[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tthe0:AAS80360.1

[Show Plain Result]


## Summary of Sequence Search
    1::620
    3::604     8e-76  35%  605 aa  AOR_PYRKO RecName: Full=Tungsten-containing aldehyde ferredoxin
    3::604     2e-71  34%  605 aa  AOR_PYRFU RecName: Full=Tungsten-containing aldehyde ferredoxin
    3::587     2e-63  32%  607 aa  AOR_PYRAB RecName: Full=Tungsten-containing aldehyde ferredoxin
    3::587     3e-63  32%  607 aa  AOR_PYRHO RecName: Full=Tungsten-containing aldehyde ferredoxin
    2::608     7e-61  33%  621 aa  FOR_THELI RecName: Full=Tungsten-containing formaldehyde ferredoxin
    1::206     1e-19  31%  700 aa  YDHV_ECOLI RecName: Full=Uncharacterized protein ydhV;
    1::620

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MPKGYHDRVAFVDLSTGKVWYESFGEAFWXXXXXXXXXXXXXXXXHVPKGADPLGPENALVFAPGILTGT
AOR_PYRKO       ---GNWGRFLRVNLSTGEVKVEEYGEELAKKWLGSRGLAIYLLLKEMDPKADPLGPENKLIITPGPLTGT
AOR_PYRFU       ---GNWGRFIRVNLSTGDIKVEEYDEELAKKWLGSRGLAIYLLLKEMDPTVDPLSPENKLIIAAGPLTGT
AOR_PYRAB       ---GYWGKILRVNLTDGTIKEETFNEEFAKKWLGTRGFGIYFLLKEMDPKVDPFSPENKLIFATGPLTGT
AOR_PYRHO       ---GYWGKILRVNLSDGTIKEETFNEEFAKKWLGTRGFGIYFLLKEMDPKIDPFSPENKLIFATGPLTGT
FOR_THELI       --KGWWGKILRVDLTNNKVWVQEYSPEV-AKNFIGGRGLAAWILWNEAKNVDPLGPKNKLVFATGPFNGL
YDHV_ECOLI      MANGWTGNILRVNLTTGNITLEDSSK--FKSFVGGMGFGYKIMYDEVPPGTKPFDEANKLVFATGPLTGS


                         .         .         *         .         .         .         .:140
query           PISGSGRNTVAAKSPLTXXXXXXXXXXXXXXXLKNAGLDALVVLGQAEAPVYLHVEGGKVALHPAVHLWG
AOR_PYRKO       SAPTGGRYNVVTKSPQTGFITMANSGGYFGAELKFAGWDAIVVEGQSEKPVYIYIKDDHVEIRDASHLWG
AOR_PYRFU       SAPTGGRYNVVTKSPLTGFITMANSGGYFGAELKFAGYDAIVVEGKAEKPVYIYIKDEHIEIRDASHIWG
AOR_PYRAB       SAPTGGRYMVITKSPLTGYIAMANSGGYFGAELKFAGWDAIIIEGKADHPVYLYIHDENVEIRDASKVWG
AOR_PYRHO       SAPTGGRYMVITKSPLTGYIAMANSGGYFGAELKFAGWDAIIVEGKADHPVYIYINDENVEIRDASKVWG
FOR_THELI       PTPSGGKMVIAAKSPLTGGYGDGNLGTMATVHLRKAGYDALVVEGKAKKPVYIYIEDDNVSILSAEGLWG
YDHV_ECOLI      GAPCSSRVNITSLSTFTKGNLVVDAHMGGFFAMKFAGYDVIIIEGKAKSPVWLKIKDDKVSLEKADFLWG


                         +         .         .         .         .         *         .:210
query           KDPLEVEALIKEAHGGNTRVAQIGLAGENRVLTANVIHDLAHFAGRGGLGAVMGAKRLKAVSARAHKETL
AOR_PYRKO       KVVSETEAAIKKEIGSNLHIASIGPAGENLVKFAAIMNDXXXXXXXXXXXXXMGSKKLKAIAVEGSKR-V
AOR_PYRFU       KKVSETEATIKEVGSEKVKIASIGPAGENLVKFAAIMNDXXXXXXXXXXXXXXXSKNLKAIAVEGSK-TV
AOR_PYRAB       KLVSETEKALKEEVGDHVQIASIGPAGENKVRFAAVXXXXXXXXXXXXXXXXXXSKNLKAIVVRGHKRVE
AOR_PYRHO       KLVSETERMLKEEVGDHVQIASIGPAGENKVRFAAVXXXXXXXXXXXXXXXXXXSKNLKAIVVRGHKRVE
FOR_THELI       KTTFETERELKEIHGKNVGILSIGPGGENLVKYAVVISQEGRAAGRPGMGAVMGSKKLKAVVIKGTKEIP
YDHV_ECOLI      KGTRATTEEICRLTSPETCVAAIGQAGENLVPLSGMLNSRNH-SGGAGTGAIMGSKNLKAIAVEGTK---


