSU      LNDSYKD---KIKVMLGTTSPPDIYFSWSDEFAFFIRGNKALDLSSYYVQSQITPFTYENKQ------YG
MALE_PYRFU      ------NLEDALKAAIPTGQGPDLFIWAHDWIGKFAEAGLLEPIDEYVTELNEFAPMAQDAMQYKGHYYA
UE38_DEIRA      ----------------------------------------------------------------GGKLIA
Y1039_PYRHO     ----------------------------------------------------------LDSVTVDGKIYG
LACE_RHIRD      -----------------------------------------------------------------GQVYG
SUCC_BORPD      ----------------------------------------------------------------------
IDIA_SYNP6      ----------------------------------------------------------------------
IDIA_SYNE7      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VPFNKSIQVLYYNKDLLKKHGVPVPATLEEFVAAAKKLSRAEGGPVYWFQPDASTFAYFFFNLGGSYLKD
UGPB_SALCH      QPFNSSTPVLYYNKDAFKKAGLDLPKTWQELADYTAKLRAAASGWQGWIQLEAWNGLPFASKNNGFDGTD
UGPB_SALTY      QPFNSSTPVLYYNKDAFKKAGLDPPKTWQELADYTAKLRAAASGWQGWIQLEAWNGLPFASKNNGFDGTD
UGPB_SALTI      QPFNSSTPVLYYNKDAFKKAGLDPPKTWQELADYTAKLRAAASGWQGWIQLEAWNGLPFASKNNGFDGTD
UGPB_SALPA      QPFNSSTPVLYYNKDAFKKAGLDPPKTWQELADYTAKLRAAASGWQGWIQLEAWNGLPFASKNNGFDGTD
UGPB_YERPS      QPFNSSTPVLYYNKEAFKKAGLDPPKTWQELAADTAKLRAAGSSCGYWIQIENFSAWHIASRNNGFDGTD
UGPB_YERPN      QPFNSSTPVLYYNKEAFKKAGLDPPKTWQELAADTAKLRAAGSSCGYWIQIENFSAWHIASRNNGFDGTD
UGPB_YERPE      QPFNSSTPVLYYNKEAFKKAGLDPPKTWQELAADTAKLRAAGSSCGYWIQIENFSAWHIASRNNGFDGTD
UGPB_YERPA      QPFNSSTPVLYYNKEAFKKAGLDPPKTWQELAADTAKLRAAGSSCGYWIQIENFSAWHIASRNNGFDGTD
UGPB_RHIME      FPYNSSSPILYYNKDAFQKAGLNVPKTWPEVFEAAKKIKTSGAAPLTWIQTEAWNNVPYGTNENGLGGTD
UGPB_ECOLI      QPFNSSTPVLYYNKDAFKKAGLDPPKTWQDLADYAAKLKASASGWQGWIQLEAWNGLPFASKNNGFDGTD
UGPB_ECO57      QPFNSSTPVLYYNKDAFKKAGLDPPKTWQDLADYAAKLKASASGWQGWIQLEAWNGLPFASKNNGFDGTD
UGPB_SHIF8      QPFNSSTPVLYYNKDAFKKAGLDPPKTWQDLADYSAKLKASASGWQGWIQLEAWNGLPFASKNNGFDGTD
UGPB_BRUSU      FPYNSSSPILYYNKDAFKKAGLDEPKTWPEVFEAAKKIKASGASPLTWIQTEAWNNVPYGTNENGLAGTD
UGPB_BRUME      FPYNSSSPILYYNKDAFKKAGLDEPKTWPEVFEAAKKIKASGASPLTWIQTEAWNNVPYGTNENGLAGTD
UGPB_BRUAB      FPYNSSSPILYYNKDAFKKAGLDEPKTWPEVFEAAKKIKASGASPLTWIQTEAWNNVPYGTNENGLAGTD
UGPB_BRUA2      FPYNSSSPILYYNKDAFKKAGLDEPKTWPEVFEAAKKIKASGASPLTWIQTEAWNNVPYGTNENGLAGTD
UGPB_SHIDS      QPFNSSTPVLYYNKDAFKKAGLDPPKTWQDLADYAAKL-KASGGRIQLENFSAWNGLPFASKNNGFDGTD
UGPB_SHIFL      QPFNSSTSVLYYNKDAFKKAGLDPPKTWQDLADYSAKLKASASGWQGWIQLEAWNGLPFASKNNGFDGTD
