[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tthe0:AAS80391.1

[Show Plain Result]


## Summary of Sequence Search
    1::397
   13::386     2e-64  36%  401 aa  Y104_SULSO RecName: Full=Uncharacterized aminotransferase SSO0104; 
   92::460     5e-42  30%  484 aa  YISV_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
   17::408     2e-36  30%  425 aa  AADAT_HUMAN RecName: Full=Kynurenine/alpha-aminoadipate
   93::439     6e-34  33%  468 aa  YDCR_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
   15::390     2e-33  31%  425 aa  AADAT_RAT RecName: Full=Kynurenine/alpha-aminoadipate
   23::425     1e-32  30%  440 aa  AATR2_DICDI RecName: Full=Aromatic amino acid aminotransferase
   93::465     4e-32  27%  482 aa  YDFD_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
   33::391     5e-31  29%  425 aa  AADAT_MOUSE RecName: Full=Kynurenine/alpha-aminoadipate
  114::465     3e-29  29%  493 aa  MOCR_RHIME RecName: Full=Probable rhizopine catabolism regulatory
   17::390     3e-29  28%  425 aa  AADAT_BOVIN RecName: Full=Kynurenine/alpha-aminoadipate
   38::393     6e-27  30%  470 aa  AATR3_SCHPO RecName: Full=Aromatic amino acid aminotransferase
  130::447     5e-26  28%  470 aa  YJIR_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
   29::397     7e-25  30%  474 aa  AATR1_SCHPO RecName: Full=Aromatic amino acid aminotransferase
   56::428     4e-23  23%  442 aa  NORG_STAAC RecName: Full=HTH-type transcriptional regulator norG;
   56::428     4e-23  23%  442 aa  NORG_STAA8 RecName: Full=HTH-type transcriptional regulator norG;
   56::428     4e-23  23%  442 aa  NORG_STAA3 RecName: Full=HTH-type transcriptional regulator norG;
   56::428     3e-22  23%  442 aa  NORG_STAAN RecName: Full=HTH-type transcriptional regulator norG;
   56::428     3e-22  23%  442 aa  NORG_STAAM RecName: Full=HTH-type transcriptional regulator norG;
   66::397     7e-22  29%  481 aa  AATR1_DICDI RecName: Full=Aromatic amino acid aminotransferase
   56::428     8e-21  23%  442 aa  NORG_STAAB RecName: Full=HTH-type transcriptional regulator norG;
   97::458     2e-20  29%  481 aa  AATR2_SCHPO RecName: Full=Aromatic amino acid aminotransferase
  147::452     2e-19  27%  463 aa  YDEL_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
   83::433     4e-18  26%  444 aa  YCXD_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
  108::451     2e-17  24%  469 aa  YHDI_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
  146::335     2e-17  32%  479 aa  GABR_BACSU RecName: Full=HTH-type transcriptional regulatory
   99::362     2e-17  32%  513 aa  ARO9_YEAST RecName: Full=Aromatic amino acid aminotransferase 2;   
   66::375     5e-17  28%  388 aa  DAPAT_DESDG RecName: Full=LL-diaminopimelate aminotransferase;     
   63::371     1e-16  27%  390 aa  DAPAT_CARHZ RecName: Full=LL-diaminopimelate aminotransferase;     
   55::382     2e-16  28%  394 aa  AAT_AQUAE RecName: Full=Aspartate aminotransferase;       
   66::258     3e-16  33%  357 aa  HIS8_ERWCT RecName: Full=Histidinol-phosphate aminotransferase;    
    9::451     8e-16  26%  500 aa  ARO8_YEAST RecName: Full=Aromatic amino acid aminotransferase 1;   
   63::380     1e-15  29%  388 aa  DAPAT_DEHE1 RecName: Full=LL-diaminopimelate aminotransferase;     
   49::366     1e-15  28%  383 aa  AAT_THEAQ RecName: Full=Aspartate aminotransferase;       
   16::371     2e-15  24%  391 aa  AAT_PYRHO RecName: Full=Aspartate aminotransferase;       
   68::388     5e-15  27%  402 aa  AAT_SULSO RecName: Full=Aspartate aminotransferase;       
   56::358     6e-15  26%  377 aa  AAT_THEMA RecName: Full=Aspartate aminotransferase;       
   59::367     8e-15  25%  389 aa  AAT_PYRAB RecName: Full=Aspartate aminotransferase;       
   66::261     1e-14  31%  357 aa  HIS8_PECCP RecName: Full=Histidinol-phosphate aminotransferase;    
   63::366     1e-14  28%  385 aa  AAT_THET8 RecName: Full=Aspartate aminotransferase;       
   53::373     1e-14  25%  393 aa  AAT1_BACSU RecName: Full=Aspartate aminotransferase;       
   63::237     2e-14  32%  348 aa  HIS8_CHLTE RecName: Full=Histidinol-phosphate aminotransferase;    
   65::248     2e-14  30%  358 aa  HIS8_BLOPB RecName: Full=Histidinol-phosphate aminotransferase;    
   63::244     2e-14  31%  369 aa  HIS8_BACHD RecName: Full=Histidinol-phosphate aminotransferase;    
   70::244     2e-14  34%  364 aa  HIS8_ANADF RecName: Full=Histidinol-phosphate aminotransferase;    
   63::380     4e-14  26%  388 aa  DAPAT_DEHSB RecName: Full=LL-diaminopimelate aminotransferase;     
   66::365     5e-14  28%  388 aa  DAPAT_DESVH RecName: Full=LL-diaminopimelate aminotransferase;     
  188::421     9e-14  30%  443 aa  YEY2_YEAST RecName: Full=Uncharacterized protein YER152C;
   63::239     9e-14  28%  376 aa  HIS8_HALWD RecName: Full=Histidinol-phosphate aminotransferase;    
   63::380     9e-14  26%  388 aa  DAPAT_DEHSC RecName: Full=LL-diaminopimelate aminotransferase;     
   63::255     1e-13  30%  392 aa  HIS82_NITMU RecName: Full=Histidinol-phosphate aminotransferase 2; 
   66::365     1e-13  28%  388 aa  DAPAT_DESVV RecName: Full=LL-diaminopimelate aminotransferase;     
   64::283     2e-13  29%  367 aa  HIS8_WOLSU RecName: Full=Histidinol-phosphate aminotransferase;    
   64::243     2e-13  29%  366 aa  HIS81_MANSM RecName: Full=Histidinol-phosphate aminotransferase 1; 
   40::230     3e-13  33%  340 aa  HIS8_THEGJ RecName: Full=Histidinol-phosphate aminotransferase;    
   73::262     3e-13  30%  376 aa  HIS81_RALEJ RecName: Full=Histidinol-phosphate aminotransferase 1; 
   70::368     3e-13  26%  412 aa  YFDZ_ECOLI RecName: Full=Uncharacterized aminotransferase yfdZ;    
   60::255     3e-13  31%  366 aa  HIS8_PSEST RecName: Full=Histidinol-phosphate aminotransferase;    
   61::380     3e-13  27%  397 aa  AAT_STRVG RecName: Full=Aspartate aminotransferase;       
   94::275     5e-13  29%  386 aa  HIS8_MOOTA RecName: Full=Histidinol-phosphate aminotransferase;    
  168::357     6e-13  25%  462 aa  YDEF_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
   51::258     6e-13  26%  364 aa  HIS8_SULNB RecName: Full=Histidinol-phosphate aminotransferase;    
   65::378     6e-13  28%  388 aa  DAPAT_SYNFM RecName: Full=LL-diaminopimelate aminotransferase;     
   64::376     6e-13  27%  389 aa  DAPAT_HALOH RecName: Full=LL-diaminopimelate aminotransferase;     
   69::267     1e-12  25%  364 aa  HIS8_BREBN RecName: Full=Histidinol-phosphate aminotransferase;    
   53::259     1e-12  25%  393 aa  AAT_BACST RecName: Full=Aspartate aminotransferase;       
   64::259     1e-12  29%  351 aa  HIS8_THETN RecName: Full=Histidinol-phosphate aminotransferase;    
   65::254     1e-12  30%  374 aa  HIS82_RALSO RecName: Full=Histidinol-phosphate aminotransferase 2; 
   60::375     1e-12  26%  388 aa  DAPAT_DESAD RecName: Full=LL-diaminopimelate aminotransferase;     
   49::233     2e-12  32%  346 aa  HIS8_VIBCH RecName: Full=Histidinol-phosphate aminotransferase;    
   64::259     2e-12  27%  351 aa  HIS8_THEP3 RecName: Full=Histidinol-phosphate aminotransferase;    
   70::247     2e-12  32%  361 aa  HIS8_SYMTH RecName: Full=Histidinol-phosphate aminotransferase;    
   64::269     2e-12  31%  390 aa  DAPT2_ANAVT RecName: Full=LL-diaminopimelate aminotransferase 2;   
   67::271     2e-12  28%  399 aa  AAT_SULTO RecName: Full=Aspartate aminotransferase;       
   71::252     2e-12  31%  359 aa  HIS8_SALPK RecName: Full=Histidinol-phosphate aminotransferase;    
   71::252     2e-12  31%  359 aa  HIS8_SALPA RecName: Full=Histidinol-phosphate aminotransferase;    
   71::252     2e-12  33%  359 aa  HIS8_SALDC RecName: Full=Histidinol-phosphate aminotransferase;    
   87::362     2e-12  26%  405 aa  AATC_RHIME RecName: Full=Putative aminotransferase aatC;       
   64::375     3e-12  22%  392 aa  AAT_BACY2 RecName: Full=Aspartate aminotransferase;       
   49::233     4e-12  33%  346 aa  HIS8_VIBPA RecName: Full=Histidinol-phosphate aminotransferase;    
   64::257     4e-12  27%  351 aa  HIS8_THEPX RecName: Full=Histidinol-phosphate aminotransferase;    
   71::252     4e-12  31%  359 aa  HIS8_SALTY RecName: Full=Histidinol-phosphate aminotransferase;    
   71::252     4e-12  31%  359 aa  HIS8_SALTI RecName: Full=Histidinol-phosphate aminotransferase;    
   71::252     4e-12  31%  359 aa  HIS8_SALSV RecName: Full=Histidinol-phosphate aminotransferase;    
   71::252     4e-12  31%  359 aa  HIS8_SALPC RecName: Full=Histidinol-phosphate aminotransferase;    
   71::252     4e-12  31%  359 aa  HIS8_SALPB RecName: Full=Histidinol-phosphate aminotransferase;    
   71::252     4e-12  31%  359 aa  HIS8_SALNS RecName: Full=Histidinol-phosphate aminotransferase;    
   71::252     4e-12  31%  359 aa  HIS8_SALHS RecName: Full=Histidinol-phosphate aminotransferase;    
   71::252     4e-12  31%  359 aa  HIS8_SALG2 RecName: Full=Histidinol-phosphate aminotransferase;    
   71::252     4e-12  31%  359 aa  HIS8_SALEP RecName: Full=Histidinol-phosphate aminotransferase;    
   71::252     4e-12  31%  359 aa  HIS8_SALA4 RecName: Full=Histidinol-phosphate aminotransferase;    
   61::246     4e-12  29%  370 aa  HIS81_NITOC RecName: Full=Histidinol-phosphate aminotransferase 1; 
   64::269     4e-12  30%  390 aa  DAPT2_ANASP RecName: Full=LL-diaminopimelate aminotransferase 2;   
   49::233     5e-12  32%  346 aa  HIS8_VIBCM RecName: Full=Histidinol-phosphate aminotransferase;    
   49::233     5e-12  32%  346 aa  HIS8_VIBC3 RecName: Full=Histidinol-phosphate aminotransferase;    
   59::230     5e-12  34%  336 aa  HIS8_PYRKO RecName: Full=Histidinol-phosphate aminotransferase;    
   53::248     5e-12  29%  360 aa  HIS8_DESHY RecName: Full=Histidinol-phosphate aminotransferase;    
   64::269     5e-12  33%  387 aa  DAPAT_AQUAE RecName: Full=LL-diaminopimelate aminotransferase;     
  108::281     7e-12  32%  416 aa  Y1527_METMP RecName: Full=Uncharacterized aminotransferase MMP1527;
    9::372     7e-12  25%  393 aa  PATA_BACSU RecName: Full=Putative aminotransferase A;       
   73::253     7e-12  27%  362 aa  HIS81_DECAR RecName: Full=Histidinol-phosphate aminotransferase 1; 
   65::235     9e-12  32%  360 aa  HIS8_SODGM RecName: Full=Histidinol-phosphate aminotransferase;    
   71::252     9e-12  31%  359 aa  HIS8_SALCH RecName: Full=Histidinol-phosphate aminotransferase;    
   51::249     9e-12  27%  371 aa  HIS8_ANOFW RecName: Full=Histidinol-phosphate aminotransferase;    
   76::248     9e-12  30%  373 aa  HIS82_THICR RecName: Full=Histidinol-phosphate aminotransferase 2; 
   64::253     9e-12  29%  366 aa  HIS82_HAEIN RecName: Full=Histidinol-phosphate aminotransferase 2; 
   65::246     1e-11  31%  360 aa  HIS8_ENTS8 RecName: Full=Histidinol-phosphate aminotransferase;    
   43::258     1e-11  22%  356 aa  HIS8_CLONN RecName: Full=Histidinol-phosphate aminotransferase;    
   56::232     1e-11  32%  342 aa  HIS82_ARCFU RecName: Full=Histidinol-phosphate aminotransferase 2; 
   64::363     1e-11  24%  392 aa  DAPAT_GLOVI RecName: Full=LL-diaminopimelate aminotransferase;     
  509::690     1e-11  29%  807 aa  HIS8_PHOLL RecName: Full=Putative histidine biosynthesis
   22::236     2e-11  30%  347 aa  PATR_MYCA9 RecName: Full=Putative phenylalanine aminotransferase;  
   53::244     2e-11  29%  357 aa  HIS8_PROA2 RecName: Full=Histidinol-phosphate aminotransferase;    
   64::253     2e-11  28%  366 aa  HIS82_HAEI8 RecName: Full=Histidinol-phosphate aminotransferase 2; 
   47::358     2e-11  23%  375 aa  AAT1_METJA RecName: Full=Probable aspartate aminotransferase 1;    
   68::249     2e-11  30%  356 aa  HIS8_ECO45 RecName: Full=Histidinol-phosphate aminotransferase;    
   54::231     2e-11  29%  358 aa  HIS8_CLOCE RecName: Full=Histidinol-phosphate aminotransferase;    
   72::255     2e-11  28%  384 aa  HIS81_THIDA RecName: Full=Histidinol-phosphate aminotransferase 1; 
  108::281     3e-11  32%  418 aa  Y1391_METJA RecName: Full=Uncharacterized aminotransferase MJ1391; 
   45::237     3e-11  30%  351 aa  PATR_MYCVP RecName: Full=Putative phenylalanine aminotransferase;  
   45::243     3e-11  30%  355 aa  PATR_MYCPA RecName: Full=Putative phenylalanine aminotransferase;  
   64::257     3e-11  32%  365 aa  HIS8_XYLFA RecName: Full=Histidinol-phosphate aminotransferase;    
   68::249     3e-11  31%  356 aa  HIS8_SHIFL RecName: Full=Histidinol-phosphate aminotransferase;    
   68::249     3e-11  31%  356 aa  HIS8_SHIF8 RecName: Full=Histidinol-phosphate aminotransferase;    
   68::249     3e-11  31%  356 aa  HIS8_SHIDS RecName: Full=Histidinol-phosphate aminotransferase;    
   68::249     3e-11  30%  356 aa  HIS8_ECOK1 RecName: Full=Histidinol-phosphate aminotransferase;    
   68::249     3e-11  31%  356 aa  HIS8_ECO81 RecName: Full=Histidinol-phosphate aminotransferase;    
   68::249     3e-11  31%  356 aa  HIS8_ECO5E RecName: Full=Histidinol-phosphate aminotransferase;    
   68::249     3e-11  31%  356 aa  HIS8_ECO57 RecName: Full=Histidinol-phosphate aminotransferase;    
   68::249     3e-11  31%  356 aa  HIS8_ECO55 RecName: Full=Histidinol-phosphate aminotransferase;    
   52::237     3e-11  33%  365 aa  HIS82_BORPA RecName: Full=Histidinol-phosphate aminotransferase 2; 
   52::237     3e-11  33%  365 aa  HIS82_BORBR RecName: Full=Histidinol-phosphate aminotransferase 2; 
   45::243     4e-11  30%  355 aa  PATR_MYCA1 RecName: Full=Putative phenylalanine aminotransferase;  
   64::257     4e-11  32%  365 aa  HIS8_XYLFT RecName: Full=Histidinol-phosphate aminotransferase;    
   64::257     4e-11  32%  365 aa  HIS8_XYLFM RecName: Full=Histidinol-phosphate aminotransferase;    
   64::257     4e-11  32%  365 aa  HIS8_XYLF2 RecName: Full=Histidinol-phosphate aminotransferase;    
   68::249     4e-11  31%  356 aa  HIS8_SHIBS RecName: Full=Histidinol-phosphate aminotransferase;    
   66::236     4e-11  35%  357 aa  HIS8_PELLD RecName: Full=Histidinol-phosphate aminotransferase;    
   76::255     4e-11  28%  368 aa  HIS8_METFL RecName: Full=Histidinol-phosphate aminotransferase;    
   73::356     4e-11  32%  371 aa  HIS82_METCA RecName: Full=Histidinol-phosphate aminotransferase 2; 
   45::244     6e-11  30%  358 aa  PATR_MYCSS RecName: Full=Putative phenylalanine aminotransferase;  
   45::244     6e-11  30%  358 aa  PATR_MYCSK RecName: Full=Putative phenylalanine aminotransferase;  
   45::244     6e-11  30%  358 aa  PATR_MYCSJ RecName: Full=Putative phenylalanine aminotransferase;  
   69::250     6e-11  31%  382 aa  HIS8_YERPY RecName: Full=Histidinol-phosphate aminotransferase;    
   69::250     6e-11  31%  382 aa  HIS8_YERPP RecName: Full=Histidinol-phosphate aminotransferase;    
   69::250     6e-11  31%  382 aa  HIS8_YERPN RecName: Full=Histidinol-phosphate aminotransferase;    
   69::250     6e-11  31%  382 aa  HIS8_YERPG RecName: Full=Histidinol-phosphate aminotransferase;    
   69::250     6e-11  31%  382 aa  HIS8_YERPE RecName: Full=Histidinol-phosphate aminotransferase;    
   69::250     6e-11  31%  382 aa  HIS8_YERPA RecName: Full=Histidinol-phosphate aminotransferase;    
   69::250     6e-11  31%  382 aa  HIS8_YERP3 RecName: Full=Histidinol-phosphate aminotransferase;    
   71::252     6e-11  30%  359 aa  HIS8_SALAR RecName: Full=Histidinol-phosphate aminotransferase;    
   64::231     6e-11  30%  370 aa  HIS8_LEPIN RecName: Full=Histidinol-phosphate aminotransferase;    
   64::231     6e-11  30%  370 aa  HIS8_LEPIC RecName: Full=Histidinol-phosphate aminotransferase;    
   65::246     6e-11  30%  353 aa  HIS8_KLEP3 RecName: Full=Histidinol-phosphate aminotransferase;    
   65::235     6e-11  28%  356 aa  HIS8_BLOFL RecName: Full=Histidinol-phosphate aminotransferase;    
   68::245     7e-11  30%  368 aa  HIS8_RHISN RecName: Full=Histidinol-phosphate aminotransferase;    
   54::237     7e-11  34%  348 aa  HIS8_PSEE4 RecName: Full=Histidinol-phosphate aminotransferase;    
   68::249     7e-11  30%  356 aa  HIS8_ESCF3 RecName: Full=Histidinol-phosphate aminotransferase;    
   68::249     7e-11  30%  356 aa  HIS8_ECOUT RecName: Full=Histidinol-phosphate aminotransferase;    
   68::249     7e-11  30%  356 aa  HIS8_ECOSE RecName: Full=Histidinol-phosphate aminotransferase;    
   68::249     7e-11  30%  356 aa  HIS8_ECOLI RecName: Full=Histidinol-phosphate aminotransferase;    
   68::249     7e-11  30%  356 aa  HIS8_ECOLC RecName: Full=Histidinol-phosphate aminotransferase;    
   68::249     7e-11  30%  356 aa  HIS8_ECOL6 RecName: Full=Histidinol-phosphate aminotransferase;    
   68::249     7e-11  30%  356 aa  HIS8_ECOL5 RecName: Full=Histidinol-phosphate aminotransferase;    
   68::249     7e-11  30%  356 aa  HIS8_ECOHS RecName: Full=Histidinol-phosphate aminotransferase;    
   68::249     7e-11  30%  356 aa  HIS8_ECODH RecName: Full=Histidinol-phosphate aminotransferase;    
   68::249     7e-11  30%  356 aa  HIS8_ECOBW RecName: Full=Histidinol-phosphate aminotransferase;    
   68::249     7e-11  30%  356 aa  HIS8_ECO8A RecName: Full=Histidinol-phosphate aminotransferase;    
   68::249     7e-11  30%  356 aa  HIS8_ECO27 RecName: Full=Histidinol-phosphate aminotransferase;    
   68::249     7e-11  30%  356 aa  HIS8_ECO24 RecName: Full=Histidinol-phosphate aminotransferase;    
   73::244     7e-11  30%  355 aa  HIS8_CHLL2 RecName: Full=Histidinol-phosphate aminotransferase;    
  128::304     7e-11  29%  417 aa  HIS8_ARATH RecName: Full=Histidinol-phosphate aminotransferase,
   76::256     7e-11  30%  373 aa  HIS82_NITEU RecName: Full=Histidinol-phosphate aminotransferase 2; 
   51::236     7e-11  33%  350 aa  HIS82_MANSM RecName: Full=Histidinol-phosphate aminotransferase 2; 
  137::314     9e-11  28%  453 aa  PDXR_CORGL RecName: Full=HTH-type pyridoxine biosynthesis
   63::244     9e-11  28%  366 aa  HIS8_LYSSC RecName: Full=Histidinol-phosphate aminotransferase;    
   65::235     9e-11  33%  356 aa  HIS8_AERHH RecName: Full=Histidinol-phosphate aminotransferase;    
  121::268     1e-10  27%  456 aa  Y3073_RHOS4 RecName: Full=Uncharacterized HTH-type transcriptional
   69::250     1e-10  30%  382 aa  HIS8_YERPS RecName: Full=Histidinol-phosphate aminotransferase;    
   69::250     1e-10  30%  382 aa  HIS8_YERPB RecName: Full=Histidinol-phosphate aminotransferase;    
   49::233     1e-10  30%  346 aa  HIS8_VIBFM RecName: Full=Histidinol-phosphate aminotransferase;    