                         .         .         .         +         .         .         .:280
query           PAYHDPGLLKELARRMAKERMDRAAGLVTMGTVGTVKPFNLRGVLPSHNFLDGFSEGAEALDGTSLDALG
AOR_PYRKO       PIADKQKFMLVVREKINKLRNDPVAGLPKYGTAVLVNIINENGLYPTRNFQTGVFEHAYEQSGEAMTAKY
AOR_PYRFU       PIADKQKFMLVVREKVNKLRNDPVAGLPKYGTAVLVNIINENGLYPVKNFQTGVYPYAYEQSGEAMAAKY
AOR_PYRAB       VA--DKGKFMEVIRKIEKLKKDPVAGLPKYGTAVLVNIINEHGLYPTRNFQTGVFEYAYEQSGEAMAAKY
AOR_PYRHO       VA--DKGKFMEVIRKIEKLRKDPVAGLPKYGTAVLVNIINEHGLYPTRNFQTGVFKYAYEQSGEAMAAKY
FOR_THELI       VA--DKEKLKELSQE-AYDAILNSPGYPRQGTMAAVEWTNENSALPTRNFSDGSFEFARSIDGYTME--G
YDHV_ECOLI      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           IRIGRDTCYACAIRCKQVVKIEGTGKYDVRXXXXXXXXXXXXXXXSTCGVTDPYAVTKANTLCNQYGLDV
AOR_PYRKO       L-IRNQPCYACPIGCGRVNKLPTLGVTE------GPEYESIWALGANLGINDLASIIEANHQCDEFGLDT
AOR_PYRFU       L-VRNKPCYACPIGCGRVNRLPTVGETE------GPEYESVWALGANLGINDLASIIEANHMCDELGLDT
AOR_PYRAB       L-IRNKPCFACPIGCGRVNYLPSIGETE------GPEYESTWALGANLGINDLASIIEANHFADEYGMDT
AOR_PYRHO       L-VRNKPCFACPIGCGRVNYLPSIGETE------GPEYESTWALGANLGINDLASIIEANHFADEYGMDT
FOR_THELI       MKVKQRGCPYCNMPCGNVV-------LDAEGQESELDYENVALLGSNLGIGKLNEVSVLNRIADEMGLDT
YDHV_ECOLI      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           IGVGVTIACAMEAVEKGYLDDEGLGLRFGNGDALIAAIXXXXXXXXXXXXXXXXXXKRLAESLGHPELAM
AOR_PYRKO       ISTGGTLAAAMELYEKGYLTDDELGFRWGNTEVLHYYIEKIAYRKDLGDKLAEGSY-RFAEMYGHPEFSM
AOR_PYRFU       ISTGGTLATAMELYEKGHIKDEELGFRWGNTEVLHYYIEKIAKREGFGDKLAEGSY-RLAESYGHPELSM
AOR_PYRAB       ISLGGTLATAMELYERGLIKQEDIGFRFGNTEVLHYWIHKIAKREGFGDILAEGGY-RLAERFNGTEYFM
AOR_PYRHO       ISLGGTLATAMELYERGLIKQEDIGFRFGNTEVLHYWIHKIAKREGFGDILAEGGY-RLAEKFNGLEYFM
FOR_THELI       ISLGVAISYVMEAKEKGIIKDDD-APEFGDFKKAKQLALDIAYRRGELGNLAAEGVKVMSEKLGAKDFAM
YDHV_ECOLI      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           HVKGQEVPMHDPRYKRALGVGYAVSPTGADHNHNLHDTAFAKEGRALRELRFYGEDFQPLPIEDLSEAKI
AOR_PYRKO       SVKKLELPAYDPRGAEGHGLGYATNNRGGCHIKNYMISP---------EILGYPYKMDP---HDISDEKV
AOR_PYRFU       TVKKLELPAYDPRGAEGHGLGYATNNRGGCHIKNYMISP---------EILGYPYKMDP---HDVSDDKI
AOR_PYRAB       GVKKQELPAYDPRGAEGHGLGYATNNRGGCH---------IKQYMISPEILGYPYKMDP---HDISDEKV
AOR_PYRHO       GVKKQELPAYDPRGAEGHGLGYATNNRGGCH---------IKQYMISPEILGYPYKMDP---HDISDEKV
FOR_THELI       HVKGLEVSGYNCYIYPAMALAYGTSSIGAHH----------------KEAWVIAWEIGTAPIEGEKAQKV
YDHV_ECOLI      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           RMLWTKTRERGFVNSLVMCDFVPWTPEEWREALYAATGWRLSPEEMLEVGERTLQLTRLFNLREGISPEE
AOR_PYRKO       KMLILFQDLSALIDAAGLCLFTTFGADDYRDMLNAALGWDFSTEDYLKIGERIWNAERLFNLKAGLDPAK
AOR_PYRFU       KMLILFQDLTALIDSAGLCLFTTFGADDYRDLLNAALGWDFTTEDYLKIGERIWNAERLFNLKAGLDPRD
AOR_PYRAB       KMVILFQDLTALIDAAGLCLFTTFGADDYRDMLNAALGWDFSTEDYLKIGERIWNAERLFNLKAGLDPKE
AOR_PYRHO       KMVILFQDLTAVIDAAGLCIFTTFGADDYTDMLNAALGWDFSTDDYLKIGERIWNAERLFNLKAGLDPKE
FOR_THELI       EYKITYDPEKGLFEMLTACR-LPWVEDYYPKLLEAITGVKYTWDDLYKAADRVYALMRAYWVRENWSREM
YDHV_ECOLI      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           DRLPERFFQPFRKGNPEARLDPEAFREGVRAYRRLAGWEGGVDPERLRALGLEEFxxxxx
AOR_PYRKO       DELPKRFLEPMPEGPNKGHV--VRLKEMLPRYYKLRGWDGRIPREKAEELGIAEF-----
AOR_PYRFU       DTLPKRFLEPMPEGPNKGH--TVRLKEMLPRYYKLRGWDGKIPKEKLEELGIAEF-----
AOR_PYRAB       DTLPKRLLEPMPEGPNKGHV--VRLKEMLPRYYKLRGW----------------------
AOR_PYRHO       DTLPKRFLEPMPEGPNKGHV--VRLKEMLPRYYKLRGW----------------------
FOR_THELI       DYPPERWFKEGLKSGPGQHLEKDKYDALLSEYYKLRGWDGIPKKETLKELNLE-------
YDHV_ECOLI      ------------------------------------------------------------