UGPB_ECOUT      QPFNSSTPVLYYNKDAFKKAGLDPPKTWQDLADYAAKLKASASGWQGWIQLEAWNGLPFASKNNGFDGTD
UGPB_ECOL6      QPFNSSTPVLYYNKDAFKKAGLDPPKTWQDLADYAAKLKASASGWQGWIQLEAWNGLPFASKNNGFDGTD
UGPB_ECOL5      QPFNSSTPVLYYNKDAFKKAGLDPPKTWQDLADYAAKLKASASGWQGWIQLEAWNGLPFASKNNGFDGTD
UGPB_ECOK1      QPFNSSTPVLYYNKDAFKKAGLDPPKTWQDLADYAAKLKASASGWQGWIQLEAWNGLPFASKNNGFDGTD
UGPB_YERE8      QPFNSSTPVLYYNKDAFKKAGLQPPKTWQELAEDTAKLRAAGSSCGYWIQIENFSAWHIASRNNGFDGTD
Y3748_BRUSU     LPIAASARAMYYNKDLFEKAGIKPPANWDELKADAAKI-KALGGENYGFGKEIETDVYYYYSYGTEILKD
Y2991_BRUA2     LPIAASARAMYYNKDLFEKAGIKPPANWDELKADAAKI-KALGGENYGFGKEIETDVYYYYSYGTEILKD
Y2784_BRUAB     LPIAASARAMYYNKDLFEKAGIKPPANWDELKADAAKI-KALGGENYGFGKEIETDVYYYYSYGTEILKD
UGPB_AGRT5      FPYNSSSPILYYNKDIFQKAGLDAPKTWPEVFEAAKKIKTSGAAQLTWIQTEAWNNVSYGSNENGLGGTD
UGPB_ERWCT      QPFNSSTPVLYYNKDAFKKAGLDPPKTWQQMADYTAKLRSAASGWQGWIQIEAWNGLPVATKNNGFDGTD
CYCB_BACSU      LPKAVETTVLFYNKDLITEK--ELPKTLEEWYDYSKK--TADGSQIYYAESVMSGYGGYIFGKAGSY-NP
Y1214_PYRHO     VPINHRANVIWYNKQIFKKYGIDPSSTIDDLFAVAEKL--------------------------------
ARAN_BACSU      LDTHVGTTVMFYNMDVMKKAGVNPDKTWDDYHKAGQKVRKVTGKPMGTVETDSATFLSMISQQNSGYFKN
MALX_STRR6      APAVIESLVMYYNKDLV-KDAPKTFADLENLAKDSKYAFAGEDGKTTAFLADWTNFYYTYGLLNGAYVKD
MALX_STRPN      APAVIESLVMYYNKDLV-KDAPKTFADLENLAKDSKYAFAGEDGKTTAFLADWTNFYYTYGLLAGNFGQN
MALE_ECOLI      YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
MALE_ECO57      YPIAVEALSLIYNKDLLPN----PPKTWEEIPALDKEL-KAKGKSALMFNLQEPYFTWPLIAADGGYYEN
ARAN_BACHD      IPTHVGASVMYYNKEIMDEAGVDIESTWDDYVEAGKQVVERTGKVMTTVPTDDYLPMFQMVSQRGSFDEN
YCJN_ECOLI      VPVSAWIGGIWYRKDVLAKAGLEEPKNWQQLLDVAQKLNDPANKKYGIALPTAQSFSQFLSNQANVFNAE
MALE_PYRAB      LPFAAETVAMIYNKKIVSEP----PKTFDELKEVMEKYYDPNNEKYGIAWPINAYFISAIAQAFGGYYFD
YOE2_STRAT      VPFLQEPRVLIADADRLRAAKVRIPTSWPEFRQVAKKLTGPGRYGVAWLKEPVSATLNLSLSAGGRLFAD
MDXE_BACSU      MPLVIETLILYYNKDLLK----TAPKTFKDLFAFASEKGKSTGFLAKWYMSYGLLAGYGGYVFGKNGTDS
MALE_ENTAE      YPVAVEALSLIYNKDL-----VPNPPKTWEEIPALDKALKAKGKSALMFNLQEPYFTWPLIAADGGYFEN
MSME_STRMU      VPLTANVSGIYYNKTKFKELGLKVPETWDEFVKLVEEIKAKKETP-------------------------
MALE_SALTY      YPIAVEALSLIYNKDL-----VPNPPKTWEEIPALDKELKVKGKSAIMFNLQEPYFTWPLIAADGGYFEN
YURO_BACSU      VPWQMDAKSFFYNKDIFQKLNLDPPKTWDELIDVSKKLKEHGYTPISFGTKATWTISHYIGTL-------
MALE_PYRFU      LPFAAETVAIIYNKEMVSEP----PKTFDEMKAIMEKYYDPANEKYGIAWPINAYFISAIAQAFGGYYFD