   68::249     1e-10  30%  356 aa  HIS8_SHISS RecName: Full=Histidinol-phosphate aminotransferase;    
   69::250     2e-10  30%  374 aa  HIS8_YERE8 RecName: Full=Histidinol-phosphate aminotransferase;    
   65::236     2e-10  33%  348 aa  HIS8_PSEPK RecName: Full=Histidinol-phosphate aminotransferase;    
   65::246     2e-10  30%  353 aa  HIS8_KLEP7 RecName: Full=Histidinol-phosphate aminotransferase;    
   71::252     2e-10  30%  359 aa  HIS8_CITK8 RecName: Full=Histidinol-phosphate aminotransferase;    
   49::233     2e-10  31%  346 aa  HIS8_VIBHB RecName: Full=Histidinol-phosphate aminotransferase;    
   59::226     2e-10  29%  338 aa  HIS8_PYRFU RecName: Full=Histidinol-phosphate aminotransferase;    
   65::236     2e-10  34%  348 aa  HIS8_PSEPW RecName: Full=Histidinol-phosphate aminotransferase;    
   64::253     2e-10  25%  365 aa  HIS82_PASMU RecName: Full=Histidinol-phosphate aminotransferase 2; 
   52::237     2e-10  32%  365 aa  HIS82_BORPE RecName: Full=Histidinol-phosphate aminotransferase 2; 
   55::237     3e-10  31%  361 aa  PATR_MYCS2 RecName: Full=Putative phenylalanine aminotransferase;  
   68::249     3e-10  29%  356 aa  HIS8_ECO7I RecName: Full=Histidinol-phosphate aminotransferase;    
   64::251     3e-10  28%  361 aa  HIS8_BACLD RecName: Full=Histidinol-phosphate aminotransferase;    
   66::229     3e-10  27%  367 aa  HIS81_IDILO RecName: Full=Histidinol-phosphate aminotransferase 1; 
   49::233     4e-10  30%  346 aa  HIS8_VIBF1 RecName: Full=Histidinol-phosphate aminotransferase;    
   68::249     4e-10  30%  356 aa  HIS8_SHIB3 RecName: Full=Histidinol-phosphate aminotransferase;    
   65::246     4e-10  30%  362 aa  HIS8_SERP5 RecName: Full=Histidinol-phosphate aminotransferase;    
   65::236     4e-10  33%  348 aa  HIS8_PSEP1 RecName: Full=Histidinol-phosphate aminotransferase;    
   73::244     4e-10  30%  355 aa  HIS8_PELPB RecName: Full=Histidinol-phosphate aminotransferase;    
   53::251     4e-10  26%  366 aa  HIS8_NITSB RecName: Full=Histidinol-phosphate aminotransferase;    
   72::255     4e-10  29%  373 aa  HIS8_METTH RecName: Full=Histidinol-phosphate aminotransferase;    
   68::249     4e-10  30%  356 aa  HIS8_ECOLU RecName: Full=Histidinol-phosphate aminotransferase;    
   70::244     4e-10  30%  355 aa  HIS8_CHLP8 RecName: Full=Histidinol-phosphate aminotransferase;    
   78::243     4e-10  26%  358 aa  HIS8_CALS8 RecName: Full=Histidinol-phosphate aminotransferase;    
   55::238     5e-10  30%  358 aa  PATR_RHOSR RecName: Full=Putative phenylalanine aminotransferase;  
  124::300     5e-10  27%  413 aa  HIS8_TOBAC RecName: Full=Histidinol-phosphate aminotransferase,
   65::236     5e-10  33%  348 aa  HIS8_PSEPG RecName: Full=Histidinol-phosphate aminotransferase;    
   65::246     5e-10  29%  353 aa  HIS8_ENT38 RecName: Full=Histidinol-phosphate aminotransferase;    
   65::236     5e-10  33%  351 aa  HIS81_PASMU RecName: Full=Histidinol-phosphate aminotransferase 1; 
    6::377     5e-10  24%  400 aa  AAT_SULAC RecName: Full=Aspartate aminotransferase;       
  124::300     6e-10  27%  413 aa  HIS8_NICPL RecName: Full=Histidinol-phosphate aminotransferase,
   61::249     6e-10  29%  371 aa  HIS8_METPP RecName: Full=Histidinol-phosphate aminotransferase;    
   55::227     6e-10  29%  367 aa  HIS8_LEPBL RecName: Full=Histidinol-phosphate aminotransferase;    
   55::227     6e-10  29%  367 aa  HIS8_LEPBJ RecName: Full=Histidinol-phosphate aminotransferase;    
   46::248     6e-10  27%  370 aa  HIS81_BACC1 RecName: Full=Histidinol-phosphate aminotransferase 1; 
   74::256     8e-10  25%  371 aa  HIS8_ROSCS RecName: Full=Histidinol-phosphate aminotransferase;    
   73::248     8e-10  30%  372 aa  HIS8_NOVAD RecName: Full=Histidinol-phosphate aminotransferase;    
   68::249     8e-10  30%  356 aa  HIS8_ECOSM RecName: Full=Histidinol-phosphate aminotransferase;    
   17::238     1e-09  29%  359 aa  PATR_STRCO RecName: Full=Putative phenylalanine aminotransferase;  
   84::263     1e-09  25%  379 aa  HIS8_DESPS RecName: Full=Histidinol-phosphate aminotransferase;    
   67::233     1e-09  31%  346 aa  HIS8_VIBVY RecName: Full=Histidinol-phosphate aminotransferase;    
   67::233     1e-09  31%  346 aa  HIS8_VIBVU RecName: Full=Histidinol-phosphate aminotransferase;    
   68::235     1e-09  27%  356 aa  HIS8_LACPL RecName: Full=Histidinol-phosphate aminotransferase;    
   64::254     2e-09  31%  364 aa  HIS8_STRMK RecName: Full=Histidinol-phosphate aminotransferase;    
   64::244     2e-09  28%  360 aa  HIS8_PROVI RecName: Full=Histidinol-phosphate aminotransferase;    
   52::239     2e-09  28%  364 aa  HIS8_HALLT RecName: Full=Histidinol-phosphate aminotransferase;    
   48::267     2e-09  24%  364 aa  HIS8_SULDN RecName: Full=Histidinol-phosphate aminotransferase;    
   63::268     2e-09  27%  390 aa  DAPAT_MOOTA RecName: Full=LL-diaminopimelate aminotransferase;     
   65::273     3e-09  24%  367 aa  HIS8_METST RecName: Full=Histidinol-phosphate aminotransferase;    
   69::249     3e-09  28%  365 aa  HIS8_GEOKA RecName: Full=Histidinol-phosphate aminotransferase;    
   46::240     3e-09  31%  356 aa  HIS8_AZOSE RecName: Full=Histidinol-phosphate aminotransferase;    
   65::236     3e-09  32%  350 aa  HIS81_PSEF5 RecName: Full=Histidinol-phosphate aminotransferase 1; 
   50::267     4e-09  25%  360 aa  HIS8_LISIN RecName: Full=Histidinol-phosphate aminotransferase;    
   41::247     4e-09  28%  364 aa  HIS81_LEGPL RecName: Full=Histidinol-phosphate aminotransferase 1; 
   46::236     5e-09  30%  356 aa  HIS8_ACEPA RecName: Full=Histidinol-phosphate aminotransferase;    
   48::322     5e-09  29%  364 aa  AAT_PYRKO RecName: Full=Aspartate aminotransferase;       
   62::323     7e-09  29%  362 aa  HIS8_XANCB RecName: Full=Histidinol-phosphate aminotransferase;    
   63::249     7e-09  26%  365 aa  HIS8_GEOSW RecName: Full=Histidinol-phosphate aminotransferase;    
   54::248     7e-09  26%  360 aa  HIS8_DESHD RecName: Full=Histidinol-phosphate aminotransferase;    
   65::246     7e-09  29%  359 aa  HIS8_BUCSC RecName: Full=Histidinol-phosphate aminotransferase;    
   65::236     7e-09  33%  350 aa  HIS81_PSEPF RecName: Full=Histidinol-phosphate aminotransferase 1; 
   73::238     9e-09  32%  359 aa  PATR_STRGG RecName: Full=Putative phenylalanine aminotransferase;  
   67::236     9e-09  26%  355 aa  HIS8_BUCAP RecName: Full=Histidinol-phosphate aminotransferase;    
   69::248     9e-09  26%  370 aa  HIS8_BACCN RecName: Full=Histidinol-phosphate aminotransferase;    
   65::235     9e-09  31%  355 aa  HIS8_AERS4 RecName: Full=Histidinol-phosphate aminotransferase;    
   46::244     9e-09  25%  366 aa  HIS82_BACAN RecName: Full=Histidinol-phosphate aminotransferase 2; 
   66::376     9e-09  25%  389 aa  DAPAT_DESVM RecName: Full=LL-diaminopimelate aminotransferase;     
   51::233     1e-08  25%  350 aa  HIS8_MACCJ RecName: Full=Histidinol-phosphate aminotransferase;    
   63::235     1e-08  28%  360 aa  HIS8_HALMA RecName: Full=Histidinol-phosphate aminotransferase;    
   75::259     1e-08  29%  363 aa  HIS8_AKKM8 RecName: Full=Histidinol-phosphate aminotransferase;    
   41::247     1e-08  27%  364 aa  HIS81_LEGPH RecName: Full=Histidinol-phosphate aminotransferase 1; 
   62::384     1e-08  29%  408 aa  DAPAT_DESDA RecName: Full=LL-diaminopimelate aminotransferase;     
   65::236     2e-08  31%  350 aa  HIS8_PSEU2 RecName: Full=Histidinol-phosphate aminotransferase;    
   50::267     2e-08  25%  360 aa  HIS8_LISMF RecName: Full=Histidinol-phosphate aminotransferase;    
   63::249     2e-08  27%  365 aa  HIS8_GEOTN RecName: Full=Histidinol-phosphate aminotransferase;    
   47::240     2e-08  32%  353 aa  HIS8_SYNJB RecName: Full=Histidinol-phosphate aminotransferase;    
   59::239     2e-08  30%  359 aa  HIS8_ROSDO RecName: Full=Histidinol-phosphate aminotransferase;    
   51::235     2e-08  28%  374 aa  HIS8_PHOPR RecName: Full=Histidinol-phosphate aminotransferase;    
   50::267     2e-08  25%  360 aa  HIS8_LISMC RecName: Full=Histidinol-phosphate aminotransferase;    
   65::233     2e-08  32%  352 aa  HIS8_HAEIG RecName: Full=Histidinol-phosphate aminotransferase;    
   65::233     2e-08  32%  352 aa  HIS8_HAEIE RecName: Full=Histidinol-phosphate aminotransferase;    
   68::237     2e-08  26%  363 aa  HIS8_BUCDN RecName: Full=Histidinol-phosphate aminotransferase;    
   63::250     2e-08  26%  360 aa  HIS8_BACSU RecName: Full=Histidinol-phosphate aminotransferase;    
   46::244     2e-08  25%  366 aa  HIS82_BACCZ RecName: Full=Histidinol-phosphate aminotransferase 2; 
   80::248     2e-08  32%  367 aa  HIS81_HAEIN RecName: Full=Histidinol-phosphate aminotransferase 1; 
  148::380     2e-08  28%  495 aa  1A112_ARATH RecName: Full=Probable aminotransferase ACS12;       
   55::243     3e-08  28%  358 aa  PATR_NOCFA RecName: Full=Putative phenylalanine aminotransferase;  
   62::323     3e-08  29%  363 aa  HIS8_XANAC RecName: Full=Histidinol-phosphate aminotransferase;    
   63::267     3e-08  28%  360 aa  HIS8_LISW6 RecName: Full=Histidinol-phosphate aminotransferase;    
   50::267     3e-08  26%  360 aa  HIS8_LISMH RecName: Full=Histidinol-phosphate aminotransferase;    
   64::234     3e-08  25%  358 aa  HIS8_DEHSC RecName: Full=Histidinol-phosphate aminotransferase;    
   64::234     3e-08  25%  358 aa  HIS8_DEHSB RecName: Full=Histidinol-phosphate aminotransferase;    
   63::250     3e-08  26%  360 aa  HIS8_BACNA RecName: Full=Histidinol-phosphate aminotransferase;    
   49::231     3e-08  30%  346 aa  HIS8_ALISL RecName: Full=Histidinol-phosphate aminotransferase;    
   68::240     3e-08  29%  356 aa  HIS82_DECAR RecName: Full=Histidinol-phosphate aminotransferase 2; 
   41::247     3e-08  27%  364 aa  HIS81_LEGPA RecName: Full=Histidinol-phosphate aminotransferase 1; 
   74::256     3e-08  25%  370 aa  HIS8_ROSS1 RecName: Full=Histidinol-phosphate aminotransferase;    
   65::236     3e-08  33%  350 aa  HIS8_PSESM RecName: Full=Histidinol-phosphate aminotransferase;    
   71::244     3e-08  28%  358 aa  HIS8_DEHE1 RecName: Full=Histidinol-phosphate aminotransferase;    
   55::239     4e-08  28%  353 aa  PATR_MYCTU RecName: Full=Putative phenylalanine aminotransferase;  
   55::239     4e-08  28%  353 aa  PATR_MYCTA RecName: Full=Putative phenylalanine aminotransferase;  
   55::239     4e-08  28%  353 aa  PATR_MYCBT RecName: Full=Putative phenylalanine aminotransferase;  
   55::239     4e-08  28%  353 aa  PATR_MYCBP RecName: Full=Putative phenylalanine aminotransferase;  
   55::239     4e-08  28%  353 aa  PATR_MYCBO RecName: Full=Putative phenylalanine aminotransferase;  
   50::267     4e-08  24%  360 aa  HIS8_LISMO RecName: Full=Histidinol-phosphate aminotransferase;    
   63::250     4e-08  28%  365 aa  HIS8_BACP2 RecName: Full=Histidinol-phosphate aminotransferase;    
   83::286     4e-08  25%  505 aa  ALAT_SCHPO RecName: Full=Putative alanine aminotransferase;        
   62::351     4e-08  23%  370 aa  AAT2_METJA RecName: Full=Probable aspartate aminotransferase 2;    
   96::254     6e-08  28%  371 aa  HIS8_METM5 RecName: Full=Histidinol-phosphate aminotransferase;    
   65::233     6e-08  31%  352 aa  HIS81_HAEI8 RecName: Full=Histidinol-phosphate aminotransferase 1; 
   46::248     6e-08  24%  370 aa  HIS81_BACCR RecName: Full=Histidinol-phosphate aminotransferase 1; 
   67::340     6e-08  25%  350 aa  HIS81_ANAVT RecName: Full=Histidinol-phosphate aminotransferase 1; 
   62::252     8e-08  30%  363 aa  HIS8_XANC5 RecName: Full=Histidinol-phosphate aminotransferase;    
   57::242     8e-08  23%  351 aa  HIS8_STAS1 RecName: Full=Histidinol-phosphate aminotransferase;    
   44::244     8e-08  28%  360 aa  HIS8_CHLPD RecName: Full=Histidinol-phosphate aminotransferase;    
   46::248     8e-08  24%  370 aa  HIS81_BACHK RecName: Full=Histidinol-phosphate aminotransferase 1; 
   46::248     8e-08  24%  370 aa  HIS81_BACAN RecName: Full=Histidinol-phosphate aminotransferase 1; 
   55::242     1e-07  30%  358 aa  PATR_RHOE4 RecName: Full=Putative phenylalanine aminotransferase;  
   63::234     1e-07  28%  352 aa  PATR_PROAC RecName: Full=Putative phenylalanine aminotransferase;  
   46::248     1e-07  24%  370 aa  HIS81_BACCZ RecName: Full=Histidinol-phosphate aminotransferase 1; 
   52::270     1e-07  23%  370 aa  HIS8_HELHP RecName: Full=Histidinol-phosphate aminotransferase;    
   74::231     1e-07  31%  347 aa  HIS8_GEOSF RecName: Full=Histidinol-phosphate aminotransferase;    
   67::250     1e-07  25%  360 aa  HIS8_BAUCH RecName: Full=Histidinol-phosphate aminotransferase;    
   57::242     2e-07  25%  351 aa  HIS8_STAHJ RecName: Full=Histidinol-phosphate aminotransferase;    
   85::241     2e-07  26%  365 aa  HIS8_NEIMB RecName: Full=Histidinol-phosphate aminotransferase;    
  109::295     2e-07  23%  454 aa  ATTY_RAT RecName: Full=Tyrosine aminotransferase;       
   78::264     2e-07  24%  417 aa  ATTY_DICDI RecName: Full=Tyrosine aminotransferase;       
   62::238     2e-07  30%  359 aa  PATR_STRAW RecName: Full=Putative phenylalanine aminotransferase;  
   43::235     2e-07  29%  351 aa  HIS8_CHRSD RecName: Full=Histidinol-phosphate aminotransferase;    
  109::295     2e-07  22%  454 aa  ATTY_HUMAN RecName: Full=Tyrosine aminotransferase;       
  102::288     2e-07  23%  447 aa  ATTY_BOVIN RecName: Full=Tyrosine aminotransferase;       
   64::214     3e-07  30%  367 aa  HIS8_PARDP RecName: Full=Histidinol-phosphate aminotransferase;    
   85::241     3e-07  26%  365 aa  HIS8_NEIMF RecName: Full=Histidinol-phosphate aminotransferase;    
   85::241     3e-07  26%  365 aa  HIS8_NEIMA RecName: Full=Histidinol-phosphate aminotransferase;    
   85::241     3e-07  26%  365 aa  HIS8_NEIM0 RecName: Full=Histidinol-phosphate aminotransferase;    
   74::262     3e-07  25%  380 aa  HIS81_PSYA2 RecName: Full=Histidinol-phosphate aminotransferase 1; 
   47::236     3e-07  30%  357 aa  HIS81_METCA RecName: Full=Histidinol-phosphate aminotransferase 1; 
   57::247     4e-07  26%  361 aa  HIS8_LACF3 RecName: Full=Histidinol-phosphate aminotransferase;    
  109::295     4e-07  22%  454 aa  ATTY_MOUSE RecName: Full=Tyrosine aminotransferase;       
  174::397     4e-07  25%  592 aa  ALAM_YEAST RecName: Full=Probable alanine aminotransferase,
  122::423     4e-07  23%  495 aa  1A16_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate synthase
   53::268     5e-07  25%  365 aa  HIS8_CAMC1 RecName: Full=Histidinol-phosphate aminotransferase;    
   60::238     5e-07  29%  357 aa  HIS82_IDILO RecName: Full=Histidinol-phosphate aminotransferase 2; 
   19::239     5e-07  28%  349 aa  HIS81_CARHZ RecName: Full=Histidinol-phosphate aminotransferase 1; 
   30::373     5e-07  23%  417 aa  AVTA_ECOLI RecName: Full=Valine--pyruvate aminotransferase;        
   88::276     6e-07  24%  376 aa  HIS8_SULSO RecName: Full=Histidinol-phosphate aminotransferase;    
   52::255     6e-07  29%  377 aa  HIS8_MYCSS RecName: Full=Histidinol-phosphate aminotransferase;    
   52::255     6e-07  29%  377 aa  HIS8_MYCSK RecName: Full=Histidinol-phosphate aminotransferase;    
   52::255     6e-07  29%  377 aa  HIS8_MYCSJ RecName: Full=Histidinol-phosphate aminotransferase;    
   96::254     6e-07  26%  371 aa  HIS8_METMP RecName: Full=Histidinol-phosphate aminotransferase;    
   60::236     6e-07  27%  359 aa  HIS8_BUCMH RecName: Full=Histidinol-phosphate aminotransferase;    
   72::385     6e-07  30%  412 aa  DAPAT_SYNY3 RecName: Full=LL-diaminopimelate aminotransferase;     
   94::373     6e-07  24%  386 aa  DAPAT_NATTJ RecName: Full=LL-diaminopimelate aminotransferase;     
   79::254     8e-07  24%  371 aa  HIS8_METVS RecName: Full=Histidinol-phosphate aminotransferase;    
   57::234     8e-07  29%  350 aa  HIS8_GEOSL RecName: Full=Histidinol-phosphate aminotransferase;    
   60::251     8e-07  28%  361 aa  HIS8_DINSH RecName: Full=Histidinol-phosphate aminotransferase;    
   83::367     8e-07  25%  387 aa  CBL_BACSU RecName: Full=Cystathionine beta-lyase patB;       
   92::380     8e-07  26%  399 aa  AAT_RICBR RecName: Full=Aspartate aminotransferase;       
   74::231     1e-06  32%  347 aa  HIS8_PELCD RecName: Full=Histidinol-phosphate aminotransferase;    
   86::241     1e-06  26%  359 aa  HIS8_NEIG2 RecName: Full=Histidinol-phosphate aminotransferase;    
   86::241     1e-06  26%  359 aa  HIS8_NEIG1 RecName: Full=Histidinol-phosphate aminotransferase;    
   63::239     1e-06  26%  361 aa  HIS8_HALVO RecName: Full=Histidinol-phosphate aminotransferase;    
   63::244     1e-06  29%  366 aa  HIS8_HALSA RecName: Full=Histidinol-phosphate aminotransferase;    
   63::244     1e-06  29%  366 aa  HIS8_HALS3 RecName: Full=Histidinol-phosphate aminotransferase;    
   52::241     1e-06  31%  357 aa  HIS82_THIDA RecName: Full=Histidinol-phosphate aminotransferase 2; 
   88::263     1e-06  29%  378 aa  HIS82_CAUCR RecName: Full=Histidinol-phosphate aminotransferase 2; 
   45::240     1e-06  24%  367 aa  COBD_THETN RecName: Full=Putative threonine-phosphate
   75::268     1e-06  29%  371 aa  HIS8_PSEA6 RecName: Full=Histidinol-phosphate aminotransferase;    
   54::256     1e-06  32%  382 aa  HIS8_MYCUA RecName: Full=Histidinol-phosphate aminotransferase;    
   96::254     1e-06  27%  371 aa  HIS8_METM7 RecName: Full=Histidinol-phosphate aminotransferase;    
   82::257     1e-06  24%  373 aa  HIS8_METJA RecName: Full=Histidinol-phosphate aminotransferase;    
   62::323     2e-06  27%  362 aa  HIS8_XANC8 RecName: Full=Histidinol-phosphate aminotransferase;    
   52::221     2e-06  31%  349 aa  HIS8_STRMU RecName: Full=Histidinol-phosphate aminotransferase;    
   59::244     2e-06  28%  365 aa  HIS8_POLNA RecName: Full=Histidinol-phosphate aminotransferase;    
   92::380     2e-06  25%  409 aa  AAT_RICFE RecName: Full=Aspartate aminotransferase;       
   92::380     2e-06  24%  401 aa  AAT_RICCN RecName: Full=Aspartate aminotransferase;       
   59::237     2e-06  28%  366 aa  HIS8_MESSB RecName: Full=Histidinol-phosphate aminotransferase;    
   64::272     2e-06  26%  365 aa  HIS8_CAMC5 RecName: Full=Histidinol-phosphate aminotransferase;    
   64::259     2e-06  24%  367 aa  HIS8_ARCB4 RecName: Full=Histidinol-phosphate aminotransferase;    
   63::253     2e-06  26%  374 aa  HIS81_RALSO RecName: Full=Histidinol-phosphate aminotransferase 1; 