UE38_DEIRA      MPWFTDAGVLYYRTDLLKKYGYNAPKTWNELATMAQKIQAGESNPKYVFQGKTCDALEWISSFGGGSIVD
Y1039_PYRHO     APFTAAAKPFWYRKSFFEKHNLKPPKTWDDFVALLEEIKKVSGDSVGW--PLSDVTEHFILTFGGKDLQ-
LACE_RHIRD      VPFDSGVTGLYYRTDYLEQAGFKPELTWDRFIEIGKEVKAKTGHEMMALDANDGGLIRIMMQSGGQWYED
SUCC_BORPD      ----------YQGKELLKQFGVPVPRSVDEAVAAAEKL----GGPVW-----------------------
IDIA_SYNP6      ----------------------------------------------------------------------
IDIA_SYNE7      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GKLVLNSKEAVEALTLLQNGVKEGWAKPITSGYINQNLGSGPYAFSVDTSAGYTYYLRAAKFDLGVATLP
UGPB_SALCH      AVLEFNKPEQVKHIALLEEMNKKGDFSYVRKDESTEKFYNGDCAMTTASSGSLANIRQYAKFNYGVGMMP
UGPB_SALTY      AVLEFNKPEQVKHIALLEEMNKKGDFSYVRKDESTEKFYNGDCAMTTASSGSLANIRQYAKFNYGVGMMP
UGPB_SALTI      AVLEFNKPEQVKHIALLEEMNKKGDFSYVRKDESTEKFYNGDCAMTTASSGSLANIRQYAKFNYGVGMMP
UGPB_SALPA      AVLEFNKPEQVKHIALLEEMNKKGDFSYVRKDESTEKFYNGDCAMTTASSGSLANIRQYAKFNYGVGMMP
UGPB_YERPS      AVLEFNKPLQIKHIQLLSDMNKKGRKDESTSKFYN-----GDCAITTASSGSLASIRHYAKFNFGVGMMP
UGPB_YERPN      AVLEFNKPLQVKHIQLLSDMNKKGRKDESTSKFYN-----GDCAITTASSGSLASIRHYAKFNFGVGMMP
UGPB_YERPE      AVLEFNKPLQVKHIQLLSDMNKKGRKDESTSKFYN-----GDCAITTASSGSLASIRHYAKFNFGVGMMP
UGPB_YERPA      AVLEFNKPLQVKHIQLLSDMNKKGRKDESTSKFYN-----GDCAITTASSGSLASIRHYAKFNFGVGMMP
UGPB_RHIME      VKLQINAPLYVEHFQAIADLAKDGFRYGGRTSEAKQLFTSGECAILTESSGGLGDIAKSG-VNYGIGQLP
UGPB_ECOLI      AVLEFNKPEQVKHIAMLEEMNKKGDFSYVRKDESTEKFYNGDCAMTTASSGSLANIREYAKFNYGVGMMP
UGPB_ECO57      AVLEFNKPEQVKHIAMLEEMNKKGDFSYVRKDESTEKFYNGDCAMTTASSGSLANIREYAKFNYGVGMMP
UGPB_SHIF8      AVLEFNKPEQVKHIAMLEEMNKKGDFSYVRKDESTEKFYNGDCAMTTASSGSLANIREYAKFNYGVGMMP
UGPB_BRUSU      VKLEINSPLYVEHFQAIADLAKDGTFRGGRTSEAKQLFTSGECAMLTESSGGLGDVVKSG-INYGIGQLP
UGPB_BRUME      VKLEINSPLYVEHFQAIADLAKDGTFRGGRTSEAKQLFTSGECAMLTESSGGLGDVVKSG-INYGIGQLP
UGPB_BRUAB      VKLEINSPLYVEHFQAIADLAKDGTFRGGRTSEAKQLFTSGECAMLTESSGGLGDVVKSG-INYGIGQLP
UGPB_BRUA2      VKLEINSPLYVEHFQAIADLAKDGTFRGGRTSEAKQLFTSGECAMLTESSGGLGDVVKSG-INYGIGQLP
UGPB_SHIDS      AVLEFNKPEQVKHIAMLEEMNKKGDFSYVRKDESTEKFYNGDCAMTTASSGSLANIREYAKFNYGVGMMP
UGPB_SHIFL      AVLEFNKPEQVKHIAMLEEMNKKGDFSYVRKDESTEKFYNGDCAMTTASSGSLANIREYAKFNYGVGMMP
UGPB_ECOUT      AVLEFNKPEQVKHIAMLEEMNKKGDFSYVRKDESTEKFYNGDCAMTTASSGSLANIREYAKFNYGVGMMP
UGPB_ECOL6      AVLEFNKPEQVKHIAMLEEMNKKGDFSYVRKDESTEKFYNGDCAMTTASSGSLANIREYAKFNYGVGMMP
UGPB_ECOL5      AVLEFNKPEQVKHIAMLEEMNKKGDFSYVRKDESTEKFYNGDCAMTTASSGSLANIREYAKFNYGVGMMP
UGPB_ECOK1      AVLEFNKPEQVKHIAMLEEMNKKGDFSYVRKDESTEKFYNGDCAMTTASSGSLANIREYAKFNYGVGMMP
UGPB_YERE8      AVLEFNKPLQVKHIQLLSDMNKKGRKDESTAKFYN-----GDCAITTASSGSLADIRHYAKFNYGVGMMP
Y3748_BRUSU     GTSGLSTPGALEAAKLYKSMIDDGLTQPGVTSYARQNLFKQGKVGMMITAPFLSNQIKAPNLKYGVAAIP
Y2991_BRUA2     GTSGLSTPGALEAAKLYKSMIDDGLTQPGVTSYARQNLFKQGKVGMMITAPFLSNQIKAPNLKYGVAAIP
Y2784_BRUAB     GTSGLSTPGALEAAKLYKSMIDDGLTQPGVTSYARQNLFKQGKVGMMITAPFLSNQIKAPNLKYGVAAIP
UGPB_AGRT5      VKLAVNAPLFVEHFQAIADLAKDGFRYGGRTSEAKQLFMSGECGILTESSGGLGDIVKTG-MNYGIGQLP
UGPB_ERWCT      TVLEFNKPTQVKHIQLLQDMNKKGFTYFGRKDEPTEKFYNGECAMTTASSGSLANIREHAKFNYGVGMMP
CYCB_BACSU      SDIGINNEGAVKGAALIQKFYKDGL---FPAGIIGEQIISGPWNVEAFSNAGINY---------GITKLP
Y1214_PYRHO     ----------------------------------------------------------------------
ARAN_BACSU      GKLILNNDTNVKTLQYLKDMINDKTMIPAPGGFMNQG-GAASVLMPIWYMGRFIDYMPDLKGKIAIRPLP
MALX_STRR6      AKDIGLANDGSIAGINYAKSWYEKWPKGMAGNLIQTQFQEGKTAAIID-GPWKAQAFKDAKVNYGVATIP
MALX_STRPN      GKDAKDIGLANDGSIVGINYAKEKWPKGMAGNLIQTQFQEGKTAAIID-GPWKAQAFKDAKVNYGVATIP
MALE_ECOLI      GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
MALE_ECO57      GKVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDTS----------KVNYGVTVLP
ARAN_BACHD      GNLTLDTQENIEVLQFLYDLIYVHEIAELTPG--GQPHAEEYYQYNVASMAMPIWYM--GRFLDNMPDLA
YCJN_ECOLI      GKITLDTPEMMQALTYYRNDIME-----VKDAFMN---GTAPMAI-------YSTYILPAVIKEGVGFVV
MALE_PYRAB      DKTELDKPETIEGFKFFFENIWPYMAP--TADYNTQQSGRAPIMVNGPWSIGS---VKDAGIDFGVAPLP
YOE2_STRAT      DKVTVRFEAGDEVVARTQVAVDREHAPASTLGSGGADLFGGRYAM---VPLGFSYIVRQAPEDFHWQVLP
MDXE_BACSU      GDIGLNNKGAVEAVKYAEKWFETYWPKGMADDFIQQMFLEGKAAAIIGGPWSAANY-KEAKLNYGAAPIP
MALE_ENTAE      GKVGVDSAGAKAGLTFLVDLIKNKHMNADTDYSIAENKGNGPWAWSIDKS----------KVNYGVTLLP
MSME_STRMU      ----------------------------------------------------------------------
MALE_SALTY      GKVGVDNAGAKAGLTFLIDMIKNKNMSADTDYSIAENKGNGPWAWSIDKS----------KVNYGVTLLP
YURO_BACSU      ----------------------------------------------------------------------
MALE_PYRFU      DKTEQPGLDKPETIEGFKFFFTEIWPYMAPTGDYNTQMVNGPWSINDVKKAGINF---------GVVPLP
UE38_DEIRA      GKITVNNPKAVQALQAIQ----------------------------------------------------
Y1039_PYRHO     ----------------------------------------------------------------------