   53::235     2e-06  29%  350 aa  HIS81_BRAJA RecName: Full=Histidinol-phosphate aminotransferase 1; 
   72::279     2e-06  32%  408 aa  DAPAT_PROMS RecName: Full=LL-diaminopimelate aminotransferase;     
   62::229     3e-06  26%  432 aa  Y1479_METJA RecName: Full=Uncharacterized aminotransferase MJ1479; 
   80::243     3e-06  28%  361 aa  PATR_MYCMM RecName: Full=Putative phenylalanine aminotransferase;  
   54::256     3e-06  32%  382 aa  HIS8_MYCMM RecName: Full=Histidinol-phosphate aminotransferase;    
   57::252     3e-06  27%  367 aa  HIS81_RHILO RecName: Full=Histidinol-phosphate aminotransferase 1; 
   98::274     3e-06  24%  401 aa  HIS81_GLUOX RecName: Full=Histidinol-phosphate aminotransferase 1; 
   80::243     4e-06  28%  361 aa  PATR_MYCUA RecName: Full=Putative phenylalanine aminotransferase;  
   62::290     4e-06  26%  422 aa  KAT1_HUMAN RecName: Full=Kynurenine--oxoglutarate transaminase 1;  
   65::236     4e-06  30%  356 aa  HIS8_GLUDA RecName: Full=Histidinol-phosphate aminotransferase;    
   63::230     4e-06  34%  359 aa  HIS81_CAUCR RecName: Full=Histidinol-phosphate aminotransferase 1; 
   72::267     4e-06  29%  404 aa  DAPAT_CLOPH RecName: Full=LL-diaminopimelate aminotransferase;     
   61::234     5e-06  29%  352 aa  HIS8_STRGC RecName: Full=Histidinol-phosphate aminotransferase;    
   78::232     5e-06  28%  378 aa  HIS8_BEII9 RecName: Full=Histidinol-phosphate aminotransferase;    
   54::236     5e-06  32%  351 aa  HIS81_PSEAE RecName: Full=Histidinol-phosphate aminotransferase 1; 
   71::234     7e-06  28%  352 aa  HIS8_STRSV RecName: Full=Histidinol-phosphate aminotransferase;    
   54::243     7e-06  32%  354 aa  HIS8_CLOBK RecName: Full=Histidinol-phosphate aminotransferase;    
   54::243     7e-06  32%  354 aa  HIS8_CLOBH RecName: Full=Histidinol-phosphate aminotransferase;    
   54::243     7e-06  32%  354 aa  HIS8_CLOB1 RecName: Full=Histidinol-phosphate aminotransferase;    
   92::384     7e-06  24%  399 aa  AAT_RICTY RecName: Full=Aspartate aminotransferase;       
   52::212     9e-06  29%  373 aa  PATR_CORJK RecName: Full=Putative phenylalanine aminotransferase;  
   54::243     9e-06  31%  354 aa  HIS8_CLOBL RecName: Full=Histidinol-phosphate aminotransferase;    
   46::243     9e-06  25%  352 aa  HIS8_CLOAB RecName: Full=Histidinol-phosphate aminotransferase;    
   57::164     9e-06  25%  362 aa  HIS82_CARHZ RecName: Full=Histidinol-phosphate aminotransferase 2; 
   46::239     9e-06  30%  355 aa  HIS82_BURS3 RecName: Full=Histidinol-phosphate aminotransferase 2; 
   65::346     1e-05  25%  398 aa  MTNE_BACSU RecName: Full=Transaminase mtnE;         EC=2.6.1.-;
   82::259     1e-05  26%  354 aa  HIS8_VESOH RecName: Full=Histidinol-phosphate aminotransferase;    
   76::236     1e-05  28%  362 aa  HIS8_RHOBA RecName: Full=Histidinol-phosphate aminotransferase;    
   58::251     1e-05  27%  373 aa  HIS8_DESVV RecName: Full=Histidinol-phosphate aminotransferase;    
   58::251     1e-05  27%  373 aa  HIS8_DESVH RecName: Full=Histidinol-phosphate aminotransferase;    
   60::284     1e-05  23%  482 aa  ALA2_PANMI RecName: Full=Alanine aminotransferase 2;       
   92::384     1e-05  26%  399 aa  AAT_RICPR RecName: Full=Aspartate aminotransferase;       
   62::323     2e-05  27%  362 aa  HIS8_XANCP RecName: Full=Histidinol-phosphate aminotransferase;    
   89::216     2e-05  29%  369 aa  HIS8_STRAW RecName: Full=Histidinol-phosphate aminotransferase;    
   63::234     2e-05  25%  368 aa  HIS8_RHORT RecName: Full=Histidinol-phosphate aminotransferase;    
   84::258     2e-05  23%  363 aa  HIS8_HAHCH RecName: Full=Histidinol-phosphate aminotransferase;    
   74::231     2e-05  27%  347 aa  HIS8_GEOUR RecName: Full=Histidinol-phosphate aminotransferase;    
   46::234     2e-05  31%  350 aa  HIS8_GEOMG RecName: Full=Histidinol-phosphate aminotransferase;    
   52::243     2e-05  26%  358 aa  HIS8_CLOB8 RecName: Full=Histidinol-phosphate aminotransferase;    
  103::382     2e-05  25%  402 aa  CBL_MYCLE RecName: Full=Putative cystathionine beta-lyase;       
   89::317     2e-05  24%  507 aa  ALAT_YEAST RecName: Full=Probable alanine aminotransferase;        
   96::322     2e-05  26%  457 aa  KAT1_RAT RecName: Full=Kynurenine--oxoglutarate transaminase 1,
   62::288     2e-05  26%  424 aa  KAT1_MOUSE RecName: Full=Kynurenine--oxoglutarate transaminase 1;  
   60::254     2e-05  26%  362 aa  HIS8_SILST RecName: Full=Histidinol-phosphate aminotransferase;    
   49::246     2e-05  23%  354 aa  HIS8_LEUCK RecName: Full=Histidinol-phosphate aminotransferase;    
   88::246     2e-05  25%  368 aa  HIS8_DIAST RecName: Full=Histidinol-phosphate aminotransferase;    
   93::227     3e-05  21%  405 aa  YFBQ_SHIFL RecName: Full=Uncharacterized aminotransferase yfbQ;    
   93::227     3e-05  21%  405 aa  YFBQ_ECOLI RecName: Full=Uncharacterized aminotransferase yfbQ;    
   93::227     3e-05  21%  405 aa  YFBQ_ECOL6 RecName: Full=Uncharacterized aminotransferase yfbQ;    
   65::236     3e-05  30%  350 aa  HIS8_PSE14 RecName: Full=Histidinol-phosphate aminotransferase;    
   54::243     3e-05  31%  354 aa  HIS8_CLOB6 RecName: Full=Histidinol-phosphate aminotransferase;    
   64::250     3e-05  23%  366 aa  HIS8_CAMFF RecName: Full=Histidinol-phosphate aminotransferase;    
   60::284     3e-05  23%  482 aa  ALA2_HORVU RecName: Full=Alanine aminotransferase 2;       
   17::218     3e-05  22%  404 aa  Y286_HAEIN RecName: Full=Uncharacterized aminotransferase HI0286;  
   46::236     3e-05  27%  355 aa  HIS82_GLUOX RecName: Full=Histidinol-phosphate aminotransferase 2; 
   52::237     3e-05  28%  353 aa  HIS81_ANASP RecName: Full=Histidinol-phosphate aminotransferase 1; 
   75::299     3e-05  30%  496 aa  ALAT1_MOUSE RecName: Full=Alanine aminotransferase 1;       
   46::231     5e-05  27%  350 aa  HIS8_GEOBB RecName: Full=Histidinol-phosphate aminotransferase;    
   68::246     5e-05  25%  363 aa  HIS8_CHLCH RecName: Full=Histidinol-phosphate aminotransferase;    
   88::246     5e-05  25%  368 aa  HIS8_ACISJ RecName: Full=Histidinol-phosphate aminotransferase;    
   72::390     5e-05  26%  408 aa  DAPAT_LEPBL RecName: Full=LL-diaminopimelate aminotransferase;     
   72::390     5e-05  26%  408 aa  DAPAT_LEPBJ RecName: Full=LL-diaminopimelate aminotransferase;     
  101::212     5e-05  28%  213 aa  AAT_STRGR RecName: Full=Probable aspartate aminotransferase;       
   92::252     5e-05  23%  429 aa  AAT_MYCTU RecName: Full=Probable aspartate aminotransferase;       
   92::252     5e-05  23%  429 aa  AAT_MYCBO RecName: Full=Probable aspartate aminotransferase;       
   65::209     6e-05  31%  361 aa  HIS8_UNCMA RecName: Full=Histidinol-phosphate aminotransferase;    
   65::232     6e-05  30%  392 aa  DAPAT_DESAP RecName: Full=LL-diaminopimelate aminotransferase;     
   55::216     6e-05  25%  407 aa  CBL_MYCTU RecName: Full=Putative cystathionine beta-lyase;       
   55::216     6e-05  25%  407 aa  CBL_MYCBO RecName: Full=Putative cystathionine beta-lyase;       
   68::222     8e-05  25%  365 aa  HIS8_RHOPB RecName: Full=Histidinol-phosphate aminotransferase;    
   77::254     8e-05  28%  379 aa  HIS8_MYCS2 RecName: Full=Histidinol-phosphate aminotransferase;    
   55::220     8e-05  27%  362 aa  HIS8_MARMM RecName: Full=Histidinol-phosphate aminotransferase;    
   62::245     8e-05  25%  363 aa  HIS8_CAMLR RecName: Full=Histidinol-phosphate aminotransferase;    
   72::385     8e-05  30%  410 aa  DAPAT_METTH RecName: Full=LL-diaminopimelate aminotransferase;     
   66::235     1e-04  28%  361 aa  HIS8_FRAP2 RecName: Full=Histidinol-phosphate aminotransferase;    
   55::245     1e-04  27%  361 aa  HIS8_ACIBT RecName: Full=Histidinol-phosphate aminotransferase;    
   55::245     1e-04  27%  361 aa  HIS8_ACIB5 RecName: Full=Histidinol-phosphate aminotransferase;    
   55::245     1e-04  27%  361 aa  HIS8_ACIB3 RecName: Full=Histidinol-phosphate aminotransferase;    
   65::262     1e-04  34%  384 aa  HIS82_ANASP RecName: Full=Histidinol-phosphate aminotransferase 2; 
   51::250     1e-04  25%  386 aa  YBDL_ECOLI RecName: Full=Aminotransferase ybdL;         EC=2.6.1.-;
  109::362     1e-04  23%  390 aa  MALY_ECOLI RecName: Full=Protein malY;Includes:  RecName:
   46::231     1e-04  26%  350 aa  HIS8_GEOSM RecName: Full=Histidinol-phosphate aminotransferase;    
   55::245     1e-04  27%  361 aa  HIS8_ACIBY RecName: Full=Histidinol-phosphate aminotransferase;    
   55::245     1e-04  27%  361 aa  HIS8_ACIBC RecName: Full=Histidinol-phosphate aminotransferase;    
   72::390     1e-04  27%  408 aa  DAPAT_SYNS9 RecName: Full=LL-diaminopimelate aminotransferase;     
   72::280     1e-04  28%  408 aa  DAPAT_DESPS RecName: Full=LL-diaminopimelate aminotransferase;     
   87::248     1e-04  26%  444 aa  BNA3_YEAST RecName: Full=Probable kynurenine--oxoglutarate
  119::420     1e-04  22%  484 aa  1A1C_SOYBN RecName: Full=1-aminocyclopropane-1-carboxylate
   27::161     2e-04  22%  319 aa  HIS81_ARCFU RecName: Full=Histidinol-phosphate aminotransferase 1; 
  129::318     2e-04  24%  461 aa  DAPAT_ARATH RecName: Full=LL-diaminopimelate aminotransferase,
   63::180     2e-04  34%  406 aa  CSD_CHLPN RecName: Full=Probable cysteine desulfurase;       
  126::335     2e-04  23%  447 aa  1A17_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate synthase
    1::184     2e-04  24%  286 aa  HIS8_SULTO RecName: Full=Histidinol-phosphate aminotransferase;    
   57::248     2e-04  27%  368 aa  HIS8_COLP3 RecName: Full=Histidinol-phosphate aminotransferase;    
   72::261     2e-04  23%  411 aa  DAPAT_PARUW RecName: Full=LL-diaminopimelate aminotransferase;     
   65::262     3e-04  27%  421 aa  YDT4_SCHPO RecName: Full=Uncharacterized aminotransferase
   77::205     3e-04  29%  219 aa  HIS8_MYCSM RecName: Full=Histidinol-phosphate aminotransferase;    
   52::234     4e-04  28%  360 aa  HIS8_LACLA RecName: Full=Histidinol-phosphate aminotransferase;    
  164::323     4e-04  26%  534 aa  ALAM_DICDI RecName: Full=Probable alanine aminotransferase,
  107::252     4e-04  25%  487 aa  1A11_ORYSJ RecName: Full=1-aminocyclopropane-1-carboxylate synthase
  107::252     4e-04  25%  487 aa  1A11_ORYSI RecName: Full=1-aminocyclopropane-1-carboxylate synthase
   55::245     5e-04  27%  361 aa  HIS8_ACIBS RecName: Full=Histidinol-phosphate aminotransferase;    
   70::202     7e-04  29%  370 aa  HIS8_ACIAC RecName: Full=Histidinol-phosphate aminotransferase;    
   81::169     7e-04  28%  356 aa  HIS82_BURPS RecName: Full=Histidinol-phosphate aminotransferase 2; 
   81::169     7e-04  28%  356 aa  HIS82_BURP1 RecName: Full=Histidinol-phosphate aminotransferase 2; 
   65::277     7e-04  28%  380 aa  HIS82_ANAVT RecName: Full=Histidinol-phosphate aminotransferase 2; 
   81::169     7e-04  28%  356 aa  HIS81_BURMA RecName: Full=Histidinol-phosphate aminotransferase 1; 
   72::284     7e-04  31%  409 aa  DAPAT_DESAH RecName: Full=LL-diaminopimelate aminotransferase;     
   51::226     9e-04  27%  364 aa  HIS8_CAMJR RecName: Full=Histidinol-phosphate aminotransferase;    
   51::226     9e-04  27%  364 aa  HIS8_CAMJJ RecName: Full=Histidinol-phosphate aminotransferase;    
   51::226     9e-04  27%  364 aa  HIS8_CAMJ8 RecName: Full=Histidinol-phosphate aminotransferase;    
   70::322     9e-04  21%  368 aa  1A1C_PHAAU RecName: Full=1-aminocyclopropane-1-carboxylate
    1::397

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxPLSWSEAFGKGAGRIQASTIRELLKLTQRPGILSFAGGLPAPELFPKXXXXXXXXRILREKGEVALQY
Y104_SULSO      ----------------LRTSEIRDLLKLTEGKNVISLAGGLPDPQTFPVEEIKKIADDILLNSADKALQY
YISV_BACSU      --PLDWSDYVRSGIHRANSSIIQAINQNEPRADIIRLGTGELSPDLVPADTIGRMFQQI--NPGVLSLGY
AADAT_HUMAN     -------------------SPIRTMTDILSRKSMISLAGGLPNPNMFPFKTAVITVEQFGEEMMKRALQY
YDCR_ECOLI      ---------------------IFDMLQASRDPSVVPFASAFPDPRLFPLQQLNRSLAQVSKTATAMSVIE
AADAT_RAT       -----------------KTSPIRATVEIMSRADIISLAPGSPNPKVFPSAVFTVENGSTIRFEGEMALQY
AATR2_DICDI     -----------------EASPIRSLFQYSSLPGMISLGGGLPNASTFPSINIELKDGSKLEIEGEEAFQY
YDFD_BACSU      -----WDQYVTSGIQMPSRKIVQEINQSESNTDLIQLSKGELSAEIFPLAVMKEMMGKVSQHME--AFGY
AADAT_MOUSE     ---------------------------------LISLAPGSPNPSMFPSAAFTVENGSTIRFEDDLALQY
MOCR_RHIME      -------------------------------PDRIAFHPGYPEIKAFPFSTWARLLKRHARYSHEDLYGY
AADAT_BOVIN     -------------------STIRVMTEILSKASVISLATGAPNPNTFPFKTAVITIEQFNEQMMKRALQY
AATR3_SCHPO     ---------------------------------MLSFAGGEPNPSKFPIHKLSVSFPEVNSWEKDTALQY
YJIR_ECOLI      ---------------------------------------------------------RVVQHNLQTVLGY
AATR1_SCHPO     ------------------------LSKSSRNIKIISLAGGLPNPEYFPIREMDAEIPAINSWKKDXALQY
NORG_STAAC      -----WSEMMLWSSQQRSQYTVQLINKIETDDSYIHISKGELGISLMPHIQLKKAMSNTASHIEDLSFGY
NORG_STAA8      -----WSEMMLWSSQQRSQYTVQLINKIETDDSYIHISKGELGISLMPHIQLKKAMSNTASHIEDLSFGY
NORG_STAA3      -----WSEMMLWSSQQRSQYTVQLINKIETDDSYIHISKGELGISLMPHIQLKKAMSNTASHIEDLSFGY
NORG_STAAN      -----WSEMMLWSSQQRSQYTVQLINKIETDDSYIHISKGELGISLMPHIQLKKAMSNTASHIEDLSFGY
NORG_STAAM      -----WSEMMLWSSQQRSQYTVQLINKIETDDSYIHISKGELGISLMPHIQLKKAMSNTASHIEDLSFGY
AATR1_DICDI     ---------------------------------ILSFGAGIPSKLFFPIKELEFNFNRLSKEDLDLVQQY
NORG_STAAB      -----WSEMMLWSSRQRSQYTVQLINKIETDASYIHISKGELGQPLMPHIQLKKAMSNTASHIEDLSFGY
AATR2_SCHPO     ------------------------------------------------------------------SLQY
YDEL_BACSU      ----------------------------------------------------------------------
YCXD_BACSU      ------------------------------------FATSAPDPDVFPYLDFQHCINKAIDTYKNDLFIY
YHDI_BACSU      ----------------------------------IDFHQGSVDPTLFPFNAWRKSIVKSLRYSGSFHTSG
GABR_BACSU      ----------------------------------------------------------------------
ARO9_YEAST      ------------------------------------------------------------------SFQY
DAPAT_DESDG     --------------------------------------------------------------------QY
DAPAT_CARHZ     --------------------------------------------------------------------QY
AAT_AQUAE       -----------------------------------------------------------IRALREGKTKY
HIS8_ERWCT      ----------------------------------------------------------------------
ARO8_YEAST      -----FSYLFSDETNARKPSPLKTCIHLFQDPNIIFLGGGLPLKDYFPKPPFPQGIGAPIDEQNCIALQY
DAPAT_DEHE1     --------------------------------------------------------------------RY
AAT_THEAQ       -----------------------------------------------------------VKEAGRRALKY
AAT_PYRHO       ----------------IKRSKIRELFRASKMEDVISL--GIGEPDFDTPKNIKEAAKRALDEGWT---HY
AAT_SULSO       ---------------------------------------------------------------------Y
AAT_THEMA       -------------------------------------------------------------QKGEV--KY
AAT_PYRAB       ---------------------------------------------------------------------Y
HIS8_PECCP      ----------------------------------------------------------------------
AAT_THET8       --------------------------------------------------------------------KY
AAT1_BACSU      -----------------------------------------------------------VRSMNEGHTKY
HIS8_CHLTE      ----------------------------------------------------------------------
HIS8_BLOPB      ----------------------------------------------------------------------
HIS8_BACHD      ----------------------------------------------------------------------
HIS8_ANADF      ----------------------------------------------------------------------
DAPAT_DEHSB     --------------------------------------------------------------------RY
DAPAT_DESVH     --------------------------------------------------------------------QY
YEY2_YEAST      ----------------------------------------------------------------------
HIS8_HALWD      ----------------------------------------------------------------------
DAPAT_DEHSC     --------------------------------------------------------------------RY
HIS82_NITMU     ----------------------------------------------------------------EVSL-Y
DAPAT_DESVV     --------------------------------------------------------------------QY
HIS8_WOLSU      ----------------------------------------------------------------------
HIS81_MANSM     --------------------------------------------------------------------RY
HIS8_THEGJ      ----------------------------------------------------------IFEELREVSFNR
HIS81_RALEJ     --------------------------------------------------------------------RY
YFDZ_ECOLI      ---------------------------------------------------------------------Y
HIS8_PSEST      --------------------------------------------------------------RGELSTRY
AAT_STRVG       --------------------------------------------------------------------RY
HIS8_MOOTA      ----------------------------------------------------------------------
YDEF_BACSU      ----------------------------------------------------------------------
HIS8_SULNB      ---------------------------------------------------------KVIRSNADIAHLY
DAPAT_SYNFM     --------------------------------------------------------------------QY
DAPAT_HALOH     ---------------------------------------------------------------------Y
HIS8_BREBN      ----------------------------------------------------------------------
AAT_BACST       -----------------------------------------------------------IKAMNEGHTKY
HIS8_THETN      ----------------------------------------------------------------------
HIS82_RALSO     --------------------------------------------------------------------RY
DAPAT_DESAD     --------------------------------------------------------------KNPVNHQY
HIS8_VIBCH      --------------------------------------------------------------------RY
HIS8_THEP3      ----------------------------------------------------------------------
HIS8_SYMTH      ----------------------------------------------------------------------
DAPT2_ANAVT     ---------------------------------------------------------------------Y
AAT_SULTO       ---------------------------------------------------------------------Y
HIS8_SALPK      ----------------------------------------------------------------------
HIS8_SALPA      ----------------------------------------------------------------------
HIS8_SALDC      ----------------------------------------------------------------------
AATC_RHIME      ----------------------------------------------------------------------
AAT_BACY2       --------------------------------------------------------------------KY