LACE_RHIRD      GSLNITGNAALKALETQARIVNERVAKP-TSG--------------------------------------
SUCC_BORPD      ----------------------------------------------------------------------
IDIA_SYNP6      ----------------------------------------------------------------------
IDIA_SYNE7      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GRTKGQPGYGLVQGTNLVVFRQASKEEQAVAKDFLEFVLSPRAQAVFATATGYVPVTEGALKDPVYQAYA
UGPB_SALCH      ADIKGAPQNAIIGGASLWVMQGKDKETYTGVAKFLDFLAKPENAAEWHQKTGYLPITTAAYELTREQGYY
UGPB_SALTY      ADIKGAPQNAIIGGASLWVMQGKDKETYTGVAKFLDFLAKPENAAEWHQKTGYLPITTAAYELTREQGYY
UGPB_SALTI      ADIKGAPQNAIIGGASLWVMQGKDKETYTGVAKFLDFLAKPENAAEWHQKTGYLPITTAAYELTREQGYY
UGPB_SALPA      ADIKGAPQNAIIGGASLWVMQGKYKETYTGVAKFLDFLAKPENAAEWHQKTGYLPITTAAYELTREQGYY
UGPB_YERPS      ADAKNAPQNAIIGGASLWVMDGKDKETYKGVAEFLQYLVKPEIAAEWHQKTGYLPITTAAYELTKQQGFY
UGPB_YERPN      ADAKNAPQNAIIGGASLWVMDGKDKETYKGVAEFLQYLVKPEIAAEWHQKTGYLPITTAAYELTKQQGFY
UGPB_YERPE      ADAKNAPQNAIIGGASLWVMDGKDKETYKGVAEFLQYLVKPEIAAEWHQKTGYLPITTAAYELTKQQGFY
UGPB_YERPA      ADAKNAPQNAIIGGASLWVMDGKDKETYKGVAEFLQYLVKPEIAAEWHQKTGYLPITTAAYELTKQQGFY
UGPB_RHIME      YYEGHGPQNTIPGGASLWVFAGKSDEEYKGVAEFFNFLSQTEIQAKLHQVSGYMPVTMAAYEETKKSGFY
UGPB_ECOLI      ADAKDAPQNAIIGGASLWVMQGKDKETYTGVAKFLDFLAKPENAAEWHQKTGYLPITKAAYDLTREQGFY
UGPB_ECO57      ADAKDAPQNAIIGGASLWVMQGKDKETYTGVAKFLDFLAKPENAAEWHQKTGYLPITKAAYDLTREQGFY
UGPB_SHIF8      ADAKDAPQNAIIGGASLWVMQGKDKETYTGVAKFLDFLAKPENAAEWHQKTGYLPITKAAYDLTREQGFY
UGPB_BRUSU      YYEGHGPQNTIPGGASLWVFAGLSDDQYKGIAEFFNFLSQTKIQVKLHEKSGYLPVTLAAYEETKKSDFY
UGPB_BRUME      YYEGHGPQNTIPGGASLWVFAGLSDDQYKGIAEFFNFLSQSKIQVKLHEKSGYLPVTLAAYEETKKSDFY
UGPB_BRUAB      YYEGHGPQNTIPGGASLWVFAGLSDDQYKGIAEFFNFLSQTKIQVKLHEKSGYLPVTLAAYEETKKSDFY
UGPB_BRUA2      YYEGHGPQNTIPGGASLWVFAGLSDDQYKGIAEFFNFLSQTKIQVKLHEKSGYLPVTLAAYEETKKSDFY
UGPB_SHIDS      ADAKDAPQNAIIGGASLWVMQGKDKETYTGVAKFLDFLAKPENAAEWHQKTGYLPITKAAYDLTREQGFY
UGPB_SHIFL      ADAKDAPQNAIIGGASLWVMQGKDKETYTGVAKFLDFLAKPENAAEWHQKTGYLPITKAAYDLTREQGFY
UGPB_ECOUT      ADAKDAPQNAIIGGASLWVMQGKDKETYTGVAKFLDFLAKPENAAEWHQKTGYLPITKAAYDLTREQGFY
UGPB_ECOL6      ADAKDAPQNAIIGGASLWVMQGKDKETYTGVAKFLDFLAKPENAAEWHQKTGYLPITKAAYDLTREQGFY
UGPB_ECOL5      ADAKDAPQNAIIGGASLWVMQGKDKETYTGVAKFLDFLAKPENAAEWHQKTGYLPITKAAYDLTREQGFY
UGPB_ECOK1      ADAKDAPQNAIIGGASLWVMQGKDKETYTGVAKFLDFLAKPENAAEWHQKTGYLPITKAAYDLTREQGFY