HIS8_VIBPA      --------------------------------------------------------------------RY
HIS8_THEPX      ----------------------------------------------------------------------
HIS8_SALTY      ----------------------------------------------------------------------
HIS8_SALTI      ----------------------------------------------------------------------
HIS8_SALSV      ----------------------------------------------------------------------
HIS8_SALPC      ----------------------------------------------------------------------
HIS8_SALPB      ----------------------------------------------------------------------
HIS8_SALNS      ----------------------------------------------------------------------
HIS8_SALHS      ----------------------------------------------------------------------
HIS8_SALG2      ----------------------------------------------------------------------
HIS8_SALEP      ----------------------------------------------------------------------
HIS8_SALA4      ----------------------------------------------------------------------
HIS81_NITOC     ----------------------------------------------------------VLGESG----RY
DAPT2_ANASP     ---------------------------------------------------------------------Y
HIS8_VIBCM      --------------------------------------------------------------------RY
HIS8_VIBC3      --------------------------------------------------------------------RY
HIS8_PYRKO      ----------------------------------------------------------------------
HIS8_DESHY      ----------------------------------------------------------------DIAFNR
DAPAT_AQUAE     --------------------------------------------------------------------KY
Y1527_METMP     ----------------------------------------------------------------------
PATA_BACSU      -------------AREIEISGIRKFSNLVQHEDVISLTIG--QPDFFTPHHVKAAAKKAIDEN---VTSY
HIS81_DECAR     ----------------------------------------------------------------------
HIS8_SODGM      ----------------------------------------------------------------------
HIS8_SALCH      ----------------------------------------------------------------------
HIS8_ANOFW      ----------------------------------------------------------VMNELDDLALY-
HIS82_THICR     ----------------------------------------------------------------------
HIS82_HAEIN     --------------------------------------------------------------------RY
HIS8_ENTS8      ----------------------------------------------------------------------
HIS8_CLONN      ---------------------------------------------------------KIIRSLIELEFNN
HIS82_ARCFU     ----------------------------------------------------------------------
DAPAT_GLOVI     ---------------------------------------------------------------------Y
HIS8_PHOLL      ----------------------------------------------------------------------
PATR_MYCA9      -------------------------------PGAIKLASNETVQEPLPSVRAA------LAEAGSLINRY
HIS8_PROA2      --------------------------------------------------------------KHEAWNRY
HIS82_HAEI8     --------------------------------------------------------------------RY
AAT1_METJA      ------------------------------------------------------------RALDEGKTHY
HIS8_ECO45      ----------------------------------------------------------------------
HIS8_CLOCE      -------------------------------------------------------------------LNL
HIS81_THIDA     ---------------------------------------------------------------------Y
Y1391_METJA     ----------------------------------------------------------------------
PATR_MYCVP      -------------------------------------------------------------EKAIDGINR
PATR_MYCPA      -------------------------------------------------------------ERAVAVVNR
HIS8_XYLFA      ----------------------------------------------------------------------
HIS8_SHIFL      ----------------------------------------------------------------------
HIS8_SHIF8      ----------------------------------------------------------------------
HIS8_SHIDS      ----------------------------------------------------------------------
HIS8_ECOK1      ----------------------------------------------------------------------
HIS8_ECO81      ----------------------------------------------------------------------
HIS8_ECO5E      ----------------------------------------------------------------------
HIS8_ECO57      ----------------------------------------------------------------------
HIS8_ECO55      ----------------------------------------------------------------------
HIS82_BORPA     ----------------------------------------------------------IARAARETPLNR
HIS82_BORBR     ----------------------------------------------------------IARAARETPLNR
PATR_MYCA1      -------------------------------------------------------------ERAVAIVNR
HIS8_XYLFT      ----------------------------------------------------------------------
HIS8_XYLFM      ----------------------------------------------------------------------
HIS8_XYLF2      ----------------------------------------------------------------------
HIS8_SHIBS      ----------------------------------------------------------------------
HIS8_PELLD      ----------------------------------------------------------------------
HIS8_METFL      ----------------------------------------------------------------------
HIS82_METCA     ----------------------------------------------------------------------
PATR_MYCSS      -------------------------------------------------------------EKATDQLNR
PATR_MYCSK      -------------------------------------------------------------EKATDQLNR
PATR_MYCSJ      -------------------------------------------------------------EKATDQLNR
HIS8_YERPY      ----------------------------------------------------------------------
HIS8_YERPP      ----------------------------------------------------------------------
HIS8_YERPN      ----------------------------------------------------------------------
HIS8_YERPG      ----------------------------------------------------------------------
HIS8_YERPE      ----------------------------------------------------------------------
HIS8_YERPA      ----------------------------------------------------------------------
HIS8_YERP3      ----------------------------------------------------------------------
HIS8_SALAR      ----------------------------------------------------------------------
HIS8_LEPIN      -------------------------------------------------------------------MSF
HIS8_LEPIC      -------------------------------------------------------------------MSF
HIS8_KLEP3      ----------------------------------------------------------------------
HIS8_BLOFL      ----------------------------------------------------------------------
HIS8_RHISN      ----------------------------------------------------------------------
HIS8_PSEE4      -------------------------------------------------------------------LRL
HIS8_ESCF3      ----------------------------------------------------------------------
HIS8_ECOUT      ----------------------------------------------------------------------
HIS8_ECOSE      ----------------------------------------------------------------------
HIS8_ECOLI      ----------------------------------------------------------------------
HIS8_ECOLC      ----------------------------------------------------------------------
HIS8_ECOL6      ----------------------------------------------------------------------
HIS8_ECOL5      ----------------------------------------------------------------------
HIS8_ECOHS      ----------------------------------------------------------------------
HIS8_ECODH      ----------------------------------------------------------------------
HIS8_ECOBW      ----------------------------------------------------------------------
HIS8_ECO8A      ----------------------------------------------------------------------
HIS8_ECO27      ----------------------------------------------------------------------
HIS8_ECO24      ----------------------------------------------------------------------
HIS8_CHLL2      ----------------------------------------------------------------------
HIS8_ARATH      ----------------------------------------------------------------------
HIS82_NITEU     ----------------------------------------------------------------------
HIS82_MANSM     --------------------------------------------------------------------RY
PDXR_CORGL      ---------------------------------------------------------------------H
HIS8_LYSSC      ----------------------------------------------------------------------
HIS8_AERHH      ----------------------------------------------------------------------
Y3073_RHOS4     --------------------------------------------------------------RGTLAMHY
HIS8_YERPS      ----------------------------------------------------------------------
HIS8_YERPB      ----------------------------------------------------------------------
HIS8_VIBFM      --------------------------------------------------------------------RY
HIS8_SHISS      ----------------------------------------------------------------------
HIS8_YERE8      ----------------------------------------------------------------------
HIS8_PSEPK      ----------------------------------------------------------------------
HIS8_KLEP7      ----------------------------------------------------------------------
HIS8_CITK8      ----------------------------------------------------------------------
HIS8_VIBHB      --------------------------------------------------------------------RY
HIS8_PYRFU      ----------------------------------------------------------------------
HIS8_PSEPW      ----------------------------------------------------------------------
HIS82_PASMU     --------------------------------------------------------------------RY
HIS82_BORPE     ----------------------------------------------------------IARAARETPLNR
PATR_MYCS2      ----------------------------------------------------------------------
HIS8_ECO7I      ----------------------------------------------------------------------
HIS8_BACLD      ----------------------------------------------------------------------
HIS81_IDILO     -------------------------------------------------------------------VRY
HIS8_VIBF1      --------------------------------------------------------------------RY
HIS8_SHIB3      ----------------------------------------------------------------------
HIS8_SERP5      ----------------------------------------------------------------------
HIS8_PSEP1      ----------------------------------------------------------------------
HIS8_PELPB      ----------------------------------------------------------------------
HIS8_NITSB      -----------------------------------------------------------VREIADTMYMY
HIS8_METTH      ----------------------------------------------------------------------
HIS8_ECOLU      ----------------------------------------------------------------------
HIS8_CHLP8      ----------------------------------------------------------------------
HIS8_CALS8      ----------------------------------------------------------------------
PATR_RHOSR      ----------------------------------------------------------------------
HIS8_TOBAC      ----------------------------------------------------------------------
HIS8_PSEPG      ----------------------------------------------------------------------
HIS8_ENT38      ----------------------------------------------------------------------
HIS81_PASMU     ----------------------------------------------------------------------
AAT_SULAC       ---------FSKGALAISGETTQDIARSVQKEKIVNFGIGQPDFPTFQK----------IRDEAKKALDY
HIS8_NICPL      ----------------------------------------------------------------------
HIS8_METPP      ------------------------------------------------------------RRLGALAINR
HIS8_LEPBL      -------------------------------------------------------------QKAASKMPY
HIS8_LEPBJ      -------------------------------------------------------------QKAASKMPY
HIS81_BACC1     ---------------------------------------------------------RVTEALTSLASQY
HIS8_ROSCS      ----------------------------------------------------------------------
HIS8_NOVAD      ----------------------------------------------------------------------
HIS8_ECOSM      ----------------------------------------------------------------------
PATR_STRCO      ----------------------------TYKPGKPAAADGPVAYKLSSNENPYPPLPGVMETVTAAAASF
HIS8_DESPS      ----------------------------------------------------------------------
HIS8_VIBVY      ----------------------------------------------------------------------
HIS8_VIBVU      ----------------------------------------------------------------------
HIS8_LACPL      ----------------------------------------------------------------------
HIS8_STRMK      ----------------------------------------------------------------------
HIS8_PROVI      -------------------------------------------------------------------LPY
HIS8_HALLT      -----------------------------------------------------------IREHADRVHQY
HIS8_SULDN      ---------------------------------------------------------KVIDAVGKILTKM
DAPAT_MOOTA     --------------------------------------------------------------------RY
HIS8_METST      ----------------------------------------------------------------------
HIS8_GEOKA      ----------------------------------------------------------------------
HIS8_AZOSE      -----------------------------------------------------------IRAEASDALRL
HIS81_PSEF5     ----------------------------------------------------------------------
HIS8_LISIN      -----------------------------------------------------------IQANSSVETEI
HIS81_LEGPL     ---------------------------------------------------------------GEYNLNY
HIS8_ACEPA      -----------------------------------------------------------IRAADNDTLRL
AAT_PYRKO       ---------------------------------------------------------------------Y
HIS8_XANCB      ----------------------------------------------------------------------
HIS8_GEOSW      ----------------------------------------------------------------------
HIS8_DESHD      -----------------------------------------------------------------IAFNR
HIS8_BUCSC      ----------------------------------------------------------------------
HIS81_PSEPF     ----------------------------------------------------------------------
PATR_STRGG      ----------------------------------------------------------------------
HIS8_BUCAP      ----------------------------------------------------------------------
HIS8_BACCN      ----------------------------------------------------------------------
HIS8_AERS4      ----------------------------------------------------------------------
HIS82_BACAN     ---------------------------------------------------------RVLDELQKSWLDH
DAPAT_DESVM     --------------------------------------------------------------------QY
HIS8_MACCJ      --------------------------------------------------------------RSQDALNY
HIS8_HALMA      ----------------------------------------------------------------------
HIS8_AKKM8      ----------------------------------------------------------------------
HIS81_LEGPH     ---------------------------------------------------------------GEHNLNY
DAPAT_DESDA     -------------------------------------------------------------EMGDATLGY
HIS8_PSEU2      ----------------------------------------------------------------------
HIS8_LISMF      -----------------------------------------------------------LQANSSVETEI
HIS8_GEOTN      ----------------------------------------------------------------------
HIS8_SYNJB      ----------------------------------------------------------LLWEKGIPSNRY
HIS8_ROSDO      ----------------------------------------------------------------------
HIS8_PHOPR      --------------------------------------------------------------------RY
HIS8_LISMC      -----------------------------------------------------------LQADSSVETEI
HIS8_HAEIG      ----------------------------------------------------------------------
HIS8_HAEIE      ----------------------------------------------------------------------
HIS8_BUCDN      ----------------------------------------------------------------------
HIS8_BACSU      ----------------------------------------------------------------------
HIS82_BACCZ     ---------------------------------------------------------RVLDELQKSWLDH
HIS81_HAEIN     ----------------------------------------------------------------------
1A112_ARATH     ---------------------------------------------------------------------Y
PATR_NOCFA      ----------------------------------------------------------------------
HIS8_XANAC      ----------------------------------------------------------------------
HIS8_LISW6      ----------------------------------------------------------------------
HIS8_LISMH      -----------------------------------------------------------LQANSSVETEI
HIS8_DEHSC      ----------------------------------------------------------------------
HIS8_DEHSB      ----------------------------------------------------------------------
HIS8_BACNA      ----------------------------------------------------------------------
HIS8_ALISL      --------------------------------------------------------------------RY
HIS82_DECAR     ----------------------------------------------------------------------
HIS81_LEGPA     ---------------------------------------------------------------GEHNLNY
HIS8_ROSS1      ----------------------------------------------------------------------
HIS8_PSESM      ----------------------------------------------------------------------
HIS8_DEHE1      ----------------------------------------------------------------------
PATR_MYCTU      ----------------------------------------------------------------------
PATR_MYCTA      ----------------------------------------------------------------------
PATR_MYCBT      ----------------------------------------------------------------------
PATR_MYCBP      ----------------------------------------------------------------------
PATR_MYCBO      ----------------------------------------------------------------------
HIS8_LISMO      -----------------------------------------------------------LQANSNVETEI
HIS8_BACP2      ----------------------------------------------------------------------
ALAT_SCHPO      --------------GQSPITFVRQVLSLCQYPTLLDHAEEKWFQNLFPTDVVQRSKM-LLKESGSLGA-Y
AAT2_METJA      ---------------------------------------------------------------------Y
HIS8_METM5      ----------------------------------------------------------------------
HIS81_HAEI8     ----------------------------------------------------------------------
HIS81_BACCR     ---------------------------------------------------------RVTEALTSLASQY
HIS81_ANAVT     ----------------------------------------------------------------------
HIS8_XANC5      ----------------------------------------------------------------------
HIS8_STAS1      -------------------------------------------------------------------LQY
HIS8_CHLPD      -----------------------------------------------------------LKEEVLEAFEK
HIS81_BACHK     ---------------------------------------------------------RVTEALTSLASQY
HIS81_BACAN     ---------------------------------------------------------RVTEALTSLASQY
PATR_RHOE4      ----------------------------------------------------------------------
PATR_PROAC      ----------------------------------------------------------------------
HIS81_BACCZ     ---------------------------------------------------------RVTEALTSLASQY
HIS8_HELHP      -----------------------------------------------------------LQKNAHKAFLY
HIS8_GEOSF      ----------------------------------------------------------------------
HIS8_BAUCH      ----------------------------------------------------------------------
HIS8_STAHJ      -------------------------------------------------------------------LFY
HIS8_NEIMB      ----------------------------------------------------------------------
ATTY_RAT        ---------------------------------------------------------------------Y
ATTY_DICDI      ---------------------------------------------------------------------Y
PATR_STRAW      ----------------------------------------------------------------------
HIS8_CHRSD      ---------------------------------------------------------QVLREFPVDHLRL
ATTY_HUMAN      ---------------------------------------------------------------------Y
ATTY_BOVIN      ---------------------------------------------------------------------Y
HIS8_PARDP      ----------------------------------------------------------------------
HIS8_NEIMF      ----------------------------------------------------------------------
HIS8_NEIMA      ----------------------------------------------------------------------
HIS8_NEIM0      ----------------------------------------------------------------------
HIS81_PSYA2     --------------------------------------------------------------------RY
HIS81_METCA     --------------------------------------------------------------RGELSLRL
HIS8_LACF3      ------------------------------------------------------------------ALNR
ATTY_MOUSE      ---------------------------------------------------------------------Y
ALAM_YEAST      ----------------------RQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAY
1A16_ARATH      ----------------------------------------------------------------------
HIS8_CAMC1      -----------------------------------------------------------LKEVAKNAHLY
HIS82_IDILO     ----------------------------------------------------------------------
HIS81_CARHZ     -------------------------------PHLVSYEIKLDAPYLFPKSLLEEIFSKIGTR--DFPLYP
AVTA_ECOLI      -------------------------------PGAIMLGGGNPAPEMQDYFQTLLTDMLESGKATDALCNY
HIS8_SULSO      ----------------------------------------------------------------------
HIS8_MYCSS      ----------------------------------------------------------VTRSVGEAALHR
HIS8_MYCSK      ----------------------------------------------------------VTRSVGEAALHR
HIS8_MYCSJ      ----------------------------------------------------------VTRSVGEAALHR
HIS8_METMP      ----------------------------------------------------------------------
HIS8_BUCMH      ----------------------------------------------------------------------
DAPAT_SYNY3     ---------------------------------------------------------------------Y
DAPAT_NATTJ     ----------------------------------------------------------------------
HIS8_METVS      ----------------------------------------------------------------------
HIS8_GEOSL      -------------------------------------------------------------------LRT
HIS8_DINSH      ----------------------------------------------------------------------
CBL_BACSU       ----------------------------------------------------------------------
AAT_RICBR       ----------------------------------------------------------------------
HIS8_PELCD      ----------------------------------------------------------------------
HIS8_NEIG2      ----------------------------------------------------------------------
HIS8_NEIG1      ----------------------------------------------------------------------
HIS8_HALVO      ----------------------------------------------------------------------
HIS8_HALSA      ----------------------------------------------------------------------
HIS8_HALS3      ----------------------------------------------------------------------
HIS82_THIDA     --------------------------------------------------------------RGEVGLRL
HIS82_CAUCR     ----------------------------------------------------------------------
COBD_THETN      ----------------------------------------------------------------EVDLSR
HIS8_PSEA6      ----------------------------------------------------------------------
HIS8_MYCUA      ----------------------------------------------------------VVRSVGEAALHR
HIS8_METM7      ----------------------------------------------------------------------
HIS8_METJA      ----------------------------------------------------------------------
HIS8_XANC8      ----------------------------------------------------------------------
HIS8_STRMU      --------------------------------------------------------------------KY
HIS8_POLNA      ---------------------------------------------------------------GALALNR
AAT_RICFE       ----------------------------------------------------------------------
AAT_RICCN       ----------------------------------------------------------------------
HIS8_MESSB      -------------------------------------------------------------------LEI
HIS8_CAMC5      ----------------------------------------------------------------------
HIS8_ARCB4      ----------------------------------------------------------------------
HIS81_RALSO     ----------------------------------------------------------------EVALNR
HIS81_BRAJA     -------------------------------------------------------------------LRL
DAPAT_PROMS     ---------------------------------------------------------------------Y
Y1479_METJA     --------------------------------------------------------------KNDCSYAY
PATR_MYCMM      ----------------------------------------------------------------------
HIS8_MYCMM      ----------------------------------------------------------VVRSVGEAALHR
HIS81_RHILO     -------------------------------------------------------------QAGAEMFRL
HIS81_GLUOX     ----------------------------------------------------------------------
PATR_MYCUA      ----------------------------------------------------------------------
KAT1_HUMAN      --------------------------------------------------------------------QY
HIS8_GLUDA      ----------------------------------------------------------------------
HIS81_CAUCR     ----------------------------------------------------------------------
DAPAT_CLOPH     ---------------------------------------------------------------------Y
HIS8_STRGC      ----------------------------------------------------------------------
HIS8_BEII9      ----------------------------------------------------------------------
HIS81_PSEAE     -------------------------------------------------------------------LRL
HIS8_STRSV      ----------------------------------------------------------------------
HIS8_CLOBK      -------------------------------------------------------------------LRL
HIS8_CLOBH      -------------------------------------------------------------------LRL
HIS8_CLOB1      -------------------------------------------------------------------LRL
AAT_RICTY       ----------------------------------------------------------------------
PATR_CORJK      ----------------------------------------------------------------------
HIS8_CLOBL      -------------------------------------------------------------------LRL
HIS8_CLOAB      -----------------------------------------------------------IKKEADYKLKL
HIS82_CARHZ     -------------------------------------------------------------------VNY
HIS82_BURS3     ----------------------------------------------------------IARELGETGLRR
MTNE_BACSU      --------------------------------------------------------------------KY
HIS8_VESOH      ----------------------------------------------------------------------
HIS8_RHOBA      ----------------------------------------------------------------------
HIS8_DESVV      ---------------------------------------------------------RTLKTKADLAFRY
HIS8_DESVH      ---------------------------------------------------------RTLKTKADLAFRY
ALA2_PANMI      --------------GQQPVTFFREVLALCDHPCLLEKE---ETKSLFSADAISRAKQILSTIPGRATGAY
AAT_RICPR       ----------------------------------------------------------------------
HIS8_XANCP      ----------------------------------------------------------------------
HIS8_STRAW      ----------------------------------------------------------------------
HIS8_RHORT      ----------------------------------------------------------------------
HIS8_HAHCH      ----------------------------------------------------------------------
HIS8_GEOUR      ----------------------------------------------------------------------
HIS8_GEOMG      ----------------------------------------------------------ILEELGPAALRI
HIS8_CLOB8      ---------------------------------------------------------------GDLKLYP
CBL_MYCLE       ----------------------------------------------------------------------
ALAT_YEAST      ----------------------RQVLAILEYPEILRVGHNLASLNLFSRDALERAE-RLLNDIGGSIGAY
KAT1_RAT        --------------------------------------------------------------------QY
KAT1_MOUSE      --------------------------------------------------------------------QY
HIS8_SILST      ----------------------------------------------------------------------
HIS8_LEUCK      -----------------------------------------------------------IRDVSDDVLGF
HIS8_DIAST      ----------------------------------------------------------------------
YFBQ_SHIFL      ----------------------------------------------------------------------
YFBQ_ECOLI      ----------------------------------------------------------------------
YFBQ_ECOL6      ----------------------------------------------------------------------
HIS8_PSE14      ----------------------------------------------------------------------
HIS8_CLOB6      -------------------------------------------------------------------LRL
HIS8_CAMFF      ----------------------------------------------------------------------
ALA2_HORVU      --------------GQQPVTFFREVLALCDHPDLLQRE---EIKTLFSADSISRAKQILAMIPGRATGAY
Y286_HAEIN      ----------------IRGPVHKEALRLEEEGNILKLNIGNPAP--FGFEAPDEILVDVLRNLPS-AQGY
HIS82_GLUOX     -----------------------------------------------------------IRDAASDDLRL
HIS81_ANASP     ---------------------------------------------------------------GECLRRY
ALAT1_MOUSE     --------------GQRPITFFRQVLALCVYPNLLS------SPD-FPEDAKRRAE-RILQACGGHSLAY
HIS8_GEOBB      ----------------------------------------------------------IAKEAGEGLRRY
HIS8_CHLCH      ----------------------------------------------------------------------
HIS8_ACISJ      ----------------------------------------------------------------------
DAPAT_LEPBL     ---------------------------------------------------------------------Y
DAPAT_LEPBJ     ---------------------------------------------------------------------Y
AAT_STRGR       ----------------------------------------------------------------------
AAT_MYCTU       ---------------------------------------------------------------------Y
AAT_MYCBO       ---------------------------------------------------------------------Y
HIS8_UNCMA      ----------------------------------------------------------------------
DAPAT_DESAP     --------------------------------------------------------------------QY
CBL_MYCTU       -------------------------------------------------------------DDGDTGYPY
CBL_MYCBO       -------------------------------------------------------------DDGDTGYPY
HIS8_RHOPB      ----------------------------------------------------------------------
HIS8_MYCS2      ----------------------------------------------------------------------
HIS8_MARMM      -------------------------------------------------------------------LHL
HIS8_CAMLR      ----------------------------------------------------------------------
DAPAT_METTH     ---------------------------------------------------------------------Y
HIS8_FRAP2      ----------------------------------------------------------------------
HIS8_ACIBT      ----------------------------------------------------------VLHEQADVLRLY
HIS8_ACIB5      ----------------------------------------------------------VLHEQAD-ALRL
HIS8_ACIB3      ----------------------------------------------------------VLHEQAD-ALRL
HIS82_ANASP     ----------------------------------------------------------------------
YBDL_ECOLI      ---------------------------------------------------------RLAHHVAQGANQY
MALY_ECOLI      ----------------------------------------------------------------------
HIS8_GEOSM      ----------------------------------------------------------IAKEAGEGLRRY
HIS8_ACIBY      ----------------------------------------------------------VLHEQADVLRLY
HIS8_ACIBC      ----------------------------------------------------------VLHEQADVLRLY
DAPAT_SYNS9     ---------------------------------------------------------------------Y
DAPAT_DESPS     ---------------------------------------------------------------------Y
BNA3_YEAST      --------------------------------------------------------------------QY
1A1C_SOYBN      ----------------------------------------------------------------------
HIS81_ARCFU     -------------------------------------------------------------------LHI
DAPAT_ARATH     ---------------------------------------------------------------------Y
CSD_CHLPN       ----------------------------------------------------------------------
1A17_ARATH      ----------------------------------------------------------------------
HIS8_SULTO      ----------------------------------------------------------------------
HIS8_COLP3      --------------------------------------------------------------------RY
DAPAT_PARUW     ---------------------------------------------------------------------Y
YDT4_SCHPO      --------------------------------------------------------------------QY
HIS8_MYCSM      ----------------------------------------------------------------------
HIS8_LACLA      -------------------------------------------------------------------LRL
ALAM_DICDI      ---------------------------------------------------------------------Y
1A11_ORYSJ      ----------------------------------------------------------------------
1A11_ORYSI      ----------------------------------------------------------------------
HIS8_ACIBS      ----------------------------------------------------------VLHEQAD-ALRL
HIS8_ACIAC      ----------------------------------------------------------------------
HIS82_BURPS     ----------------------------------------------------------------------
HIS82_BURP1     ----------------------------------------------------------------------
HIS82_ANAVT     ----------------------------------------------------------------------
HIS81_BURMA     ----------------------------------------------------------------------
DAPAT_DESAH     ---------------------------------------------------------------------Y
HIS8_CAMJR      -----------------------------------------------------------LRQNANKAHLY
HIS8_CAMJJ      -----------------------------------------------------------LRQNANKAHLY
HIS8_CAMJ8      -----------------------------------------------------------LRQNANKAHLY
1A1C_PHAAU      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SPTEGYAPLRAFVAEWIGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQGPRFL
Y104_SULSO      TATAGISEFRRELVNLSGIDERNVFVTVGSQEALFMIFNILLDPGDNVVVEAPTYLAALNAMRTRKPNFI
YISV_BACSU      EQPKGNRQLREAVADHIHVSPSAILIVSGALQALQLISIGLLKRDSVILTEKPSYLQSLHVFQSAGMRLR
AADAT_HUMAN     SPSAGIPELLSWLKQLIHYPPSQLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNII
YDCR_ECOLI      NLPPGNAELRQAIAQGITISPDEIVITAGALEALNLSLQAVTEPGDWVIVENPCFYGALQALERLRLKAL
AADAT_RAT       SSSYGIPELLSWLKQLVNYSPNELCITSGCQDGLCKVFEMLINPGDTVLVNEPLYSGALFAMKPLGCNFI
AATR2_DICDI     SPTPGLPRLQKALKD-LQIRPDELIISNGSQESLANAFEVLIDDNDSIITENPTYSGTLSILKPLSLNIC
YDFD_BACSU      EEPKGYLPLREALSNYLKTXXXXXXXXXXALQALQLISMGLLQRGSTVYLDQPSYLYSLHVFQSAGMKLT
AADAT_MOUSE     SPSYGIPELLSWLKQFVNYPPNQLCITSGCQDGLCKAFEMLINPGDTILVNEPLFPGTLYAMKPLGCNII
MOCR_RHIME      HWVTGHPRLKAAIAEYLGVEPEQVIVVNGTQAALDILARMLVDEGDICWMEEPGYIGAQNSLLSAGAKLV
AADAT_BOVIN     SQSAGIPELLSWLKQLIHYAPTQLCVTCGSQEGLCKVFEMIVNPGDNILVNEPIYSGTIHALQPLGCNMI
AATR3_SCHPO     GQCQGIPELVKFIKDHVGYKDWDIKITNGNTIGLEYCLRLLVNRGDCILIEKYTYPAAITAMRPLGVKFI
YJIR_ECOLI      DLLAGQRVLREQIARLMVVTADDIIITSGCHNSMSLALMAVCKPGDIVAVESPCYYGSMQMLRGMGVKVI
AATR1_SCHPO     GQGSGAALLSQFLKEHTRIPPYEIIMTTGNTSCLDIALRMLTNRGDSILVEKYSFPSALQSMRPLGLSCI
NORG_STAAC      NNGYGYIKLRDIIVEGINVGRENVMITSGALHAIQLLSIGFLGQDAIIISNTPSYIHSTNVFEQLNFRHI
NORG_STAA8      NNGYGYIKLRDIIVEGINVGRENVMITSGALHAIQLLSIGFLGQDAIIISNTPSYIHSTNVFEQLNFRHI
NORG_STAA3      NNGYGYIKLRDIIVEGINVGRENVMITSGALHAIQLLSIGFLGQDAIIISNTPSYIHSTNVFEQLNFRHI
NORG_STAAN      NNGYGYIKLRDIIVEGINVGRENVMITSGALHAIQLLSIGFLGQDAIIISNTPSYIHSTNVFEQLNFRHI
NORG_STAAM      NNGYGYIKLRDIIVEGINVGRENVMITSGALHAIQLLSIGFLGQDAIIISNTPSYIHSTNVFEQLNFRHI
AATR1_DICDI     SDSPGLPKLRNWCKEW------NLLMTPGSQHALDCLVKAFFNRGDTLIVERYTYGGMFAVTQPSGINFA
NORG_STAAB      NNGYGYIKLRDIIVEGINVGRENVMITSGALHAIQLLSIGFLGQDAIIISNTPSYIHSTNVFEQLNFRHI
AATR2_SCHPO     GQCQGISELVGFIKEHIAPRYEDIKMSNGNTSGLEYCLRLLVNYGDHVLTEKYTYPAAITAMRALGVQFV
YDEL_BACSU      ----GEFELRTLIAEYLGVHPEQVIIGAGNPILLQILCQVF-EPNISIGYEDPGYPRARKIFEANRMNIV
YCXD_BACSU      GTPKGLPSLKLLATQQVFADERHIFITSGVQQALSLLCAMPFPNGKEIAIEQPGYHLMVEQLETLGIPAI
YHDI_BACSU      DP-QGEYELRHMIARFVRLEPGQIIIGAGTTVLLQNLC-LSLKPGTKIGFEEPGFHRSRRMFEANHMDVT
GABR_BACSU      SHPQGIYEVRAAITRLISLRPEQMIIGAGTQVLMQLLTEL-LPKEAVYAMEEPGYRRMYQLLKNAGKQVK
ARO9_YEAST      AETKGLPPLLHFVKDFVSRRPADVILSGGSNDSMFKVFETICDESTTVMIEEFTFTPAMSNVEATGAKVL
DAPAT_DESDG     PSYTGMLAFRQEVANWYKRRKTEVLTLIGSKEGIAHFPTAFVNPGDLVLVCPPCYPVYAIASRFMGGVVQ
DAPAT_CARHZ     PSSVGMLSYRQAVAAWYARRKTEVVSLLGSKEGIAHISWCYVDPGDLVLVPDPGYPVYEGGTILAGGTTY