UGPB_YERE8      ADAKDAPQNAIIGGASLWVMDGKDKDTYKGVAEFLQFLTQPEIAAEWHQKTGYLPITTAAYELTKQQGFY
Y3748_BRUSU     AGPTGARGYGV---TDSVIMFQNSKNKEEAWK-VLDFLFQKDWRAKFTQNEGFLPVN----KEEAKMDYY
Y2991_BRUA2     AGPTGARGYGV---TDSVIMFQNSKNKEEAWK-VLDFLFQKDWRAKFTQNEGFLPVN----KEEAKMDYY
Y2784_BRUAB     AGPTGARGYGV---TDSVIMFQNSKNKEEAWK-VLDFLFQKDWRAKFTQNEGFLPVN----KEEAKMDYY
UGPB_AGRT5      YYEGHGPQNTIPGGASLWVFGGKSDAEYKGVAEFFHFLSQTKIQSRLHQVSGYMPVTIAAYEETKKSGFY
UGPB_ERWCT      ADAKGAPQNAIIGGASLWVMGGKDAATYKGVAEFMQFLAKPENAAEWHQKTGYLPITTAAYELTQKQGFY
CYCB_BACSU      KLENGKSSFIGVKSYNVSAF---SKNEE-LAQELAVFLANEKNSKTRYEETKEVPAVKSLANDPAIMKSE
Y1214_PYRHO     ----------------------------------------------------------------------
ARAN_BACSU      AWKEGGDRSAGLGGTATVVPKQSKHVE--LAKEFLAF---------------------------------
MALX_STRR6      TLPNGKE-YAAFGGGKAWVIPQAVKNLEASQK-FVDFLVATEQQKVLYDKTNEIPANTEA------RSYA
MALX_STRPN      TLPNGKE-YAAFGGGKAWVIPQAVKNLEASQK-FVDFLVATEQQKVLYDKTNEIPANTEA------RSYA
MALE_ECOLI      -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
MALE_ECO57      -TFKGQPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDEGLEAVNKGAVALKSYEEEL
ARAN_BACHD      GKMLIQPGMG---GTGTVVTNQTDHEE--LAKDFLAYAISEKANEKLWTILGFDPPRWDVWDNPVFQ---
YCJN_ECOLI      PTEKNSAVYGML--TSLTITAGQKTEETEAAEKFVTFM--------------------------------
MALE_PYRAB      GKEYWPRPYG---GVKLIYFAAGTHNKDAAWKFVKWFTTNPEVIKQLALDLGYIPVLSEVLNDP------
YOE2_STRAT      APAGAG---GLTQGVSLSVSADCPHKKEAVA--FIDFLLRPRNMVRLALGDWMLPTGTQALKDP------
MDXE_BACSU      TLPNGEEYAPFAGGKGWVASKYTKEPE--LAEKWLXXXXXXXXXXXXXXXTNEVPANTAARK----KADE
MALE_ENTAE      -TFKGKPSKPFVGVLSAGI--NAASPNKELAKEFLELMTDPGLEAV----NNDKPL--GAVAVKSFQEKL
MSME_STRMU      ----------------------------------------------------------------------
MALE_SALTY      -TFKGKPSKPFVGVLSAGI--NAASPNKELAKEFLENYL--------LTDQGLEAVNKGAVALKSFQEQL
YURO_BACSU      ----------------------------------------------------------------------
MALE_PYRFU      GKEYWPRPYG---GVKLIYFAAGIKNKDAAWKFAKWLTTSEESIKTLALELGYIPVLTKVLDDP------
UE38_DEIRA      ----------------------------------------------------------------------
Y1039_PYRHO     ----------------------------------------------------------------------
LACE_RHIRD      ----------------------------------------------------------------------
SUCC_BORPD      ----------------------------------------------------------------------