AAT_AQUAE       APSAGIPELREAIAEKVEYKPSEIVVSAGAKMVLFLIFMAILDEGDEVLLPSPYWVTYPEQIRFFGGVPV
HIS8_ERWCT      -------------AEYAGVTPEQVLVSRGADEGIELLIRAFCEPGKDAILFCPPTYGAVSAETFGVERRT
ARO8_YEAST      GFSAGQPELLNFIRDHTKIKDWDVLATAGNTNAWESTLRVFCNRGDVILVEAHSFSSSLASAEAQGVITF
DAPAT_DEHE1     PETEGLPVLRKAMAEWVKLNPDEVLPLIGSKEGIGHAAWCFLDPGDVALVPDPAYPVYAISSQLAGAEVF
AAT_THEAQ       APPAGIPELREAVAEGLEVTPEETIVTVGGKQALFNLFQAILDPGDEVIVLAPYWVSYPEMVRFAGGVPV
AAT_PYRHO       TPNAGIPELREAVVEYIDIEVENVIITAGAYEGTYLAFESLLERGDEVIIPDPAFVSYAEDAKVAEAKPV
AAT_SULSO       TSAFGIDELREKIAQYLNVKKEEVIVTPGAKPALFLVFILYINPSDEVILPDPSFYSYAEVVKLLGPIYA
AAT_THEMA       TDPRGIYELREGIAKRIGERPDQVVVTNGAKQALFNAFMALLDPGDEVIVFSPVWVSYIPQIILAGGTVN
AAT_PYRAB       GPNIGLPELREAIAEKLKKQNKEIMVLVGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPV
HIS8_PECCP      -------------AEYAGVQPEQVLVSRGADEGIELLIRAFCEPGKDAILFCPPTYGAVSAETFGVERRT
AAT_THET8       APPAGIPELREALAEGLSVTPEETIVTVGGKQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVV
AAT1_BACSU      TPSGGLAELKNSIAEKIEYKPSQIIVCTGAKHALYTLFQVILDEEDEVIIPTPYWVSYPEQVKLAGGKPV
HIS8_CHLTE      ----------AAYASFLGVKPELVIMSNGSNEMLYTIFMACLGAGRKVLIPEPSFSLYDKLARLQQAGVV
HIS8_BLOPB      -------------AYYAGVRSDQILVSRGADESIELLMKVFCNPGKDVIIFCPPTYGMYKTAEILGINYR
HIS8_BACHD      ---DGYATLRDKVAHYVGVAPEELIFGNGSDEVIQILCRAFLNEQTNTVMAEPTFSQYKLNAVIEGAELR
HIS8_ANADF      --------LRNAIAAKLGVPPEEVMVGNGSNELIELLVRTFVLDGEEVLTSAQSFVAYKLAAHEHGRTLV
DAPAT_DEHSB     PETEGLPVLRKAMAEWVKLNPDEVLPLIGSKEGIGHAAWCFLDPGDIALVPNPAYPVYAISSQLAGAEVF
DAPAT_DESVH     PSYVGMLAFRQEVANWYDRRATEVIGLIGSKEGIAHFPFAFINPGDLVLVCTPNYPVYHIATGFAGGEVQ
YEY2_YEAST      ----------------------------------------------------------------------
HIS8_HALWD      -PKSSHTDLTARIADYWGLSPEQIWLSPGADGAIDYLSRAFLTPGDTMLISDPGFSYYPMSARYHHGSIR
DAPAT_DEHSC     PETEGLPVLRKAMAEWVKLNPDEVLPLIGSKEGIGHAAWCFLDPGDIALVPNPAYPVYAISSQLAGAEVF
HIS82_NITMU     PDGSGFE-LKAALSERYGVTSDQIVLGNGSNDVLELAARVFLKPGASTVYSQHAFAVYPLVTKAVGGIGI
DAPAT_DESVV     PSYVGMLAFRQEVANWYDRRATEVIGLIGSKEGIAHFPFAFINPGDLVLVCTPNYPVYHIATGFAGGEVQ
HIS8_WOLSU      -PDDSMFELKEGLAGRFGVKSENVIIGSGSDQILEMAVHAKCNASSKVLMSKTTFAMYDVYSRQVGARIL
HIS81_MANSM     PDSNGFS-LKAAIAEKFNLQPEQITLGNGSNDLIELIAHTFATEGDEIIFSQYAFIVYPLITKAINAKAR
HIS8_THEGJ      YPHITSMPAREAIADFYGVSPDNVAVGNGSDELLSYLVRLF--EGNHIVITPPTFGMYSFYAKLNGVPVV
HIS81_RALEJ     PDSNGFE-LKAALSTKLGVPQDWLTLGNGSNDILELAAHALVTPGQSIVYAEYSFAVYALATQEIGARAI
YFDZ_ECOLI      STSRGIPRLRRAISRWVEIDPEEAIVTIGSKEGLAHLMLATLDHGDTVLVPNPSYPIHIYGAVIAGAQVR
HIS8_PSEST      PDGSGFR-LKAKLAERFGLKSEQITLGNGSNDIIDLVARC-CGAGPNAVFSAHAFAAYPLCTQAAGAESR
AAT_STRVG       TPAGGLPELKAAIASGYEVEASQVLVTNGGKQAIYEAFAAILDPGDEVIVPAPYWTTYPESIRLAGGVPV
HIS8_MOOTA      --------LKEALAAKLGVKQENLIIGNGTDEILKMLAETYINPGDEIVVADPTFSEYEFAAQVMGGRAI
YDEF_BACSU      ---------------------DHILFANGGQNAIAATLASLCKPGDRIGVDHHTYPGLKTVASLLSVQIV
HIS8_SULNB      -PDDSMFELKEALSRKFDVEDENIIIGAGSDQVLEFISRALLNEASSVLMSAVTFAMYEIYAKQMGAKII
DAPAT_SYNFM     PSYSGMNDFKVSVAGWFGVELDEVLTLIGSKEGLAHFPLAVINPGDLALVPTPAYPVYHVATMFAGGESY
DAPAT_HALOH     PSYEGMYEYRKTVADWYKNNDKEVVSLIGSKEGIAHLPFCYINPGDIALVPDPGYPVYKTSVLLAGGKPV
HIS8_BREBN      --------LRWDLADFLGVKPSQLFFGNGSDEILLMISRAFLSEGTNAVMATQTFSQYRSNGIIEGADLI
AAT_BACST       TPSGGLPALKEEIIQGLDYEPAEVIVCVGAKHALYTLFQVLLDEGDEVIIPTPYWVSYPEQVKLAGGVPV
HIS8_THETN      --------LREELARYCSVTPKNIFVGNGSDEIIHLIMLAFVDKGDTVLYPHPSFAMYSIYSKIAGANEI
HIS82_RALSO     PDANGFS-LKAALHAKFGVPEAWITLGNGSNDILELAARALVAPGQGVIYAQHAFAVYALAAQEVGARAV
DAPAT_DESAD     PSYVGLLTFRQAVADWYKERTKEVVSLIGSKEGIAHFPLAFVNPGDLVLVASPNYPVYPVASGFAGGEVE
HIS8_VIBCH      SDCQPKAMIQAY-ANYAGVQPEQVLTSRGADEGIELLIRAFCEPNQDVILFCPPTYGAISAETFGVERKK
HIS8_THEP3      --------LKEELARYCGVVPTNIFVGNGSDEIIHLIMLAFINKGDVVAYPHPSFAMYSVYSKIAGAVEI
HIS8_SYMTH      --------LRERLAQMWNLPADWFLIGNGSDEVFRLLAEVYLEPGDRVVVPEPSFAAYRFVAELMGAEVV
DAPT2_ANAVT     PPYEGTQEFREAAVKWVDLNPNEVVSSIGSKEAIHNTFLAFVEAGDYTLIPDPGYPVYRTSTIFAGGEPF
AAT_SULTO       TSAYGIDELRQKIAEHLSVRKEEVIVTPGAKTALYLAFLLYINPGDEVIIFDPSFYSYAEVVKMLGPVYV
HIS8_SALPK      -------------AQYAGVKPEQVLVSRGADEGIELVIRAFCEPGKDAILYCPPTYGMYSSAETIGVERR
HIS8_SALPA      -------------AQYAGVKPEQVLVSRGADEGIELVIRAFCEPGKDAILYCPPTYGMYSSAETIGVERR
HIS8_SALDC      -------------AQYAGVKPEQVLVSRGADEGIELVIRAFCEPGKDAILYCPPTYGSVSAETL-GVERR
AATC_RHIME      ----------------VKLNPEQVVATLGSKEGFANMAQAITAPGDVVLCPNPTYPIHAFGFLMAGGVIR
AAT_BACY2       TPSGGLPALKQAIIEQLEYKPNEIIVGVGAKHVLYTLFQVILNEGDEVIIPIPYWVSYPEQVKLAGGVPV
HIS8_VIBPA      SECQPKALISAYAA-YAGVKPEQTLTSRGADEGIELLVRAFCEPGQDAILYCPPTYGAISAETI-GVERK
HIS8_THEPX      --------LKEELARYCGVVPTNIFVGNGSDEIIHLIMLAFINKGDVVAYPHPSFAMYSVYSKIAGAVEI
HIS8_SALTY      -------------AQYAGVKPEQVLVSRGADEGIELVIRAFCEPGKDAILYCPPTYGMYSSAETIGVERR
HIS8_SALTI      -------------AQYAGVKPEQVLVSRGADEGIELVIRAFCEPGKDAILYCPPTYGMYSSAETIGVERR
HIS8_SALSV      -------------AQYAGVKPEQVLVSRGADEGIELVIRAFCEPGKDAILYCPPTYGMYSSAETIGVERR
HIS8_SALPC      -------------AQYAGVKPEQVLVSRGADEGIELVIRAFCEPGKDAILYCPPTYGMYSSAETIGVERR
HIS8_SALPB      -------------AQYAGVKPEQVLVSRGADEGIELVIRAFCEPGKDAILYCPPTYGMYSSAETIGVERR
HIS8_SALNS      -------------AQYAGVKPEQVLVSRGADEGIELVIRAFCEPGKDAILYCPPTYGMYSSAETIGVERR
HIS8_SALHS      -------------AQYAGVKPEQVLVSRGADEGIELVIRAFCEPGKDAILYCPPTYGMYSSAETIGVERR
HIS8_SALG2      -------------AQYAGVKPEQVLVSRGADEGIELVIRAFCEPGKDAILYCPPTYGMYSSAETIGVERR
HIS8_SALEP      -------------AQYAGVKPEQVLVSRGADEGIELVIRAFCEPGKDAILYCPPTYGMYSSAETIGVERR
HIS8_SALA4      -------------AQYAGVKPEQVLVSRGADEGIELVIRAFCEPGKDAILYCPPTYGMYSSAETIGVERR
HIS81_NITOC     PDGNGFA-LKTALSQCLGIPANQITLGNGSSDLLEFAARVLISPEHEVIYSQYCFALYPLLIQILGAKGH
DAPT2_ANASP     PPYEGTQEFREAAVEWMERRNTEVVSSIGSKEAIHNTFLAFVEAGDYTLIPDPGYPVYRTSTIFAGGEAF
HIS8_VIBCM      SDCQPKAMIQAY-ANYAGVQPEQVLTSRGADEGIELLIRAFCEPNQDAILFCPPTYGAISAETFGVERKK
HIS8_VIBC3      SDCQPKAMIQAY-ANYAGVQPEQVLTSRGADEGIELLIRAFCEPNQDAILFCPPTYGAISAETFGVERKK
HIS8_PYRKO      -------PAREAIGEFYGLPAENVAVGKGGDELIGYLVRLF--EGDYIVTTPPTFGMYSFYARLNGIPVI
HIS8_DESHY      YPDGGAQELKEALSRYTGVPAEGILTGNGSDELIQLLMTTFGGEKGAVVIHPPTFSMYEAAARVTGTGVL
DAPAT_AQUAE     PSYVGKYEFRKAVADWYKRRFDEVITLIGSKEGIAHFPLAFVNPGDIVLCPDPAYIGAIFA----GGTPY
Y1527_METMP     ----------------------EVVHSIGSKPALAYITSVFINPGDVTLMTVPGYPVTATHTKWYGGSVE
PATA_BACSU      TPNAGYLELRQAVQLYMKKKADEIIITTGASQAIDAAFRTILSPGDEVXXXXXXXXXXXXXXNLCGAKPV
HIS81_DECAR     --------LIAKVAERCGVSSNQIVLGNGSNDVLDLIARVFLAPGRSAVFAQHAFAVYPLATLSTGAELI
HIS8_SODGM      -------------AAYAGVQPEQVVVCRGADEGIELLIRAFCEPGADAILFCPPTYGMYSSAETFGIARR
HIS8_SALCH      -------------AQYAGVKPEQVLVSRGADEGIELMIRAFCEPGKDAILYCPPTYGMYSSAETIGVERR
HIS8_ANOFW      --PDGYSTLREALAAHIGISEKQLIFGNGSDEVVQIICRAFLQKGTNTVMATPTFPQYRHNAIIEGAEVR
HIS82_THICR     --------LKQDLADFLQKQPTEIALGNGSNELLELVARIFAGKGDEIIYS--QYAFAVYSISTQGATGI
HIS82_HAEIN     PDANGFE-LKQTIAKKFGVQPNQITLGNGSNDLLELFAHTFATEGDEIMYSQYAFIVYPLVTKAINAIVK
HIS8_ENTS8      -------------AQYAGVKPEQVLVSRGADEGIELLIRAFCEPGRDAVLYCPPTYGMYSSAETSGVECR
HIS8_CLONN      YPDPDATKLKKAYGDYIGIDEKNIMVGNGSDELIQILTNAFLDKNEKIVTLNPDFSMYEVYTKVRGGKVS
HIS82_ARCFU     -PKADYARLKKALAEYTGFEVENIAVGCGASELISCICNVLLEELDRVVIPMPSYT-LYSIYAMLRSASI
DAPAT_GLOVI     PPYKGTKAYREXXXXWFGFHPDEVISSIGSKEAIHNTFLAFVDPGDYTLIPDPAYPVYRTSTIFAGGEFF
HIS8_PHOLL      -------------AAYAGLQPEQVLACRGADESIELLIRVFCEPGQDVVLFCPMYSVSAETFGVEQKKIT
PATR_MYCA9      -PDNGYAELRSHLAKHVDMPPEHIAVGCGSVSLCQQLVQITATVGDEVLFGWRSFETYPLVVRVAGATPV
HIS8_PROA2      PDILPFRGMKAY-ADFLGIAPESVMMSNGSNEMLYTIFLACLSKGRKVVIPEPSFSLYEKLAVLLQADIV
HIS82_HAEI8     PDANGFE-LKQTIAKKFGVQPNQITLGNGSNDLLELFAHTFATEGDEIIYSQYAFIVYPLVTKAINAIAK
AAT1_METJA      SPNNGIPELREEISNKLDVDKDNIIVTCGASEALMLSIMTLIDRGDEVLIPNPSFVSYFSLTEFAEGKIK
HIS8_ECO45      -------------AQYAGVKPEQVLVSRGADEGIELLIRAFCEPGKDAILYCPPTYGMYSSAETIGVECR
HIS8_CLOCE      YPDTDSVQLRQALGEYWSVDKENIIVGTGSDQLIQIIANVFLEKGDKVLYPTPSFGMYKDSCVIAGGRAV
HIS81_THIDA     PDGAGYA-LKAKLSARLGVDAAQIVLGNGSNDVLDMVARAYLAPGTSAVYAQYAFAVYPIATHTVGAHGI
Y1391_METJA     ----------------------EVIHSIGSKPALAYITSAFINPGDVCLMTVPGYPVTATHTKWYGGEVY
PATR_MYCVP      YPDNGYVELRERLAKHVNFAPEYISVGCGSVSLCQQLIQITSTVGDEVLFGWRSFEIYPLQVRTAGATPV
PATR_MYCPA      YPDNACVDLKAALAMHLGVAPEQIAVGSGSVTLCQQLVQITSAAGDEVMMGWRSFECYLPIVQVAGAIAV
HIS8_XYLFA      --------LRQMLAALYGCVPEQLLIGRGSDEGIDLLVRAVCEPGDPVLVTPPVFMYAVSA-QLQNAPVI
HIS8_SHIFL      -------------AQYAGVKPEQVLVSRGADEGIELLIRAFCEPGKDAILYCPPTYGMYSSAETIGVECR
HIS8_SHIF8      -------------AQYAGVKPEQVLVSRGADEGIELLIRAFCEPGKDAILYCPPTYGMYSSAETIGVECR
HIS8_SHIDS      -------------AQYAGVKPEQVLVSCGADEGIELLIRAFCEPGKDAILYCPPTYGMYSSAETIGVECR
HIS8_ECOK1      -------------AQYAGVKPEQVLVSRGADEGIELLIRAFCEQGKDAILYCPPTYGMYSSAETIGVECR
HIS8_ECO81      -------------AQYAGVKPEQVLVSRGADEGIELLIRAFCEPGKDAILYCPPTYGMYSSAETIGVECR
HIS8_ECO5E      -------------AQYAGVKPEQVLVSRGADEGIELLIRAFCEPGKDAILYCPPTYGMYSSAETIGVECR
HIS8_ECO57      -------------AQYAGVKPEQVLVSRGADEGIELLIRAFCEPGKDAILYCPPTYGMYSSAETIGVECR
HIS8_ECO55      -------------AQYAGVKPEQVLVSRGADEGIELLIRAFCEPGKDAILYCPPTYGMYSSAETIGVECR
HIS82_BORPA     YPAAANPALQAQVRQAFEVPAQALLFGNGSDELIHLIIQACCEPGDTVLSPWPSFVYFDMAARLSHARFV
HIS82_BORBR     YPAAANPALQAQVRQAFEVPAQALLFGNGSDELIHLIIQACCEPGDTVLSPWPSFVYFDMAARLSHARFV
PATR_MYCA1      YPDNACVDLKAALAMHLGVAPEQIAVGSGSVTLCQQLVQITSAAGDEVMMGWRSFECYLPIVQVAGAIAV
HIS8_XYLFT      --------LRQMLAALYGCLPEQVLIGRGSDEGIDLLVRAVCERRDPVLVTPPVFMYAVSA-QLQNAPLI
HIS8_XYLFM      --------LRQMLAALYGCLPEQVLIGRGSDEGIDLLVRAVCERRDPVLVTPPVFMYAVSA-QLQNAPLI
HIS8_XYLF2      --------LRQMLAALYGCLPEQVLIGRGSDEGIDLLVRAVCERRDPVLVTPPVFMYAVSA-QLQNAPLI
HIS8_SHIBS      -------------AQYAGVKPEQVLVSRGADEGIELLIRAFCEPGKDAILYCPPTYGGVSAETI-GVECR
HIS8_PELLD      -----YRGIEAY-AEFLGVPAGRVIMGNGSNELLYTIFMACLGPGRRILIPEPSFSLYEKIALLMQADIV
HIS8_METFL      --------LRDCVCRKFKLQPDQLVFGNGSNDILELAARAFLTPGTEAVYAQHAFAVYALVTQATGASGI
HIS82_METCA     --------LKAALAEKLGVEPAQIVLGNGSNDVLDLVARAFLTAGRNAVYS--EYAFAVYPIXXXXXXXX
PATR_MYCSS      YPDNGYLELREHLASHLAFTPEQIAVGCGSVSLCQQLIQITSSVGDEVIFAWRSFEIYPLQVRTAGATPV
PATR_MYCSK      YPDNGYLELREHLASHLAFTPEQIAVGCGSVSLCQQLIQITSSVGDEVIFAWRSFEIYPLQVRTAGATPV
PATR_MYCSJ      YPDNGYLELREHLASHLAFTPEQIAVGCGSVSLCQQLIQITSSVGDEVIFAWRSFEIYPLQVRTAGATPV
HIS8_YERPY      -------------AAYAGLPPEQVLVSRGADEGIELLIRAFCEPGQDAILFCPPTYGAVSA-ETFGVERR
HIS8_YERPP      -------------AAYAGLPPEQVLVSRGADEGIELLIRAFCEPGQDAILFCPPTYGAVSA-ETFGVERR
HIS8_YERPN      -------------AAYAGLPPEQVLVSRGADEGIELLIRAFCEPGQDAILFCPPTYGAVSA-ETFGVERR
HIS8_YERPG      -------------AAYAGLPPEQVLVSRGADEGIELLIRAFCEPGQDAILFCPPTYGAVSA-ETFGVERR
HIS8_YERPE      -------------AAYAGLPPEQVLVSRGADEGIELLIRAFCEPGQDAILFCPPTYGAVSA-ETFGVERR
HIS8_YERPA      -------------AAYAGLPPEQVLVSRGADEGIELLIRAFCEPGQDAILFCPPTYGAVSA-ETFGVERR
HIS8_YERP3      -------------AAYAGLPPEQVLVSRGADEGIELLIRAFCEPGQDAILFCPPTYGAVSA-ETFGVERR
HIS8_SALAR      -------------AQYAGVKPEQVLVSRGADEGIELMIRAFCEPGKDAILYCPPTYGMYSSAETIGVARR
HIS8_LEPIN      YPDDSYLDLKTAIASKFDLTTDRIIPGNGSDQVLDFVCRCVLDQGDSVLINRITF-AMYKIYALQGAKIH
HIS8_LEPIC      YPDDSYLDLKTAIASKFDLTTDRIIPGNGSDQVLDFVCRCVLDQGDSVLINRITF-AMYKIYALQGAKIH
HIS8_KLEP3      -------------ARYADVKPEQVLVSRGADEGIELLIRAFCEPGKDALLYCPPTYGMYSSAETIGVECR
HIS8_BLOFL      -------------AAYSGVQSDHILVSRGADESIELLMKVFCRPNKDFIIFCPPTYGMYKTAEILEIYYR
HIS8_RHISN      -PEDDNISLREAAAASYDLSADQVIAGNGSSELLSLIYKAFLGPGDSVAMLSPGFAYNRKLAQLQGARLL
HIS8_PSEE4      YPDPNSDRLKQAVAEYYGVTPAQVFVGNGSDEVLHIFHGLFQHDRGPLLFPDVSYSFYPVYCGLYGIAFE
HIS8_ESCF3      -------------AQYAGVKPEQVLVSRGADEGIELLIRAFCEPGKDAILYCPPTYGMYSSAETIGVECR
HIS8_ECOUT      -------------AQYAGVKPEQVLVSRGADEGIELLIRAFCEPGKDAILYCPPTYGMYSSAETIGVECR
HIS8_ECOSE      -------------AQYAGVKPEQVLVSRGADEGIELLIRAFCEPGKDAILYCPPTYGMYSSAETIGVECR
HIS8_ECOLI      -------------AQYAGVKPEQVLVSRGADEGIELLIRAFCEPGKDAILYCPPTYGMYSSAETIGVECR
HIS8_ECOLC      -------------AQYAGVKPEQVLVSRGADEGIELLIRAFCEPGKDAILYCPPTYGMYSSAETIGVECR
HIS8_ECOL6      -------------AQYAGVKPEQVLVSRGADEGIELLIRAFCEPGKDAILYCPPTYGMYSSAETIGVECR
HIS8_ECOL5      -------------AQYAGVKPEQVLVSRGADEGIELLIRAFCEPGKDAILYCPPTYGMYSSAETIGVECR
HIS8_ECOHS      -------------AQYAGVKPEQVLVSRGADEGIELLIRAFCEPGKDAILYCPPTYGMYSSAETIGVECR
HIS8_ECODH      -------------AQYAGVKPEQVLVSRGADEGIELLIRAFCEPGKDAILYCPPTYGMYSSAETIGVECR
HIS8_ECOBW      -------------AQYAGVKPEQVLVSRGADEGIELLIRAFCEPGKDAILYCPPTYGMYSSAETIGVECR
HIS8_ECO8A      -------------AQYAGVKPEQVLVSRGADEGIELLIRAFCEPGKDAILYCPPTYGMYSSAETIGVECR
HIS8_ECO27      -------------AQYAGVKPEQVLVSRGADEGIELLIRAFCEPGKDAILYCPPTYGMYSSAETIGVECR
HIS8_ECO24      -------------AQYAGVKPEQVLVSRGADEGIELLIRAFCEPGKDAILYCPPTYGMYSSAETIGVECR
HIS8_CHLL2      -------------ADFLGVSRDSVIMSNGSNEMLYTIFLACLSPGKKILIPEPSFSLYEKIALLLQADIV
HIS8_ARATH      --------LRDALAQDSGLESEYILVGCGADELIDLIMRCVLDPGEKIIDCPPTFSMYVFDAAVNGAGVI
HIS82_NITEU     --------LKAALSERLGMPADQIVLGNGSNDVLELATRIFLHPDSTAIYS--QYAFAIYPLLAQGARGI
HIS82_MANSM     PEPQPEAVIKGYAA-YADVKPENVIVTRGGDESIELLIKGFCEPEDKVLYCPPTYMYAVSAETL-GIATK
PDXR_CORGL      SPEQGLLRLRIEIADHLRVEPEQIIVTAGAREGLSLLLRT-MDAPARIGVESPGYPSLRRIPQVLGHETI
HIS8_LYSSC      ---DGYAQLRTAVANHLGVQETQLLFGNGSDDIIAIITRALLYPGVNTIMADLSFSQYWHNAEIEGAEIR
HIS8_AERHH      -------------AAYAGVNPDQVLVSRGADEAIELLIRTFCEAGDQILICPPTYMYAISA-ETCGVGIV
Y3073_RHOS4     QESTGAPADRTAAASWLGASADRIVVTSGXXXXXXXXXXXXXGRGDVVAAGAVTYPGLKAVAAQQHLELA
HIS8_YERPS      -------------AAYAGLPPEQVLVSRGADEGIELLIRAFCEPGQDAILFCPPTYGAVSA-ETFGVERR
HIS8_YERPB      -------------AAYAGLPPEQVLVSRGADEGIELLIRAFCEPGQDAILFCPPTYGAVSA-ETFGVERR
HIS8_VIBFM      SECQPPELINAYAA-YAEVKPEQVLTSRGADEGIELLVRAFCEPNQDAILYCPPTYGSISAETI-GVETK
HIS8_SHISS      -------------AQYAGVKPEQVLVSRGADEGIELLIRAFCEPGKDAILYCPPTYGMYSSAETIGVECR
HIS8_YERE8      -------------AAYAGLATDQVLVSRGADEGIELLIRAFCEPAQDAILFCPPTYGAVSAETF-GVELR
HIS8_PSEPK      --------LKQAVAEYYGVTPAQVFVGNGSDEVLAHIFHGLFQHDAPLLFPDISYSFYPVYCGLYGIAFE
HIS8_KLEP7      -------------ARYAEVKPEQVLVSRGADEGIELLIRAFCEPGEDAVLYCPPTYGMYSSAETIGVECR
HIS8_CITK8      -------------AQYAGVNPGQVLVSRGADEGIELLIRAFCEPGKEAILYCPPTYGMYSSSETIGVECR
HIS8_VIBHB      SECQPKELISAYAA-YAGVKPEQTLTSRGADEGIELLIRAFCEPGEDAILYCPPTYGGISAETI-GVERK
HIS8_PYRFU      -------PLREALAEFYGLKKENIAVGNGSDELINYLVKMF--KGKYIVVTSPTF-GMYSFFKLHGIPVK
HIS8_PSEPW      --------LKQAVAEYYGVTTGQVFVGNGSDEVLAHIFHGLFQHGGPLLFPDISYSFYPVYCGLYGIPFE
HIS82_PASMU     PDSNGFY-FKQTVAKKFGLSPEQITLGNGSNDLLELVAHTFANEQDEILFSQYAFIVYPLVTQAINAKKV
HIS82_BORPE     YPAAANPALQAQVRQAFEVPAQALLFGNGSDELIHLIIQACCEPGDTVLSPWPSFVYFDMAARLSHARFV
PATR_MYCS2      -PDNGYLDLRERLAKHVNFAPENISVGCGSVSLCQQLIQITSSVGDEVLFAWRSFEIYPLQVRTAGATPV
HIS8_ECO7I      -------------AQYAGIKPEQVLVSRGADEGIELLIRAFCEPGKDAILYCPPTYGMYSSAETIGVECR
HIS8_BACLD      ---DGYAALRTKLASHLGVNETNIILGNGTDEVIQIISRSLLDPASNTVMANPTFSQYKHNAVIEGAEVR
HIS81_IDILO     PDANGYY-LKSRLAELNEVGTQQITLGNGSNDVLEILARTFVSDKDEVIFSQHAFVVYPLVTQAIGAKPV
HIS8_VIBF1      SECQPPELINAYAA-YAKVKPEQVLTSRGADEGIELLVRAFCEPNQDAILYCPPTYGSISAETI-GVETK
HIS8_SHIB3      -------------AQYAGVKPEQVLVSRGADEGIELLIRAFCEPGKDSILYCPPTYGMYSSAETIGVECR
HIS8_SERP5      -------------AEYAGVKKEQVLVSRGADEGIELLIRAFCEPGKDAILFCPPTYGAVSA-ETFGVERR
HIS8_PSEP1      --------LKQAVAEYYGVTPAQVFVGNGSDEVLAHIFHGLFQHDAPLLFPDISYSFYPVYCGLYGIAFE
HIS8_PELPB      -------------ADFLGISPDSVMMSNGSNEMLYTIFLACLGPGRKVLIPDPSFSLYEKIALLLQSQIV
HIS8_NITSB      -PDDSMFELKSALAKRFEIDQKNIIIGAGSDQVLEFCARAVLNEKSSVLMSKITFMYEIYALQ-QGAKII
HIS8_METTH      -PESALTDLREAIADYAGVGMDQVIVGDGADEIIDVLGRTFLEPGESFVVPMPSYM--YYEYTLQAHDAR
HIS8_ECOLU      -------------AQYAGVKPEQVLVSRGADEGIELLIRAFCEPGKDAILYYPPTYGMYSSAETIGVECR
HIS8_CHLP8      ----------ATYASFLGVPAESVIMSNGSNEMLYTIFMACVGAGRKVLIPEPSFLYDKLAVLLQG-EIV
HIS8_CALS8      ------------------VKPTQIIFGAGSDEITQLIASIFINPGDNSIMARPSFPRYETVTKVMGGIPI
PATR_RHOSR      -PDNGHVALIAALADHLGVATENIAAGCGSVSLCQELVQATCNDGDEVIFAWRSFEAYPVVTQVAGATPV
HIS8_TOBAC      --------LRAALAEDSGLESEYILAGCGADELIDLIMRCVLDPGDMIVDCPPTFTMYEFDAAVNGAHVI
HIS8_PSEPG      --------LKQAVAEYYGVTPAQVFVGNGSDEVLAHIFHGLFQHDAPLLFPDISYSFYPVYCGLYGIAFE
HIS8_ENT38      -------------AQYAGVKPEQVLVSRGADEGIELLIRAFCEPGKDAVLYCQMYSVSAETFGVECRNVL
HIS81_PASMU     -------------ANYVGVTPENVLVSRGGDESIELIIRAFCEAEDSILYCPPTYMYAVSA-ETCGIALK
AAT_SULAC       TSAYGIDELRAKIASFLSISSKEVIITPGAKVSLYLAFLLYVNPGDEVIIFDPSYYSYPEVVKMLGPVYV
HIS8_NICPL      --------LRAALAEDSGLESEYILAGCGADELIDLIMRCVLDPGDMIVDCPPTFTMYEFDAAVNGAHVI
HIS8_METPP      YPGTRTDELRAALARHAGLPPGALMLGNGSDELISLLSMACDVPGATVLAPLPGFVMYEMSARLQGLRFV
HIS8_LEPBL      YPDDSYLELKTALASKFDLTPDRIILGNGSDQVLDFACRCVLGPGDSILINRITFMYRIYALQCGAKVHS
HIS8_LEPBJ      YPDDSYLELKTALASKFDLTPDRIILGNGSDQVLDFACRCVLGPGDSILINRITFMYRIYALQCGAKVHS
HIS81_BACC1     ALPDGYAELRTKVAEHLGVKAEQLLFGSGLDEVIQMISRALLHEGTNVVMANPTFSQYHHHAVIEGAKVR
HIS8_ROSCS      -PDPDHTRLRAALSRYVGQPPERIICGAGSDELIDLIMRAVLRPGDVMVDCPPTFAMYSFDAALYGARIV
HIS8_NOVAD      --------LRAAIGEVHGIDPSRIVMGTGSDELLNLAAQAYAGPGDEVLYVRYGFSVYDIAARRCGAVPV
HIS8_ECOSM      -------------AQYAGVKAEQVLVSRGADEGIELLIRAFCEPGKDAILYCPPTYGMYSSAETIGVECR
PATR_STRCO      NPDMACTSLMAELSDRFGVPLAHLATGTGSVGVAQQLIQATSGPGDEVIYAWRSFEAYPIITQISGARSV
HIS8_DESPS      ------------IAKYAGVGMSEIILGNGSNEVIEFLVKAFVQDDSEVITSHPSFLMYQKFVQVRGGVNR
HIS8_VIBVY      -----------------GVKPEQTLTSRGADEGIELLIRAFCEPNEDAILYCPPTYGMYSSAETIGVERK
HIS8_VIBVU      -----------------GVKPEQTLTSRGADEGIELLIRAFCETNEDAILYCPPTYGMYSSAETIGVERK
HIS8_LACPL      --------LRQAVAQQQGIDPNSIVFSVGLDEMIVMLSRTFLATNDQVLVSAPTFSEYGLHAEIEGGQLI
HIS8_STRMK      --------LREGLAALYGVTPQQLLIGRGSDEAIDLLVRALCVPGRDGVLVTPPVFGMYACARLQGAALI
HIS8_PROVI      RGTKAYA-------DFLGVPAEGVMMGNGSNELLYTIFLACLGPGRKILVPDPSFSLYEKLALLLQASLV
HIS8_HALLT      -PKSSHTDLTAKLAEKWDVSTEQVWVSPGADGSIDYLSRAALEPGDEVLVPEPGFAYYAMSARYHHGEVS
HIS8_SULDN      SPDDSMISLKNALSKRYNVDSENVIIGSGSDQVIEFLIHAKAHSGSKILMNSITFAMYEIYSKHVGADVI
DAPAT_MOOTA     PTSEGLLAFRQAVADWVDLDPREVVTLIGSKEGIAHISLCYVDPGDINLVPDPGYPVYNIGTLLAGGESY
HIS8_METST      -PESNHEYIKEQIAKYANVTKDQVIIGDGADELFEVLAKTVIDEGDEFIVHQPTYTYYEYTFKQSNAKAV
HIS8_GEOKA      --------LREKVAKHLGVKETQLLFGNGSDEVVQILCRAFLEPGANTVMAAPTFPQYRHNAIIERAEVR
HIS8_AZOSE      YPDPHADRLKAAIATRFGVEPREVFVGNGSDEVLAHAFMALLKHERPLRFPDISYSFYPVYCGLYGIAFE
HIS81_PSEF5     --------LKQAVASYYGVQGNQVFLGNGSDEVLAHIFHGLLQQEKPLLFPDISYSFYPVYCGLYGIEHE
HIS8_LISIN      YPDGWASSLRKEVADFYQLEEEELIFTAGVDELIELLTRVLLDTTTNTVMATPTFVQYRQNALIEGAEVR
HIS81_LEGPL     YPNIGLQELQKQLAKRYQINSDQIILTRGSDDGIDLTTRLFLTAGKDAFMQFPPTF-PMYAFRLQQAELI
HIS8_ACEPA      YPDPEALALRKALGARIGLGPEYVFVGNGSDEVLAHAFQAFFAHGEPLLFPDVTYSFYKVYCGLYSLPFR
AAT_PYRKO       TSTGGIRELRERIAEFEGVSADEVIVAPGAK----ILIAAEIASAKKVAVVSPRW----NAYSLIARQFW
HIS8_XANCB      --------LRAALAQLYGCAPEQLLIGRGSDEAIDLVRGLCVPERDAVVVTPPVFGMYAVCARLQNAPLV
HIS8_GEOSW      ---DGYARLREKVATHLGVNETQLIFGNGSDEVVQIICRAFLSPNTNTVMAAPTFPQYRHNAVIEGAEIR
HIS8_DESHD      YPDGGAQELKEALSRYTGVPAEGILTGNGSDELIQLLMTTFGGEKGAVVIHPPTFSMYEAAARXXXXXXX