IDIA_SYNP6      ------------------------------AQLLLEYLLSSQAQAVFARGNGEYPVLRGVSLDPILAGF-
IDIA_SYNE7      ------------------------------AQLLLEYLLSSQAQAVFARGNGEYPVLRGVSLDPILAGF-


                         .         .         .         .         *         .         .:420
query           AENPDYATIVRQSRYAKFEPALAEWEQIRFDILGQAIKEAILNKADPKAALDRAQKLAEDLLSSRxx
UGPB_SALCH      DKNPGADIATRQMLNKPPLPRLGNMPQIR-TIVDEELESVWTGKKTPQQALDTAVDRGNQLL-----
UGPB_SALTY      DKNPGADIATRQMLNKPPLPRLGNMPQIR-TIVDEELESVWTGKKTPQQALDTAVDRGNQLL-----
UGPB_SALTI      DKNPGADIATRQMLNKPPLPRLGNMPQIR-TIVDEELESVWTGKKTPQQALDTAVDRGNQLL-----
UGPB_SALPA      DKNPGADIATRQMLNKPPLPRLGNMPQIR-TIVDEELESVWTGKKTPQQALDTAVERGNQLL-----
UGPB_YERPS      EQNPGADVATRQMLNKPPLPRLGNMPQIR-TVVDEELEAVWTGKKTPQAALDNSVKRGDVLL-----
UGPB_YERPN      EQNPGADVATRQMLNKPPLPRLGNMPQIR-TVVDEELEAVWTAKKTPQAALDNSVKRGDVLL-----
UGPB_YERPE      EQNPGADVATRQMLNKPPLPRLGNMPQIR-TVVDEELEAVWTAKKTPQAALDNSVKRGDVLL-----
UGPB_YERPA      EQNPGADVATRQMLNKPPLPRLGNMPQIR-TVVDEELEAVWTAKKTPQAALDNSVKRGDVLL-----
UGPB_RHIME      EKNPGRETLLQMMGKAPTENSLVNLPQVR-DILNEEFEAMLSGQQDAKTALDKA-------------
UGPB_ECOLI      EKNPGADTATRQMLNKPPLPRLGNMPQIRV-IVDEELESVWTGKKTPQQALDTAVERGNQLL-----
UGPB_ECO57      EKNPGADTATRQMLNKPPLPRLGNMPQIRV-IVDEELESVWTGKKTPQQALDTAVERGNQLL-----
UGPB_SHIF8      EKNPGADTATRQMLNKPPLPRLGNMPQIRV-IVDEELESVWTGKKTPQQALDTAVERGNQLL-----
UGPB_BRUSU      EKNPGRETPILQMMGK--EPTLVNLPQVR-DILNEEFEAMLGGKQDAKTALDNAVK-----------
UGPB_BRUME      EKNPGRETPILQMMGK--EPTLVNLPQVR-DILNEEFEAMLGGKQDAKTALDNAVK-----------
UGPB_BRUAB      EKNPGRETPILQMMGK--EPTLVNLPQVR-DILNEEFEAMLGGKQDAKTALDNAVK-----------
UGPB_BRUA2      EKNPGRETPILQMMGK--EPTLVNLPQVR-DILNEEFEAMLGGKQDAKTALDNAVK-----------
UGPB_SHIDS      EKNPGADTATRQMLNKPPLPRLGNMPQIRV-IVDEELESVWTGKKTPQQALDTAVERGNQLL-----
UGPB_SHIFL      EKNPGADTATRQMLNKPPLPRLGNMPQIRV-IVDEELESVWTGKKTPQQALDTAVERGNQLL-----
UGPB_ECOUT      EKNPGADIATRQMLNKPPLPRLGNMPQIRV-IVDEELESVWTGKKTPQQALDTAVERGNQLL-----
UGPB_ECOL6      EKNPGADIATRQMLNKPPLPRLGNMPQIRV-IVDEELESVWTGKKTPQQALDTAVERGNQLL-----
UGPB_ECOL5      EKNPGADIATRQMLNKPPLPRLGNMPQIRV-IVDEELESVWTGKKTPQQALDTAVERGNQLL-----
UGPB_ECOK1      EKNPGADIATRQMLNKPPLPRLGNMPQIRV-IVDEELESVWTGKKTPQQALDTAVERGNQLL-----
UGPB_YERE8      DKNPGADVATRQMLNKPPLPRLGNMPQIR-TVVDEELEGVWTGKKTPQQALDTAVSRGDVLL-----
Y3748_BRUSU     VNNADLAAFTALLPDARFAPVIPGWEEIA-DITSNAMQSIYLGKGEP--------------------
Y2991_BRUA2     VNNADLAAFTALLPDARFAPVIPGWEEIA-DITSNAMQSIYLGKGEP--------------------
Y2784_BRUAB     VNNADLAAFTALLPDARFAPVIPGWEEIA-DITSNAMQSIYLGKGEP--------------------
UGPB_AGRT5      DKNPARETPLLQTENSK-GVRLVNLPQVR-DIMNEEFEAMLAGKQDAKAALDK--------------
UGPB_ERWCT      EKNPGADIATRQMLNKPPLPRLGNMPQIR-TVVDEELESVWTGKKTPQQALDSAVERGNALL-----
CYCB_BACSU      AAR----AVTEQSRFSEPTPNIPEMNEI-WTPADSALQTVATGKADPKQALDQAAETAKGQIKAK--
Y1214_PYRHO     -------------------------------------------------------------------
ARAN_BACSU      -------------------------------------------------------------------
MALX_STRR6      EGKNDELTVIKQFKNTQPLPNISQMSAV-WDPAKNMLFDAVSGQKDAKTAANDAVTLIKETIKQK--
MALX_STRPN      EGKNDELTVIKQFKNTQPLPNISQMSAV-WDPAKNMLFDAVSGQKDAKTAANDAVTLIKETIKQK--
MALE_ECOLI      AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVDEALKDAQ--------
MALE_ECO57      AKDPRIAATMENAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVDEALKDAQ--------
ARAN_BACHD      -------------------------------------------------------------------
YCJN_ECOLI      -------------------------------------------------------------------
MALE_PYRAB      -------------------------------------------------------------------
YOE2_STRAT      -------------------------------------------------------------------
MDXE_BACSU      QKNELTSAVIKQYETATPTPNIPEMAEV---------------------------------------
MALE_ENTAE      EKDPRIAATMANAQKGEIMPNIPQMSAFWY-----AVRTAVINAASARQTVDAALKDAQ--------
MSME_STRMU      -------------------------------------------------------------------
MALE_SALTY      AKDPRIAATMDNAQKGEIMPNIPQMSAFWY-----AVRTAVINAASGRQTVDAALKDAQSRIT----
YURO_BACSU      -------------------------------------------------------------------
MALE_PYRFU      -------------------------------------------------------------------
UE38_DEIRA      -------------------------------------------------------------------
Y1039_PYRHO     -------------------------------------------------------------------
LACE_RHIRD      -------------------------------------------------------------------
SUCC_BORPD      -------------------------------------------------------------------
IDIA_SYNP6      -------------------------------------------------------------------
IDIA_SYNE7      -------------------------------------------------------------------