HIS8_BUCSC      -------------SSYIGLDKKNILITRGSDEAIELLIKTFCEQCDRIVFCPPTYDMYNVSANIMGVECL
HIS81_PSEPF     --------LKNAVAKYYGVQNNQVFLGNGSDEVLAHIFHGLLQHDQPILFPDISYSFYPVYCGLYGITFD
PATR_STRGG      ------------LADRFGVPLGHLATGTGSVGVAQQLLQATSGPGDEVIYAWRSFEAYPIITQVSGATSV
HIS8_BUCAP      -------------ANYVGLLNNQILVTRGADEGIELLIKAFCEPGKDAIIYCPPTMYAINA-KIANVEIK
HIS8_BACCN      --------LRQKVANHLKVQPEQLLFGSGLDEVIQMISRALLHKGTNVVMARPTFSQYRHHAIIEGAEVR
HIS8_AERS4      -------------AAYAGVNPDQVLVSRGADEAIELLIRTFCEAGDQILICPPTYMYAISA-ETCGVGIV
HIS82_BACAN     APDGGATTLRQTIANKLHVKMEQVLCGSGLDEVIQMISRAVLKAGDNIVTAGATFPQYRHHAIIEGCEVK
DAPAT_DESVM     PSYVGMLEFRQEVANWYGRRKTEVIGLIGSKEGIAHFPLAFVNPGDLVLVCTPNYPVYHIATGFVGGEVQ
HIS8_MACCJ      YPDPEAIQLKASLSEFYQVDSEQILVGAGLDEIIMMISRARLNPKGHILTSEGTFIQYTTHALIEDNEVV
HIS8_HALMA      -PKASHADLVDELADMWDVTPEQVWLSNGGDGALDCLARAMLDPGQDVLVPSPGFAYYAMSARYHHGEVN
HIS8_AKKM8      --------LRSAIAEFCGVEFGQTVVGTGSSEVIELICHALLNPRAEVVAAKHAFSMYPIMSKLFGAAYV
HIS81_LEGPH     YPNIGLQELQKQLAKRYQIYSDQIILTRGSDDGIDLTTRLFLTAGKDAFMQFPPTF-PMYAFRLQQAELI
DAPAT_DESDA     GPEQGYAFLRDVIMQYVTLAPDEIFVSDGAKPDVGNFQELFAQD-SIVAVTDPVYPVYVDSNVMAGSRIV
HIS8_PSEU2      --------LKHAVADYYKVQPSQVFLGNGSDEVLAHIFHALFQHDAPLLFPDISYSFYPVYCGLYGIDYE
HIS8_LISMF      YPDGWASSLRTVVADFYQLEEEELIFTAGVDELIELLTRVLLDTTKNTVMATPTFVQYRQNALIEGAEVR
HIS8_GEOTN      ---DGYAALREKVANHLGVKETQLLFGNGSDEVVQIFCRAFLEPGTNTVMATPTFPQYRHNAIIERAEVR
HIS8_SYNJB      -PDAHHRGLKQAIAAYAGAEPEQISLGNGSDELIRLIATCLGGRGGILVAEPTFSMYAILAQSLGIP-VV
HIS8_ROSDO      -PSTDHSALRMAIGQVHGLDAGRIICGVGSDELLTLLAMAFAGPGDEVLYTEHGF-SMYRIFALSGATPV
HIS8_PHOPR      SECQPADLIQAY-ADYAGIDSKQVLTSRGADEGIELLIRTFCEPNQDSILYCPPTYGAISAETFD-IKTK
HIS8_LISMC      YPDGWASSLRTVVADFYQLEEEELIFTAGVDELIELLTRVLLDTTKNTVMATPTFVQYRQNALIEGAEVR
HIS8_HAEIG      -------------ANYAGVSTENVLVTRGGDEGIELIIHTFCEPKQDAILFCPPTYGAVSA-ETAGVLSK
HIS8_HAEIE      -------------ANYAGVSTENVLVTRGGDEGIELIIHTFCEPKQDAILFCPPTYGAVSA-ETAGVLSK
HIS8_BUCDN      -------------ADYVRLSTNQILVTRGADEGIELLIRAFCESGKDAIIYCPPTYDMYRVAEIYNIKYK
HIS8_BACSU      ---DGYAALRTRLSKHLNVSETSLIFGNGSDEIIQIICRAFLNDKTNTVTAAPTFPQYKHNAVIEGAEVR
HIS82_BACCZ     APDGGATTLRQTIANKLHVQMEQVLCGSGLDEVIQIISRAVLKAGDNIVTAGATFPQYRHHAIIEGCEVK
HIS81_HAEIN     -------------ANYAGVSTENVLVTRGGDEGIELIIHTFCEPKQDAILFCPPTYGAVSA-ETAGVLSK
1A112_ARATH     KPFEGLLELRVAFADFVSFDPSNMVITAGGTPAIEVLAFCLADHGNAFLIPTPYYPGFDRDIKFRTGVEL
PATR_NOCFA      -PDNQSGELRAALAEFLGVRVENVAIGCGSALCQELVQITCSSPRDEVLFAWRSFEAYPIITQVGNATAV
HIS8_XANAC      --------LRSALAALYGCAPEQLLIGRGSDEAIDLVRGLCVPERDAVLVTPPVFGMYAVCARLQNAPLV
HIS8_LISW6      ---DGWASLRKEVAAFYQLEEEELIFTAGVDELIELLTRVLLDNTTNTVMATPTFVQYRQNALIEGAEVK
HIS8_LISMH      YPDGWASSLRTVVADFYQLDEEELIFTAGVDELIELLTRVLLDTTKNTVMATPTFVQYRQNALIEGAEVR
HIS8_DEHSC      -PDATQSEIRRLLSEYTGVAVEQIVCGAGSDQLIDLLLRLFINPGDEVINCPPTFAMYKFYTELNRGKIV
HIS8_DEHSB      -PDATQSEIRRLLSEYTGVAVEQIVCGAGSDQLIDLLLRLFINPGDEVINCPPTFAMYKFYTELNRGKIV
HIS8_BACNA      ---DGYAALRTRLSKHLNVSETSLIFGNGSDEIIQIICRAFLNNKTNTITAAPTFPQYKHNAVIEGAEVR
HIS8_ALISL      SECQPPELINAYAA-YAKVTAEQVLTSRGADEGIELLIRAFCEPNEDAILYCPPTYGSISAETI-GVETK
HIS82_DECAR     --------LKAAVARRHTVSAQQVFVGNGSDEVLAHIFMALLKHDQPIIFPDITYSFYPVYCGLYGVEYQ
HIS81_LEGPA     YPNIGLQELQNQLAKRYQIYSDQIILTRGSDDGIDLTTRFFLTAGKDAFMQFPPTFPMYAFYRLQQAELI
HIS8_ROSS1      -PDPDHVRLRAALSRYIGQPPERIICGAGSDELIDLLMRATLRPGDTMIDCPPTFAMYSFDAALYGARVV
HIS8_PSESM      --------LKHAVAGYYNVQPNQVFLGNGSDEVLAHIFHALFQHDAPLLFPDISY------------SFY
HIS8_DEHE1      --------IRRLLAEYTGVNMEQIICGAGSDQLIDLLLRLFINPGDEVINCPPTFAMYKFYTDLNRGTVV
PATR_MYCTU      -PDNGCVQLKAALARHLGFAPEHVAVGCGSVSLCQQLVQVTASVGDEVVFGWRSFELYPPQVRVAGAIPI
PATR_MYCTA      -PDNGCVQLKAALARHLGFAPEHVAVGCGSVSLCQQLVQVTASVGDEVVFGWRSFELYPPQVRVAGAIPI
PATR_MYCBT      -PDNGCVQLKAALARHLGFAPEHVAVGCGSVSLCQQLVQVTASVGDEVVFGWRSFELYPPQVRVAGAIPI
PATR_MYCBP      -PDNGCVQLKAALARHLGFAPEHVAVGCGSVSLCQQLVQVTASVGDEVVFGWRSFELYPPQVRVAGAIPI
PATR_MYCBO      -PDNGCVQLKAALARHLGFAPEHVAVGCGSVSLCQQLVQVTASVGDEVVFGWRSFELYPPQVRVAGAIPI
HIS8_LISMO      YPDGWASSLRKEVTNFYQLEEEELIFTAGVDELIELLTRVLLDTTKNTVMATPTFVQYRQNALIEGAEVR
HIS8_BACP2      ---DGYASLRTELAEFLQVNEKQLIFGNGSDELVQIIARAFLDQHTNTVIPSPSFNAIIEQAEIREVSLL
ALAT_SCHPO      SASQGIPLVRRHVADFIRARPSDIYLTSGASHAARLIMTLIIARPTDVMVPAPQYLYGAQIDLMSGSMVS
AAT2_METJA      TDSRGILELREKISELYDIIPDNIIITXXXXXXXXXXXXXIIDDGDEVLIQNPCYPCYKNFIRFLGPVFC
HIS8_METM5      ----------------------------GADEVIDNIMRILIDEGDEVIIPIPTFTQYAISAKIHGANIK
HIS81_HAEI8     -------------ANYAGVSTENVLVTRGGDEGIELIIHTFCEPKQDAILFCPPTYGAVSA-ETAGVLSK
HIS81_BACCR     ALPDGYAELRTKIAEHLGVKAEQLLFGSGLDEVIQMISRALLHEGTNVVMANPTFSQYHHHAVIEGAEVR
HIS81_ANAVT     ---------REAASKVLGVPSDWLIVGNGSDEILSIVIRACTEPGRKVVYPMPTYVLYRTLTQMQAADIL
HIS8_XANC5      --------LRSALAALYGCAPEQLLIGRGSDEAIDLLVRGLCVPGRDAVLVTPPVFGMYACARLQNAPLV
HIS8_STAS1      YPETGSPLIKEAISKHLNIDPARILFGAGLDEVILMISRAVLTPGDKIVTSEMTFGQYYHNAIVESANVV
HIS8_CHLPD      EPWNRYPDILPFYASFVGVPADAVMMSNGSNEMLYTIFLACLGPGKKILIPEPSFSLYEKIARLLHTEVV
HIS81_BACHK     ALPDGHAELRTKVAKHLGVKAEQLLFGSGLDEVIQMISRALLHEGTNVVMANPTFSQYHHHAVIEGAEVR
HIS81_BACAN     ALPDGHAELRTQVAKHLGVKAEQLLFGSGLDEVIQMISRALLHEGTNVVMANPTFSQYHHHAVIEGAEVR
PATR_RHOE4      -PDNAAVALIEALASFLKVEPANVAAGCGSVTLCQELVQITCDQGDEVIYAWRSFEAYPVVTQVGHAVSV
PATR_PROAC      --------VRSTIAGHFGVDVSQVAVGAGSTEVASQLMHALAGAGDEIIFPWRSFEAYPILTKVAGATPI
HIS81_BACCZ     ALPDGHAELRTQVAKHLGVKVEQLLFGSGLDEVIQMISRALLHEGTNVVMANPTFSQYHHHAVIEGAEVR
HIS8_HELHP      -PDDSMYELKNALASHFDVESKHIIIGAGSDQIIEFCMQALNHHNAQVLMAKTTFAMYEVYAKLAGVEIS
HIS8_GEOSF      -----------------GFPPEWVIMANGSDEVLNNLIRAFADEGDEIAFVYPSYSYYATLAEVQGARVK
HIS8_BAUCH      -------------AAYAGVQPNQVLACRGADEGIELLIRTFCEPSKDKILFCPPTYGMYRSAETFGVAYC
HIS8_STAHJ      YPETGSPSLRKAISEHLNVDPSRILFGAGLDEVILMISRAVLTPGDKIVTSEGTFGQYYHNAIVESAEVV
HIS8_NEIMB      ----------------------DIALGNGSDELIQFITMLTAKPGAAMLAAEPSFVMYRHNAALYGMDYV
ATTY_RAT        APSIGYLSSREEVASYYHLEAKDVILTSGCSQAIELCLAVLANPGQNILIPRPGYRTLAESMGIEVKLYN
ATTY_DICDI      PPSTGYEIAREAVAKYVELTSKDIIVASGASGAIELAIGVLLNEGDNILVPKPGYECTSKTKFINVKHYN
PATR_STRAW      -PDMACSGLMSELSERFGVPLSHLATGTGSVGVAQQLLQATSGPGDEVIYAWRSFEAYPIITQVSGATSV
HIS8_CHRSD      YPDPSATALREALAETYDVATEQVFVGNGSDEVLALAFQAFFRQSRPLLMPAISYSFYPVYCKLYDVAYR
ATTY_HUMAN      APSIGFLSSREEIASYYHLEAKDVILTSGCSQAIDLCLAVLANPGQNILVPRPGYKTLAESMGIEVKLYN
ATTY_BOVIN      VPSIGYLSSREEVASYYHLEAKDVILTSGCSQAIELCLAVLANPGQNILVPRPGYRTLAESMGIEVKLYN
HIS8_PARDP      -PNTDHAGLRGAIGEVHGLDPDRIICGVGSDEIIHFLCQAYAGPGTEVLFTEHGFLMYRISAHAAGAIPV
HIS8_NEIMF      ----------------------DIALGNGSDELIQFITMLTAKPGAAMLAAEPSFVMYRHNAALYGMDYV
HIS8_NEIMA      ----------------------DIALGNGSDELIQFITMLTAKPGAAMLAAEPSFVMYRHNAALYGMDYV
HIS8_NEIM0      ----------------------DIALGNGSDELIQFITMLTAKPGAAMLAAEPSFVMYRHNAALYGMDYV
HIS81_PSYA2     PDGNGYY-LKQALADFNDVNVDQITLGNGSDDLLDILARSFVGADDAIVYSQYAFVVYSMLAKMQGAMDV
HIS81_METCA     YPDPNAELLKQAIARYHGVGANQVFVGNGSDEVLAHAFQALLKQTRPILFPDITYSFYPVYCGLYDIAHE
HIS8_LACF3      YPDGDASELRALVGQQLNVAGDQLVFGVGLDEIIELVARAFLTPDDQVVVAKPAFSEYALHATVEGAAVK
ATTY_MOUSE      APSIGYLSSREEVASYYHLEAKDVILTSGCSQAIELCLAVLANPGQNILIPRPGYRTLAESMGIEVKLYN
ALAM_YEAST      SSSQGVEGIRKSVAEFITKRPEDIFLTAGASAAVNYLLSIFCGPETGVLIPIPQYPLYTATLALNNSQAL
1A16_ARATH      --------------------PDRIVMSGGATGAHETVAFCLANPGDGFLVPTPYYPGFDRDLRWRGVNLV
HIS8_CAMC1      -PDDSYFELKEGLAKKFGVTSKKLIIGSGSDQIIEFALHAKANRQSGVLMAGVTFMYEIYAKQTGAKIYR
HIS82_IDILO     -------PLNQAYAEYAGINASKVLSSRGSDEGIELLIRAFCEPGDKVLICPPTYMYAISAFAVGVTEVP
HIS81_CARHZ     DPLAGR--LRIRLSEKLGVLPENIVLGNGSDELILCLYLAFGGYGRIALSFSPSFMYRHHAFVTQTEFFE
AVTA_ECOLI      DGPQGKTELLTLLAEKLGIEPQNIALTNGSQSAFFYLFNLFAGRRADGRVKAPEYIGYADAFVSARPNIE
HIS8_SULSO      ---------RELAAEYSKVEPENIYPSVGADGSIRAIFYNLVEPGDTILTNXXXXXXXXXXXXXRGTKVI
HIS8_MYCSS      YPDRDAVALRSDLADYLNLRTENLWAANGSNEVLQQLLQAFGGPGRSAIGFVPSYMHPIIADATRTEWLQ
HIS8_MYCSK      YPDRDAVALRSDLADYLNLRTENLWAANGSNEVLQQLLQAFGGPGRSAIGFVPSYMHPIIADATRTEWLQ
HIS8_MYCSJ      YPDRDAVALRSDLADYLNLRTENLWAANGSNEVLQQLLQAFGGPGRSAIGFVPSYMHPIIADATRTEWLQ
HIS8_METMP      ----------------------------GADEVIDNIMRILIDEGDEVIIPIPTFTQYAISAKIHGANIK
HIS8_BUCMH      --------LTSCYSSYIGINKSNILITRGIDEAIELLIKTFCNQNEKIIFCPPTYDMYNISAKIIGIKSY
DAPAT_SYNY3     GPEQGYAWLREFQARGCEVNAEEIFISDGSKNILDIFGK-----DNTIAVTDPVYPVYVDTNVMAGH---
DAPAT_NATTJ     ----------------------EILTLIGSKEGIANISQAILNPGDINFIPDPSYPVYKNGTILAGGTPH
HIS8_METVS      ------------ISSFIGVPCENIIIGDGADEVIDNIMRILIDEGDEVIIPIPTFTQYAISAKIHGAKIK
HIS8_GEOSL      YPSASSQVLRETVGELFGFDPAWIIMANGSDEVLNNLIRAFAGEGEEIGYVHPSYSYYATLAEIQGARVR
HIS8_DINSH      -PSTDHAGLRGAIAEVYGLDPERIICGAGSDEIIAFLCQAYVGPGDEVIHTEHGFAMYRISTLAAGGTPV
CBL_BACSU       ------------------VNPESITFSPGVVTALSMAVQAFTEPGDQVVVQPPVYTPFYHMVEKNGRHIL
AAT_RICBR       ---------------------EEIIVSTGGKQVIYNLFMASLNKGDEVIIPAPYWVSYPDMVLLAEGTPV
HIS8_PELCD      -----------------GFDPDWVIMANGSDEVLNNLIRAFAGEGEEIAYVHPSYSYYSTLAEIQGAKVR
HIS8_NEIG2      -----------------------VALGNGSDELIQFITMLTAKPGAAMLAAEPGFIMYRHNAALYGMDYV
HIS8_NEIG1      -----------------------VALGNGSDELIQFITMLTAKPGAAMLAAEPGFIMYRHNAALYGMDYV
HIS8_HALVO      -PKTAHTDLTERLADKWGLAPEQVWVSPGADGSIDYLTRAVLEPDDRILEPAPGFSYYSMSARYHHGDAV
HIS8_HALSA      -PKAVHADLTGALADRWDVGDDQVWVANGGDGALDYLARATLDPGDSVLVPSPTYYGMSARFHHGNVAEY
HIS8_HALS3      -PKAVHADLTGALADRWDVGDDQVWVANGGDGALDYLARATLDPGDSVLVPSPTYYGMSARFHHGNVAEY
HIS82_THIDA     YPDPNSDRLRAAIAAYHAVSPDQVFVGNGSDEVLAHTFLALLKHERPVFFPDITYSFYPVYCGLYGIAHR
HIS82_CAUCR     --------LRAAIGARLGVSPARVVVSPGSEALIDYVFRAVLHPGDSILLSSPTFPTYEIFGRCAEARII
COBD_THETN      YPDIKYRRLKEAIAEYVGCDRENIIVGNGAAELIHLFARAF--KLKKPLIPSPSFLEYERAVKLNGPVYL
HIS8_PSEA6      -------------AAYAGVQPEQLLVSRGADEGIELLIRAFCTPGDSVLICPPTYMYAISAETCD----V
HIS8_MYCUA      YPDRDAVALRTDLANYLTAQTENVWAANGSNEILQQLLQAFGGPGRTAIGFVPSYMHPIISDGTHTEWVE
HIS8_METM7      ----------------------------GADEVIDNIMRILIDEGDEVIIPIPTFTQYAISAKIHGANIK
HIS8_METJA      ------------LSKFLNVDEENIIVGDGADEIIDTIFRTFVDDGDEVIIPIPTFTQYRVSATIHNAKIK
HIS8_XANC8      --------LRAALAQLYGCAPEQLLIGRGSDEAIDLVRGLCVPERDAVVVTPPVFGMYAVCARLQNAPLV
HIS8_STRMU      STLE-QADLRAALANNLKVKPEQLMIANGSDDVLSIAFLAFFNNDEPVLFPDLTYGFYKVWADLYRVNYH
HIS8_POLNA      YPDGRVNDLRRALADYAQM-PEDIMLGNGSDELIALLALACDVPGGSVLAPLPGFVMYAMSAQLQGLKFI
AAT_RICFE       ---------------------DEIIVSTGGKQVIYNLFMASLDKGDKVIIPAPYWVSYPDMVALSTGTPV
AAT_RICCN       ---------------------DEIIVSTGGKQVIYNLFMASLDQGDEVIIPAPYWVSYPDMVALSTGTPV
HIS8_MESSB      YPDGSASKLRDAIAKAHGLNPANILCSNGSDELLALLAQTYLMPGDEGIYTEHGFL----VYRIQGATPV
HIS8_CAMC5      -PDDSYFELKEALGAKFGVGTKNIIIGSGSDQIIEFCLHAKANPQSAVLMAGVTFMYEIYAKQVGAKIYR
HIS8_ARCB4      -PDDSMYELKDALAKKYNLESSNIIIGSGSDQILEFCIHAKCKKDSKILMAKTTFA----MYEIYGKHVG
HIS81_RALSO     YPVPTADALKAQLKRVMRVPAADVLLGNGSDEIISLIAIAAAKPGATVLAPVPGFVMYAMSAQLMGLKFV
HIS81_BRAJA     YPDPRATRLREAIAAYCDVAAEQVFVGNGSDEVLAHTFPALLKHDRPLLFPDVTYSFYPVYCRLYGVAHE
DAPAT_PROMS     GPEQGYAWLREFISRGCQISPEEIFVSDGSKNILDILGKAVTDPVYPVYVDSNVMTGALENGTYQGLTYL
Y1479_METJA     CPTKGLLETREFLAEQVNKRAEDIIFFNGLG---DAIAKIYLKRQVRVINPSPSYSSSAEASHAGSPTYF
PATR_MYCMM      --------------------PEHIAVGCGSVSLCQQLVQITASVGDEVIFGWRSFELYPPQVQVAGATAI
HIS8_MYCMM      YPDRDAVALRTDLANYLTAQTENVWAANGSNEILQQLLQAFGGPGRTAIGFVPSYMHPIISDGTHTEWVE
HIS81_RHILO     YPDPAGRELRQAIAAKYGFGEDQIILGNGSEDLLSVISRAVLRPGDSVVTLYPSFPLHEDYATLMGASVK
HIS81_GLUOX     --------LREELSRQTGIDTDRIVIGNGSEQIIRMICEAFLSPGDRLVTVLPSFGLHLIWPQMMGARAE
PATR_MYCUA      --------------------PEHIAVGCGSVSLCQQLVQITASVGDEVIFGWRSFELYPPQVQVAGATAI
KAT1_HUMAN      TKTFGYPPLTKILASFFGIDPRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGPVFV
HIS8_GLUDA      --------LRAAIAQAHDVGMDEIFVGNGSDEVLAHAFHALLQHDAPLLTPDITYSFYPVYCGLYGIAHQ
HIS81_CAUCR     --------LRAAVAERYKLEPERLTFGDGSDEIFALLCQVYLEPGDNIVQGEHGFAAAIGARACQG----
DAPAT_CLOPH     SPDLGYEFLRSAIAKHVQIALDEIFISDGAKSDSGNIGDIFAENNKPVYVDTNVMAGRTGEFNYTTGKWS
HIS8_STRGC      ------AELCQALAANLGVSPDQLIIGNGSDDILSMAFLAFFNSGESVLFSDLTYFYKVWADLYQVP-FR
HIS8_BEII9      --------LRTAIASRHGLDPARIVCGAGSDELLSLLAAVYLGPGEEGIFTEHGFLVYKIAILTAGGTPI
HIS81_PSEAE     YPDPNGERLKQAVAAHYGVQANQVFVGNGSDEVLAHIFHGLFQHDLPLLFPDVTYS------------FY
HIS8_STRSV      ----------------LGVSPDQLIIGNGSDDILSMAFLAFFNSGESVLFPDLTYGFYKVWADLYHVPFR
HIS8_CLOBK      YPDPNCDALRKTIANYYNLSKEEVFIGNGSDEVLALSFLTFFNPEETVVFSDISYS------------FY
HIS8_CLOBH      YPDPNCDTLRKTIANYYNLSKEEVFIGNGSDEVLSLSFLTFFNPEETVVFSDISYS------------FY
HIS8_CLOB1      YPDPNCDTLRKTIANYYNLSKEEVFIGNGSDEVLSLSFLTFFNPEETVVFSDISYS------------FY
AAT_RICTY       ---------------------DEIIVSTGGKQVIYNLFMASLDKGDEVIIPVPYWVSYPDMVALSTGTPI
PATR_CORJK      -PDMASGALRGKLAQWLGVDLDNVAVGNGSSALCQQLVQATCKDGDEVVYAWRSFEAYPILCKIAGAVGV
HIS8_CLOBL      YPDPNCDVLRKTIANYYNLSKEEVFIGNGSDEVLSLSFLTFFNPEETIVFSDISYS------------FY
HIS8_CLOAB      YPDPNCDSLKRTIAEYYGISDKEVFVGNGSDEVLAFSFMTFFSPRKTVFFADITYSFYKVYANLLNLNCE
HIS82_CARHZ     YPDGGAFRLKEKIAAKYGVTPDNIILGNGSDELVMFLAMALIDPGDEAIMPVPSFPRYEPVVTMMNGIAR
HIS82_BURS3     YPDPVARALRETVATHHRIKPEQVFVGNGSDEVLAHTFQALLKHDRPLRFPDITYSFYPTYARLYGVQTS
MTNE_BACSU      SSFRGSYRLKSAAAAFIDLDPEEVAVLFGGKAGLVELPQCLLNPGDTILVPDPGYPDYWSGVTLAKAKME
HIS8_VESOH      -----------------------VLLGNGSDELIQLLA-LACNTGDTVLSVEPSFVGMITKFTRLNYQSV
HIS8_RHOBA      --------------------PEWVLAGNGSDEILTLLVRGFVGEGESLRLPYPSYILYRTLADIQGANWE
HIS8_DESVV      AQS-GNPRLTRAIAAHHGVAPERVVAGNGSDEIIDLLIRVRATPGKHNIV---AFRPCFSIYELQA-KFL
HIS8_DESVH      AQS-GNPRLTRAIAAHHGVAPERVVAGNGSDEIIDLLIRVRATPGKHNIV---AFRPCFSIYELQA-KFL
ALA2_PANMI      SHSQGIKGLRDAIAAGIASRDDDIFVTDGASPGVHMMMQLLINEKDGILCPIPQYPLYSASIALHGPYYL
AAT_RICPR       ---------------------DEIIVSTGGKQVIYNLFMASLDKGDEVIIPVPYWVSYPDMVALSTGTPV
HIS8_XANCP      --------LRAALAQLYGCATEQLLIGRGSDEAIDLVRGLCVPERDAVVVTPPVFGMYAVCARLQSAPLV
HIS8_STRAW      ---------------------ENVWAANGSNEVIQQLLQTFGGPGRTAIGFEPSYSMHALIARGTGTAWI
HIS8_RHORT      -PDGNATALREALGRTHGLDPARIVCGAGSDELIGLLCRAYAGPGDSIVQSAYGFLMYGIYARGVGAEPI
HIS8_HAHCH      ----------------------DMLFGNGSDEIIQILAMAVAGPGRTILSVEPSFVMYKMIATFIGAEYV
HIS8_GEOUR      -----------------GFLPEWIVMANGSDEVLNNLIRAFADEGDEIAYVYPSYSYYATLAEIQGARVK
HIS8_GEOMG      YPSASSQKLREVAGELYGFDPSWIIMANGSDEVLNNLIRAFAAEGEEIGYVHPSYSYYGTLAEVQGARVR
HIS8_CLOB8      DPT--CSELTSEIANYYKLDENEIFIGNGSDEILAFSFMTFFSKNKKILFPDISYT----FYKVYAELFL
CBL_MYCLE       --------------------------------------RLITDRGDGVIVSPPVYPPFYAFVTHDGRRVL
ALAT_YEAST      SHSQGVPGIRQTVADFITRRPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLQYPLYTASASLFNAQVLPYY
KAT1_RAT        TRAFGYPPLTNVLASFFGMDPTNVLVTVGAYGALFTRFQALVDEGDEVIIMEPAFDCYEPMTMMAGPVFV
KAT1_MOUSE      TSAFGYPPLTKILASFFGMDPKNVLVTVGAYGALFTAFQALVDEGDEVIIIEPAFNCYEPMTMMAGGRPV
HIS8_SILST      -PSSDHATLRAAIAETHGLDAERIICGAGSDEIIAFLCQCYAGPGDEVLYTEHGFAMYRISALAAGATPV
HIS8_LEUCK      YPDGQATALRQAVAKLEQVNPDSLVFGAGADELIELLTRVILTPNDNVIVPNPTFGEYAMHAQIEQATTK
HIS8_DIAST      -----------------------VLLGNGSDELISLVALACARAQATVLAPVPGFVMYAMSAQLQGLGFV
YFBQ_SHIFL      ------------------VTVEDIYIGNGVSELIVQAMQALLNSGDEMLVPAPDYTAAVSLSSGKAVHYL
YFBQ_ECOLI      ------------------VTVEDIYIGNGVSELIVQAMQALLNSGDEMLVPAPDYTAAVSLSSGKAVHYL
YFBQ_ECOL6      ------------------VTVEDIYIGNGVSELIVQAMQALLNSGDEMLVPAPDYTAAVSLSSGKAVHYL
HIS8_PSE14      --------LKHAVADYYKVQPNQVFLGNGSDEVLAHIFHALFQHDASLLFPDISYS------------FY
HIS8_CLOB6      YPDPNCDALRKTIANYYNLSKEEVFIGNGSDEILAFSFLTFFNPEETVVFSDISYS------------FY
HIS8_CAMFF      -PDDSYYELKDGLSNLYKVEPKNVIIGSGSDQIIEFALHAKANEKKGILVSGVTFMYEIYAKHVGAKIYK
ALA2_HORVU      SHSQGIKGLRDAIASGIASRDDDIFLTDGASPGVHLMMQLLINEKDGILVPIPQYPLYSASIALHGPYYL
Y286_HAEIN      CDSKGLYSARKAIVQYLGATVNDVYIGNGVSELITMAMQALLNDGDEVLVPMPDYPLWTAAVTLSGGKAV
HIS82_GLUOX     YPDPTAAVLRDTIAARFGTTSDRVFVGNGSDEVLAHAFRALFHDDAPVLFSDVTYGFYPVYCGLFEQPFR
HIS81_ANASP     PEPFG-EEFRKAVSQLLGVPCNWVIVGNGSDEILSIVIRACAEPTRKVVYPVPTYVLYRTLTEMQAADIL
ALAT1_MOUSE     SISSGIQPIREDVAQYIERRPNNIFLSTGASDAIVTMLKLLVGEGTGVLIPIPQYLDAVQVYYLDEERAW
HIS8_GEOBB      -PDAASRLAREEAAKVYGFDPSWIIMANGSDEVLNNLIRACAGEGEEIAFINPSYSYYGTLAEVQGARVR
HIS8_CHLCH      -----YRAMEAY-ANFVGVPAECVIMSNGSNEMLYTIFLACLGPGRKVLIPNPSFSLYEKLALLLQSDIV
HIS8_ACISJ      -----------------------VLLGNGSDELISLVALACARAQATVLAPVPGFVMYAMSAQLQGLGFV
DAPAT_LEPBL     GPEQGYSFLLKSIANGIKIDESEIFVSDGSKCDCGNIQEIFSTDAKPVYVDTNVMAGRTGEIGADGSNLI
DAPAT_LEPBJ     GPEQGYSFLLKSIANGIKIDESEIFVSDGSKCDCGNIQEIFSTDAKPVYVDTNVMAGRTGEIGADGSNLI
AAT_STRGR       ----------------------QILVTNGGKQAIYEAFAAILDPGDEVIVPAPYWTTYPESIRLAGGVPV
AAT_MYCTU       SDSQGILSARRAVVTRYELVPDDVYLGNGVSELITMTLQALLDNGDQVLIPSPDYPLWTASTSLAGGHYL
AAT_MYCBO       SDSQGILSARRAVVTRYELVPDDVYLGNGVSELITMTLQALLDNGDQVLIPSPDYPLWTASTSLAGGHYL
HIS8_UNCMA      -PSVDAIELREALAMRHGVPVRNIVCGNGMDAVIETLLRAFLETGDEVVIPLPSYYENVTRFCGATPKYC
DAPAT_DESAP     PSSAGMPAYRRAVADWYARRQREVVSLIGSKEGIAHLPWCFXXXXXXXXXXXXXXXGTILAGGIPHPVPL
CBL_MYCTU       G-TEYAEAVREFACQWHDLEVSRTAIVPDVMLGIVEVLRLITDRGDPVIVNSPVYAPFYAFVSHDGRRVI
CBL_MYCBO       G-TEYAEAVREFACQWHDLEVSRTAIVPDVMLGIVEVLRLITDRGDPVIVNSPVYAPFYAFVSHDGRRVI
HIS8_RHOPB      --------LREAIGRAYGLDPDRIICGAGSDEILNLLAHTYLGPGDEAIATTYGFLVYPIATMANGAKLV
HIS8_MYCS2      --------LAAYLTAATGVRVENLWAANGSNEILQQLLQAFGGPGRTAIGFVPSYMHPIISDGTQTEWLQ
HIS8_MARMM      YPDGGATKLRXXXXXXXXXXXXNIVCGTGSDELLQLLGRAYLNPGDKVVQSQYGFLVYRLVAMQCGANLV
HIS8_CAMLR      -PDDTMSELKQALAQKYDILKENLIIGSGSDQIIEYIVHAKLDHSKAYLQCGVSFMYEIYAKQLGVKVYK
DAPAT_METTH     GPEQGYPFLREAIAEGVDITADEIFISDGAKCDTGNIQEIFTDPVYPVYVESNVMAGADDDGRYSGLVYL
HIS8_FRAP2      ------------LAKIYDVDASNILVTRGSDEGIDLLFRLYCEKDSAFAVEPTFGMYKIAA-QLQGVDYK
HIS8_ACIBT      PDPDATA-LKQAIAKQQNIDVSQVFVGNGSDEVLAHIFKAFFLQDEPILYPDITYSFYPVYSQFFGTKTK
HIS8_ACIB5      YPDPDATALKQAIAKQQNIDVSQVFVGNGSDEVLAHIFKAFFLQDEPILYPDITYSFYPVYSQFFGTKTK
HIS8_ACIB3      YPDPDATALKQAIAKQQNIDVSQVFVGNGSDEVLAHIFKAFFLQDEPILYPDITYSFYPVYSQFFGTKTK
HIS82_ANASP     -PDGGHETLKSAIAEYVNESANNISVGNGSDELIRLIATCLSGEGSILVANPTFSMYGILAQTLGIP---
YBDL_ECOLI      APMTGVQALREAIAQLYGYQPDDITVTAGATEALYAAITALVRNGDEVICFDPSYDSYAPAIALSGGIVK
MALY_ECOLI      ------------------------------------------ETGEGVVIHTPAYDAFYKA--IEGNQRT
HIS8_GEOSM      -PDAASVLAREEAAKVYGFDPSWIIMANGSDEVLNNLIRACAGEGEEIAFINPSYSYYGTLAEVQGARVR
HIS8_ACIBY      -PDPDATVLKQAIAKQQNIDVSQVFVGNGSDEVLAHIFKAFFLQDGPILYPDITYSFYPVYSQFFGTKTK
HIS8_ACIBC      -PDPDATVLKQAIAKQQNIDVSQVFVGNGSDEVLAHIFKAFFLQDGPILYPDITYSFYPVYSQFFGTKTK
DAPAT_SYNS9     GPEQGYAWLREAIAQGCEINADEIFVSDGSKNILDILG-----EGNRVAVTDPVYPVYVDSNVMAG---R
DAPAT_DESPS     GPEQGYAFLREAIAEGAGIVADEIFVSDGAKCDTSNIQEIFSAE-TKIAIPDPVYPVYLDTNVMAGRTGL
BNA3_YEAST      SPTRGRPSLINSLIKLYSLKAENVTVTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVV
1A1C_SOYBN      --------------------PDRIVMSGGATGAHEVTTFCLADPGDAFLVPIPYYPGFDRDLRWRGIKLV
HIS81_ARCFU     YPNPEYRELREKISDYTGWDADRVVVGAGIDGILETLFRILIDEGDEVVIPIPTFPYYHILTKLSCGKEV
DAPAT_ARATH     GAEQGAKPLRAAIAKTLGIGDDDVFVSDGAKCDISRLQVMFQDPSYPAYVDSSVIMGQTGQFNTDVQKYG
CSD_CHLPN       --TEAYAAVREKVRKWVSAASDEIVFTRGTTAGLNLVNDLWIPKGGVVLVEAEHHANVLSACRRRGSLVK
1A17_ARATH      --------------------PDRIVLTAGATAANELLTFILADPNDALLVPTPYYPGFDRDLRWRGVKIV
HIS8_SULTO      ------------MAEYNRVEPKNIYPTPGGDGALRAVFYNLIQTGDKVVINNPSYSMYKVYASVRGLKLT
HIS8_COLP3      PDFQPQALLKAY-SNYCNLPVDNILATRGADEGIELIIRSFCRAQDSVLICPPTYMYAISAEN-HGAGII
DAPAT_PARUW     GTEQGSILLREAIAEQYKIDPQEVFVSDGSKCDVGRL-QILFGSDATIAVQNPTYPGQASFFQTSTKQYQ
YDT4_SCHPO      SHTRGRPSLRKALSEAYSLNPDEIVVTAGANEGFFSVFAAFLNPGDEVIVMEPFFDQYISNITMNXXXXX
HIS8_MYCSM      --------LAAYLTAATGVRVENLWAANGSNEILQQLLQAFGGPGRTAIGFVPSYMHPIISDGTQTEWLQ
HIS8_LACLA      YPSTDAKSLRKKLADYHHLEVEQVIIGNGSDEVLSLSFLTFFNSQSPLLMPDITYSFYPIYCELYRIPFQ
ALAM_DICDI      SNSQGIGLVLRSVADFIERRPSEIFLTDGASVGVQRILKLLIKDRSDGILQYPLYSATIELYNGSQLGYL
1A11_ORYSJ      --------LARFMSEQRGYKPSNIVLTAGATSANEALMFCLADHGDAFLIPTPYYPGFDRDLKWRGAEIV
1A11_ORYSI      --------LARFMSEQRGYKPSNIVLTAGATSANEALMFCLADHGDAFLIPTPYYPGFDRDLKWRGAEIV
HIS8_ACIBS      YPDPDATALKQAIAKQQNIDVSQVFVGNGSDEVLAHIFKAFFLQDEPILYPDITYSFYPVYSQFFGTKTK
HIS8_ACIAC      --------LKSALAAHIGM-PESMVLGNGSDEIITLLALACARPGTAMLAPMPGFVMYPMSAQLQGLDFV
HIS82_BURPS     ----------------------DVLLGNGSDEIISMLAMACAKPGAKVLAPVPGFVMYELSAKFAQLEFV
HIS82_BURP1     ----------------------DVLLGNGSDELISMLAMACAKPGAKVLAPVPGFVMYELSAKFAQLEFV
HIS82_ANAVT     -PDGGHEELKDAIAQYVNITAANISVGNGSDELISLLIATCLGAQGSILVANPTFMYGILAQTLGIP-VV
HIS81_BURMA     ----------------------DVLLGNGSDEIISMLAMACAKPGAKVLAPVPGFVMYELSAKFAQLEFV
DAPAT_DESAH     GPEQGYAFLREFKARGADIDSDEIFVSDGAKCDTGNFQELFSDPVYPVYLDTNVMAGRTGEFRYGGVSYM
HIS8_CAMJR      -PDDSMIELKSTLAQKYKVQNENIIIGAGSDQVIEFAIHAKLNSKNAFLQAGVTFMYEIYAKQCGAKCYK
HIS8_CAMJJ      -PDDSMIELKSTLAQKYKVQNENIIIGAGSDQVIEFAIHAKLNSKNAFLQAGVTFMYEIYAKQCGAKCYK
HIS8_CAMJ8      -PDDSMIELKSTLAQKYKVQNENIIIGAGSDQVIEFAIHAKLNSKNAFLQAGVTFMYEIYAKQCGAKCYK
1A1C_PHAAU      --------------------PDRIVMSGGATGAHEVTAFCLADPGEAFLVPIPYYPGFDRDLRWRGVKLV


                         +         .         .         .         .         *         .:210
query           TVPAGEEGPDLDALEEVLKRERPRFLYLIPSFQNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYRELYF
Y104_SULSO      SITVTEMGPDLDELERKIKDKKVKLMYVIPTAQNPAGTTMNTEDRKRLLEIASKYDFLIFEDDAYGFLVF
YISV_BACSU      GLPMDDEGVKAGLVSSNRKQYGGQLLYTIPSFHNPTGTVMSEQRRKEIISLSKKEQMPIIEDDAYGDLWF
AADAT_HUMAN     NVASDESGIVPDSLRDILSRNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQF
YDCR_ECOLI      SVATDKEGIDLQALELALQEYPVKACWLMTNSQNPLGFTLTPQKKAQLVALLNQYNVTLIEDDVYSELYF
AADAT_RAT       SVPSDDCGIIPEGLKKVLSKRTPKFLYTIPNGNNPTGNSLTGDRKKEIYELARKYDFLIIEDDPYYFLQF
AATR2_DICDI     GIETDRYGMIPEKLQRLLKFKFPRVIYLIPCGQNPSGTTMNHQRKLDIYSICSKYNLLIIEDDPYYYLQF
YDFD_BACSU      GLPMDNEGL-LPENVHLTRGERGRILYTNPCFHNPTGILMSKKRREEILAVSENTQLPIIEDDIYRELWI
AADAT_MOUSE     NVPSDEHGIIPEGLKKILSKKTPKFLYTVPNGNNPTGNSLTGDRKKEIYELARKYDFLIIEDDPYYFLQF
MOCR_RHIME      PLPVERDGWSL----EDETRPSPRLIFVTPSCQWPLGCLMRMEDRLRLLQIGERHDAWIVEDDYDSEYRF
AADAT_BOVIN     NVSSDEHGIIPDSLREILKKNSPKFLYTVPNGNNPSGNSLTAERKREIYELARKYDFLIIEDDPYYFMQF
AATR3_SCHPO     PIDMDENGMLPESFEKVMETARPHVLYTIPTGQNPTGSTLTLERRKKFLTLAKKYDIIIVEDEPYYFLQF
YJIR_ECOLI      EIPTDPEGISVEALELALEQWPIKGIILVPNCNNPLGFIMPDARKRAVLSLAQRHDIVIFEDDVYGELAT
AATR1_SCHPO     PIDMDQFGFLPESMDDILTNPKPHVLYTIPTGQNPTGSTLSVERRKQIYTLAQKHDIIILEDEPYYYLQF
NORG_STAAC      DVPYNQIN-EIDTIIDRFINFKNKAIYIEPRFNNPTGRSLTNEQKKNIITY-SERHNXXXXXXXXXXXXX
NORG_STAA8      DVPYNQIN-EIDTIIDRFINFKNKAIYIEPRFNNPTGRSLTNEQKKNIITY-SERHNXXXXXXXXXXXXX
NORG_STAA3      DVPYNQIN-EIDTIIDRFINFKNKAIYIEPRFNNPTGRSLTNEQKKNIITY-SERHNXXXXXXXXXXXXX
NORG_STAAN      DVPYNQIN-EINTIIDRFINFKNKAIYIEPRFNNPTGRSLTNEQKKNIITY-SERHNXXXXXXXXXXXXX
NORG_STAAM      DVPYNQIN-EINTIIDRFINFKNKAIYIEPRFNNPTGRSLTNEQKKNIITY-SERHNXXXXXXXXXXXXX
AATR1_DICDI     ACEMDSKGMIPSELDNLLSNKFPKLIYMIPHGQNPTGILYDMERKEEIYKIACKFDLLIIEDDPHNEIVN
NORG_STAAB      DAPYNQIN-EINTIIDRFINFKNKALYIEPRFNNPTG-CSLTNEQKQNIITYSERHNXXXXXXXXXXXXX
AATR2_SCHPO     SVDMDSEGMLPESLEEIMRGPRPHVLYTVPTGQNPTGSTXXXXXXXXXXXXXXXYDIIIVEDEPYYFLQF
YDEL_BACSU      PIPVDDEGICIQKIKE----QQPNLVYVTPSHQFTLGTIMTINRRIQLLKWAAENQSFIIEDDYDGEFRY
YCXD_BACSU      GVKRTEEGLDIAKVERLFQTESIKFFYTMPRFHNPLGCSLSERDKQELVRLAEAYDVYLVEDDYLGDLEE
YHDI_BACSU      PICSDAEG----VLPDELYRQNPYLMYTTPSHQFPIGTIMTITRRQELLAWAAETNSFIIEDDYDGEFRY
GABR_BACSU      TIMLDEKGMSIAEIT----RQQPDVLVTTPSHQFPSGTIMPVSRRIQLLNWAAEEPRYIIEDDYDSEFTY
ARO9_YEAST      TFDRESQGIDVEYLTQLLDNNKPRVLYTIATGQNPTGMSVPQWKREKIYQLAQRHDFLIVEDDPYGYLYF
DAPAT_DESDG     ELPLLEENPDLDAVDEATWEKARCIFVNYPN--NPTAAMAPRSFFEKLIGIARKHNVIVVHDAAYTEMYY
DAPAT_CARHZ     KMPLKPENPDLDSIPEEVARKAKLMFINYPN--NPTGAVADLGFFEKVVHFAKKYEILVCHDAAYSEITF
AAT_AQUAE       EVPLKKEKGFQLSLEDVKEKERTKAI-VINSPNNPTGAVYEEEELKKIAEFCVERGIFIISDECYEYFVY
HIS8_ERWCT      AASKSDWQLDLDAIESQLDGTK---VVYVCSPNNPTGNLIARDDLRQLLTLAQGKALVVI-DEAYIEF--
ARO8_YEAST      PVPIDADGIIPEKLAKVMENPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKYDFLIVEDEPYYFLQM
DAPAT_DEHE1     YMPLNKENPDFNAIQDVLSKAK---ILWINYPNNPTGAVAGLDXXXXXXXXXXXHNLAVCHDGPYSEIAF
AAT_THEAQ       EVPTLPEEGFVPDPERVRRAITPRTKALVNSPNNPTGVVYPEEVLRALAEMALQHDFYLVSDEIYEHLIY
AAT_PYRHO       RIPLREENPDPNELLEKISKNTRMIVINYPN--NPTGATLDKELAKTIADIAEDYNIYILSDEPYEHFIY
AAT_SULSO       NLKSREEGIDVDDLQSKISKRTKMIVFNNP--HNPTGTLFSPNDVKKIVDISRDNKIILLSDEIYDNFVY
AAT_THEMA       VVESKNFQPSLEEVEGLLVGKTK--AVLINSPNNPTGVVYRREFLEGLVRLAKKRNFYIISDEVYDSLVY
AAT_PYRAB       EVPTYEENEFRLNVDELKKTEKTKAL-IINSPCNPTGSVLKKKDLEEIADFAVEHDLIVISDEVYEHFIY
HIS8_PECCP      AASKADWQLDLESIEAQL--DGTKVIY-VCSPNNPTGNLIAREDLRQLLTMAQGNALVVI-DEAYIEF--
AAT_THET8       EVETLPEEGFVPDPERVRRAITPRTKALVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLYE
AAT1_BACSU      YVEGLEENHFKISPEQLKNTEKTKAI-VINSPSNPTGVMYTEEELSALGEVCLEHDILIVSDEIYEKLTY
HIS8_CHLTE      EVPMHDDSFDVDAIIEAARREKVDFIVL----STPNNPTSKSLSHDEIERIVEAADAIVLVDEAYVEF--
HIS8_BLOPB      IIPKKENWQDLASIKSQLNNVK---LIYICNPNNPTGNIIHLNSLKKLLKIIQNRALLVT-DEAYID-FC
HIS8_BACHD      EVPLKDGVHDLDGMLEVID-ENTRIVW-VCNPNNPTGTYVSAEAFQSFLAKVPE-DVLVVSDEAYVE-YV
HIS8_ANADF      EAPKGRFHYDLDALRKLLSRRTK--LVFLANPDNPTGTWFTEAELTPFLDAVPKDTLVVL-DEAYVE-YV
DAPAT_DEHSB     NLPLNKGNPNLEAIPQNILSKAKVLWINYPN--NPTGAVAGLSFFQEVANFAAKHNLAVCHDGPYSEIAF
DAPAT_DESVH     FVPLLEENPDLDAIPEDTWKRAKMIFVNYPN--NPTAATAPLGFYEKLVDICRRFDVIIAHDTAYTEIYY
YEY2_YEAST      -------------------------MYCIPTFANPSGNTYSLETRRRLIDIARKYDMLIITDDVYDILDY
HIS8_HALWD      TYPVSKEQDFQQRASDILTQYDDERLLYVTTPHNPSGSELPIPEITALAEGVDDQTLIVI-DEAYGEY--
DAPAT_DEHSC     NLPLNKGNPNLEAIPQNILSKAKVLWINYPN--NPTGAVAGLSFFQEVANFAAKHNLAVCHDGPYSEIAF
HIS82_NITMU     SVPARNYGHDLDAMLDAVAPETR--VVFIANPNNPTGTLLPADDVLRFLERVSPDVLVVL-DEAYNEYLP
DAPAT_DESVV     FVPLLEENPDLDAIPEDTWKRAKMIFVNYPN--NPTAATAPLGFYEKLVDICRRFDVIIAHDTAYTEIYY
HIS8_WOLSU      RTPSDQH--HLGEFWEIYQKERPEILFLLPN--NPLGECLDREEVYDFLQKIDDETLVIV-DGAYQEYAA
HIS81_MANSM     EIPAKNWGHDLEAFLAAINEKTK--LIFIANPNNPTGNFLTEAEIDSFLAKVPPH-IVVALDEAYTEFTA
HIS8_THEGJ      EVPLREDFTDGEAVAEKAKNARVVF---IASPNNPTGNLQP----EEEIIRVLETRRPVVLDEAYAE-FV
HIS81_RALEJ     VVKARDYGHDLDAMAAAITSDTR--LVFIANPNNPTGTFVPAAALETFLAKVPAE-VVVVLDEAYNEYLD
YFDZ_ECOLI      SVPLVEGVDFFNELERAIRESYPKPKMMILGFSNPTAQCVELEFFEKVVALAKRYDVLVVHDLAYADIVY
HIS8_PSEST      VVPAVDYGHDLDGMLKAIDEQTAVIFIANPN--NPTGNLVRAQALESFLDRVPERVLVVL-DEAYIEFYR
AAT_STRVG       DVVADETTGYRVSVEEAARTERTKVLFVSPS--NPTGSVYSEADAKAIGEWAAEHGLWVLTDEIYEHLVY
HIS8_MOOTA      KVPTRNFRHDLAAMAAAI-TPRTRLVF-VCNPNNPTGTIVGQAALDGFLKQVPPSVLVVL-DEAYSD-YV
YDEF_BACSU      PIKSENDEMSPESLEYACKNENIKGLYLIPDYHNPTTSFMSVENRRMVADIVKKYNLFVIEDASYHLL--
HIS8_SULNB      RTESYEH--KYDEFIEAYHTYKPKIIYICTP-NNPTGDAT---SREEVLKIIVDKDTLVVVDGAYMEYAA
DAPAT_SYNFM     FMPLVRENPDLDSIPADVARRAKVMFINYPN--NPTGATAERDFFEKVIAFAREYDVIVCHDAAYTEMAF
DAPAT_HALOH     QVPLVEENPDLKAIDEDIARKAKLFFINYPN--NPTGAIAPEEFYEELIDFADKYDIIIAHDAAYSEIGL
HIS8_BREBN      EVPLKDGVHDLEAMAAAINEQTKVVWVCNPN--NPSGTIVTTSELEAFMKKT-PKDVLVVLDEAYYE-YV
AAT_BACST       YVEGLEQNHFKITPEQLKQAITPRTAVIINSPSNPTGMIYTAEELKALGEVCLAHGVLIVSDEIYEKLTY
HIS8_THETN      AVNLNEDYTNVERFAEAVERYKPKLVFLC-NPNNPTGSVXXXXXXXXXXXKA--RGIVIV-DEAYFEFY-
HIS82_RALSO     EVPARDYGHDLDAMAAAITPD-TRLIY-VANPNNPTGTFLPADAVAAFLAKVPPT-VVVVLDEAYNEFLK
DAPAT_DESAD     IVPLLEENPNLDAISDEKWDKCKIFFVNYPN--NPTSATATPEFYAELVAKAKKHNVIIAADAAYTEVYY
HIS8_VIBCH      VPLTTDWQLDLPSIEANLDRVK---LVFVCSPNNPTGNLVKRADIIKLLEMTQDRAIVVM-DEAYID-FC
HIS8_THEP3      PVRLREDNYDVDSFIKVIEKYQPKLVFLCNP-NNPTGSVIE---REDIIKIIQKSNGIVVVDEAYFEFYG
HIS8_SYMTH      AVPLAGWTMDLPAMAEAAARGAKLLFLCRPN--NPTGTVFAEADLRAALERVPPSTLVVV-DEAYRE--F
DAPT2_ANAVT     TMPLKAENPDLDLIPEEVARKAKMLWVNYPN--NPTGALATLEFFEELVAFCQQHSILLCHDHAYSEMAY
AAT_SULTO       KMKFNESGFSLNLSELESKINKKTKMIVLNNPHNPTGMVFDPIEIEKLMEITKEKKVLLLSDEIY-DYFI
HIS8_SALPK      TVPALENWQDLQGISDNLDGTKVAF---VCSPNNPTGQLINPQDLRTLLELTRGKA-IVVADEAYIE-FC
HIS8_SALPA      TVPALENWQDLQGISDNLDGTKVAF---VCSPNNPTGQLINPQDLRTLLELTRGKA-IVVADEAYIE-FC
HIS8_SALDC      TVPALENWQDLQGISDNLDGTKVVF---VCSPNNPTGQLINPQDLRTLLELTRGKA-IVVADEAYIE-FC
AATC_RHIME      SISVEPDESFFPPLERAVRHSIPKPLALILNYSNPTAQVATLDFYKDVIAFAKKHDIIVLSDLAYSEIYF
AAT_BACY2       YIEATSEQNYKITAEQLKNAITDKTAVIINSPSNPTGMVYTREELEDIAKIALENNILIVSDEIYEKLLY
HIS8_VIBPA      TVPLTSDWQDLAGIESNLDNVK---LVFVCSPNNPTGNLVKREDIVSLLEMTKDRAIVVM-DEAYID-FC
HIS8_THEPX      PVRLREDNYDVDSFIKVIEKYQPKLVFLCNP-NNPTGSVIE---REDIIKIIQKSNGIVVVDEAYFEFY-
HIS8_SALTY      TVPALENWQDLQGISDNLDGTKVVF---VCSPNNPTGQLINPQDLRTLLELTRGKA-IVVADEAYIE-FC
HIS8_SALTI      TVPALENWQDLQGISDNLDGAKVVF---VCSPNNPTGQLINPQDLRTLLELTRGKA-IVVADEAYIE-FC
HIS8_SALSV      TVPALENWQDLQGISDNLDGTKVVF---VCSPNNPTGQLINPQDLRTLLELTRGKA-IVVADEAYIE-FC
HIS8_SALPC      TVPALENWQDLQGISDNLDGTKVVF---VCSPNNPTGQLINPQDLRTLLELTRGKA-IVVADEAYIE-FC
HIS8_SALPB      TVPALENWQDLQGISDNLDGAKVVF---VCSPNNPTGQLINPQDLRTLLELTRGKA-IVVADEAYIE-FC
HIS8_SALNS      TVPALENWQDLQGISDNLDGAKVVF---VCSPNNPTGQLINPQDLRTLLELTRGKA-IVVADEAYIE-FC
HIS8_SALHS      TVPALENWQDLQGISDNLDGTKVVF---VCSPNNPTGQLINPQDLRTLLELTRGKA-IVVADEAYIE-FC
HIS8_SALG2      TVPALENWQDLQGISDNLDGTKVVF---VCSPNNPTGQLINPQDLRTLLELTRGKA-IVVADEAYIE-FC
HIS8_SALEP      TVPALENWQDLQGISDNLDGTKVVF---VCSPNNPTGQLINPQDLRTLLELTRGKA-IVVADEAYIE-FC
HIS8_SALA4      TVPALENWQDLQGISDNLDGTKVVF---VCSPNNPTGQLINPQDLRTLLELTRGKA-IVVADEAYIE-FC
HIS81_NITOC     AVPAKGFGHDLEAMVKAVNSQT-RLVY-IANPNNPTGTWLHSDELEAFLAALPEHVLVVL-DEAYYE-YV
DAPT2_ANASP     SMPLKAENPDLDLIPEEVARKAKMLWINYPN--NPTGALATLEFFEELVALCQQYSILLCHDHAYSEMAY
HIS8_VIBCM      VPLTTDWQLDLPSIEANLDRVK---LVFVCSPNNPTGNLVKRADIIKLLEMTQDRAIVVM-DEAYID-FC
HIS8_VIBC3      VPLTTDWQLDLPSIEANLDRVK---LVFVCSPNNPTGNLVKRADIIKLLEMTQDRAIVVM-DEAYID-FC
HIS8_PYRKO      EVPLREDFTDGDTIAEKAKKASAVF---IASPNNPTGNLQPVEE----VLKVLETGKAVVVDEAYVE-FA
HIS8_DESHY      EVPLTETGRDFRLVEGMLKAAAQPQVHMIVNPNNPTGTLFP---REEILRIVAESGKIVIVDEAYGE-FS
DAPAT_AQUAE     TVPLKEENPDLDSIPEDVAKKAKIIWINYPN--NPTSAPPTLEFYKKLVDWAKEYNVIIASDNAYSEIYT
Y1527_METMP     TLPLLEKNPELDAISKEV-RENAKILYLYPN--NPTGAQATKKFYKEAVDFAFENDLIVIQDAAYAALTY
PATA_BACSU      IVDTTSHGFKLTAIEDALTPNTKCVVLPYPS--NPTGVTLSEEELKSIAALLKGRNVFVLSDEIYSELTY
HIS81_DECAR     STPAKNYGHDLNAMRAAIRPDTR--IVWIANPNNPTGNFLPYPEVRAFLEXXXXXXXXXL-DEAYNEYIP
HIS8_SODGM      TVEARQDWQDLQAIRARLDGVK---LVYICSPNNPTGNLIDLETLRAMLEMTHGRALLVV-DEAYIDF--
HIS8_SALCH      TVPALENWQDLQGISDNLDGTKVVF---VCSPNNPTGQLINPQDLRTLLELTRGKA-IVVADEAYIE-FC
HIS8_ANOFW      EIPLQDGHHHLEAMLEAID-DHTRVVW-ICSPNNPTGTYVNDASLRAFLNKVPQHVLVVV-DEAYYE-YV
HIS82_THICR     EVPAKEWGHDLEAMAEAI-TDKTKLIYL-ANPNNPTGTLFTQKEWEAFISKV-PSNVIVVLDEAYTEYVT
HIS82_HAEIN     EIPAKNWGHDLQGFLTALS-DKTKLIY-IANPNNPTGNFLTSQEIEDFLAEVPE-NVIVVLDEAYTEFTR
HIS8_ENTS8      TVQATDGWQDLPAIAEQLDGVKVIF---VCSPNNPTGQLINPQDLRTLLEMARGKA-IVVADEAYIE-FC
HIS8_CLONN      VFDLDEDFKNVNKIIEYINEEKPK-MFIFSNPNNPTGGVIP---KYDIIKIIENVNCIVVVDEAYMEFY-
HIS82_ARCFU     SFPV-FEGYRVD--PDVIAEERPKLVFLC-SPNNPTGN----SLSREIVQKVAESAEYVVLDEAYVE--F
DAPAT_GLOVI     AMPLLPENPDLEAVPETVARKAKLLWLNYPN--NPTGAVASLEFFEKVVHFAKKHDILVCHDNAYSEMAY
HIS8_PHOLL      ALENWQ--LDIEAIENNLDRVK---LIYICSPNNPTGNAINPDSLRKILELTANRAIVTI-DEAYIE-FC
PATR_MYCA9      QVPLVDHTYDLAAMAAAV-TDVTRLIF-VCNPNNPTGTVVRPAELRRFVESVPPHILIAI-DEAYVE-YV
HIS8_PROA2      DVPMHDDLTDVDAIIARTNQERAGFV-VLSTPNNPTSQSLRLDDVRRIVSGV--EALVLV-DEAYVEFSR
HIS82_HAEI8     EIPAKNWGHDLQGFLTALS-DKTKLIY-IANPNNPTGNFLTSQEIEDFLAKVPE-NVIVVLDEAYTEFTR
AAT1_METJA      NIDLDENNIDLEKVKESITKKTKLIIFNSPS--NPTGKVYDKETIKGLAEIAEDYNLIIVSDEVYDKIIY
HIS8_ECO45      TVPTLENWQDLQGISD--KLDGVKVVY-VCSPNNPTGQLINPQDFRTLLELTRGKA-IVVADEAYIEF--
HIS8_CLOCE      DYILDQNDNFSYSADKIIKTEQPKVIY-ICNPNNPTGNLMPQDEILRVLKACTKS--VVVVDEAYAE-FS
HIS81_THIDA     AVAARDFGHDLERMRAAI-RDDTRVVW-IANPNNPTGTFLPWNEIEAFLETVPPRVLVVL-DEAYGEYLA
Y1391_METJA     NLPLLEENPDLESIPEDIKK-RAKILYLYPN--NPTGAQATKKFYKEVVDFAFENEVIVVQDAAYGALVY
PATR_MYCVP      QVPLTDHTFDLDAMLAAI-TDRTRLIF-VCNPNNPTSTVVDPDALARFVEAVPPHIMVVV-DEAYVE-YI
PATR_MYCPA      KVPLREHTYDLDAMLAAI-TDRTRLIF-VCNPNNPTSTVVDPDALVRFVDAVPADILIAI-DEAYVE-YI
HIS8_XYLFA      QVPLVDDAADVPAIITAAQTSRAKLVFLC-SPSNPVGAAIPLQQIETILQTLAGTALVVV-DEAYGEF--
HIS8_SHIFL      TVPTLENWQDLQGISD--KLDGVKVVY-VCSPNNPTGQLINPQDFRTLLELTRGKA-IVVADEAYIE-FC
HIS8_SHIF8      TVPTLENWQDLQGISD--KLDGVKVVY-VCSPNNPTGQLINPQDFRTLLELTRGKA-IVVADEAYIE-FC
HIS8_SHIDS      TVPTLENWQDLQGISD--KLDGVKVVY-VCSPNNPTGQLINPQDFRTLLELTRGKA-IVVADEAYIE-FC
HIS8_ECOK1      TVPTLDNWQDLQGISD--KLDGVKVVY-VCSPNNPTGQLINPQDFRTLLELTRGKA-IVVADEAYIE-FC
HIS8_ECO81      TVPTLENWQDLQGISD--KLDGVKVVY-VCSPNNPTGQLINPQDFRTLLELTRGKA-IVVADEAYIE-FC
HIS8_ECO5E      TVPTLENWQDLQGISD--KLDGVKVVY-VCSPNNPTGQLINPQDFRTLLELTRGKA-IVVADEAYIE-FC
HIS8_ECO57      TVPTLENWQDLQGISD--KLDGVKVVY-VCSPNNPTGQLINPQDFRTLLELTRGKA-IVVADEAYIE-FC
HIS8_ECO55      TVPTLENWQDLQGISD--KLDGVKVVY-VCSPNNPTGQLINPQDFRTLLELTRGKA-IVVADEAYIE-FC
HIS82_BORPA     GVPAGLE-LDLPATLAAIEAHQPKVVFLLPN--NPTGGLWPDAAVRAILDAA--PGLVVL-DEAYQP-FA
HIS82_BORBR     GVPAGLE-LDLPATLAAIEAHQPKVVFLLPN--NPTGGLWPDAAVRAILDAA--PGLVVL-DEAYQP-FA
PATR_MYCA1      KVPLREHTYDLDAMLAAI-TDRTRLIF-VCNPNNPTSTVVDPDALVRFVDAVPADILIAI-DEAYVE-YI
HIS8_XYLFT      QVPLVDDAADVPAIITAAQTSRAKLVFLC-SPSNPVGAAIPLQQIETILQTLAGTALVVV-DEAYGEF--
HIS8_XYLFM      QVPLVDDAADVPAIITAAQTSRAKLVFLC-SPSNPVGAAIPLQQIETILQTLAGTALVVV-DEAYGEF--
HIS8_XYLF2      QVPLVDDAADVPAIITAAQTSRAKLVFLC-SPSNPVGAAIPLQQIETILQTLAGTALVVV-DEAYGEF--
HIS8_SHIBS      TVPTLDNWQDLQGISD--KLEGVKVVY-VCSPNNPTGQLINPQDFRTLLELTRGKA-IVVADEAYIE-FC
HIS8_PELLD      SVPM-RRGLDFDA-DLILERAKAEALIVLSTPNNPTGSLSPDDIRR----IATESGAIVLVDEAYIEFSR
HIS8_METFL      SVPARDFGHDLDAMLAAITDKTRLF---IANPNNPTGTLLSKPALRDFLAKV-PRQVLVVLDEAYDEYLA
HIS82_METCA     XXXXGSRGPRFHDLETMLERVDPTRVVFIANPNNPTGTLLGRGELYSFLAALPEHVIAVVD-----EAYF
PATR_MYCSS      QVPLRDHTHDLDAMLAAIT-DRTRLIFVCNP-NNPTSTVVDPAALKRFVEAVPPHILVVI-DEAYVEYIR
PATR_MYCSK      QVPLRDHTHDLDAMLAAIT-DRTRLIFVCNP-NNPTSTVVDPAALKRFVEAVPPHILVVI-DEAYVEYIR
PATR_MYCSJ      QVPLRDHTHDLDAMLAAIT-DRTRLIFVCNP-NNPTSTVVDPAALKRFVEAVPPHILVVI-DEAYVEYIR
HIS8_YERPY      TVPAQADWQDLPAIANNL--EQVKVIY-VCSPNNPTGNLINPADLQAVLALAQGRAIVAI-DEAYIE-FC
HIS8_YERPP      TVPAQADWQDLPAIANNL--EQVKVIY-VCSPNNPTGNLINPADLQAVLALAQGRAIVAI-DEAYIE-FC
HIS8_YERPN      TVPAQADWQDLPAIANNL--EQVKVIY-VCSPNNPTGNLINPADLQAVLALAQGRAIVAI-DEAYIE-FC
HIS8_YERPG      TVPAQADWQDLPAIANNL--EQVKVIY-VCSPNNPTGNLINPADLQAVLALAQGRAIVAI-DEAYIE-FC
HIS8_YERPE      TVPAQADWQDLPAIANNL--EQVKVIY-VCSPNNPTGNLINPADLQAVLALAQGRAIVAI-DEAYIE-FC
HIS8_YERPA      TVPAQADWQDLPAIANNL--EQVKVIY-VCSPNNPTGNLINPADLQAVLALAQGRAIVAI-DEAYIE-FC
HIS8_YERP3      TVPAQADWQDLPAIANNL--EQVKVIY-VCSPNNPTGNLINPADLQAVLALAQGRAIVAI-DEAYIE-FC
HIS8_SALAR      TVPTLENWQDLQGIYDNLDGAKVVF---VCSPNNPTGQLINPQDLRTLLELTRGKAMVVA-DEAYIE-FC
HIS8_LEPIN      STDSVTH--DLNAFLDLAKLIRPKIIFLCTP-SNPAGDALSKSDVYEFLSKISLDTLVVI-DAAYME--F
HIS8_LEPIC      STDSVTH--DLNAFLDLAKLIRPKIIFLCTP-SNPAGDALSKSDVYEFLSKISLDTLVVI-DAAYME--F
HIS8_KLEP3      TVPTADWQLDLPGIEAQLDGVKVVF---VCSPNNPTGQIIDPQSIRDLLEMTRDKA-IVVADEAYIE-FC
HIS8_BLOFL      MIPTKKNWQDLSSIQSQLNNVK---LIYICNPNNPTGNIIYLHSLKKLLKIIQNKALLVCD-----EAYI
HIS8_RHISN      EIKWGES--SLLPIHELLPAKQAKFI-LLANPNNPTGTFVPIADIESLVALSDQ---LVVLDEAYVDFAP
HIS8_PSEE4      QVELDEQFQI-----QVSDYSKPNAGIIFPNPNAPTGCLLPLEAVEQLLQ--ANRDSVVVVDEAY--IDF
HIS8_ESCF3      TVPTLENWQDLQGISD--KLDGVKVVY-VCSPNNPTGQLINPQDFRTLLELTRGKA-IVVADEAYIE-FC
HIS8_ECOUT      TVPTLDNWQDLQGISD--KLDGVKVVY-VCSPNNPTGQLINPQDFRTLLELTRGKA-IVVADEAYIE-FC
HIS8_ECOSE      TVPTLDNWQDLQGISD--KLDGVKVVY-VCSPNNPTGQLINPQDFRTLLELTRGKA-IVVADEAYIE-FC
HIS8_ECOLI      TVPTLDNWQDLQGISD--KLDGVKVVY-VCSPNNPTGQLINPQDFRTLLELTRGKA-IVVADEAYIE-FC
HIS8_ECOLC      TVPTLDNWQDLQGISD--KLDGVKVVY-VCSPNNPTGQLINPQDFRTLLELTRGKA-IVVADEAYIE-FC
HIS8_ECOL6      TVPTLDNWQDLQGISD--KLDGVKVVY-VCSPNNPTGQLINPQDFRTLLELTRGKA-IVVADEAYIE-FC
HIS8_ECOL5      TVPTLDNWQDLQGISD--KLDGVKVVY-VCSPNNPTGQLINPQDFRTLLELTRGKA-IVVADEAYIE-FC
HIS8_ECOHS      TVPTLDNWQDLQGISD--KLDGVKVVY-VCSPNNPTGQLINPQDFRTLLELTRGKA-IVVADEAYIE-FC
HIS8_ECODH      TVPTLDNWQDLQGISD--KLDGVKVVY-VCSPNNPTGQLINPQDFRTLLELTRGKA-IVVADEAYIE-FC
HIS8_ECOBW      TVPTLDNWQDLQGISD--KLDGVKVVY-VCSPNNPTGQLINPQDFRTLLELTRGKA-IVVADEAYIE-FC
HIS8_ECO8A      TVPTLDNWQDLQGISD--KLDGVKVVY-VCSPNNPTGQLINPQDFRTLLELTRGKA-IVVADEAYIE-FC
HIS8_ECO27      TVPTLDNWQDLQGISD--KLDGVKVVY-VCSPNNPTGQLINPQDFRTLLELTRGKA-IVVADEAYIE-FC
HIS8_ECO24      TVPTLDNWQDLQGISD--KLDGVKVVY-VCSPNNPTGQLINPQDFRTLLELTRGKA-IVVADEAYIE-FC
HIS8_CHLL2      SVPMQPSDFDADSLIERAKQEKVDFI-VLSTPNNPTGKSLASP---DIARIVRECDAIVLVDEAYIEF--
HIS8_ARATH      KVPRNPDSLNVDRIAEVVELEKPKCIFL-TSPNNPDGSII---SEDDLLK-ILEMPILVVLDEAYIEFSG
HIS82_NITEU     AVPARNYGHDLEAMLAAVTPETR--IIFIANPNNPTGTLCDARDLLRFMERVPQDVLVIL-DEAYDE-YL
HIS82_MANSM     TVPLTEDFQDLPEIEKNLAGVKVIF---VCSPNNPTGNVLNQADLIRLLDITAGSAIVVV-DEAYIEF--
PDXR_CORGL      DVPTDESGLVPRALPHDLNA-----LLVTPSHQYPYGGSLPADRRTALVAWAEANDALLIEDDFDSELRY
HIS8_LYSSC      KIPCVEGAHDLEAMAAAIDDQTAVIWVCSPN--NPTGVVIPDTALRAFLAKVPNDVLVVL-DEAYIEYVT
HIS8_AERHH      EQPTTSRQPDWPAIADRLSDVK---LVFLCSPNNPTGDLVGRDGLIALLEKARDRAIVVV-DEAYIE-FC
Y3073_RHOS4     PVAMDEQGILPEAFEAVCRERAPKLLYLIPSIDNPTTATLPXXXXXXXXXXXXXHGVLLIEDDPY-----
HIS8_YERPS      TVPAQADWQDLPAIANNL--DQVKVIY-VCSPNNPTGNLINPADLQAVLALAQGRAIVAI-DEAYIE-FC
HIS8_YERPB      TVPAQADWQDLPAIANNL--DQVKVIY-VCSPNNPTGNLINPADLQAVLALAQGRAIVAI-DEAYIE-FC
HIS8_VIBFM      TVPLTSDWQDLPAIEASLENVKVVF---VCSPNNPTGNIVDRKDILSLLEMTKDRAIVVM-DEAYIDFCM
HIS8_SHISS      TVPTQDNWQDLQGISD--KLDGVKVVY-VCSPNNPTGQLINPQDFRTLLELTRGKA-IVVADEAYIE-FC
HIS8_YERE8      TVPTKADWQDLPAIKASLDRVK---LIYICSPNNPTGNLINPADLRAVLELAQGRAIVAI-DEAYIE-FC
HIS8_PSEPK      QVALDEQ-----FQIRIEDYKKPNAGIIFPNPNAPTGCLMPLQAVEELLQ--ANRDSVVVVDEAY--IDF
HIS8_KLEP7      TVPTADWQLDLPGIEARLDGVKVVF---VCSPNNPTGQIIDPQSMRDLLEMTRGKA-IVVADEAYIE-FC
HIS8_CITK8      TVPTLENWQDLRGIADKLDGVKVMF---VCSPNNPTGQLINPQDLRTLLEMT-RGNAIVVADEAYIE-FC
HIS8_VIBHB      TVPLTSDWQELAGIEANLDNVK---LVFVCSPNNPTGNLVKREDIVSLLEMTKDRAIVVM-DEAYID-FC
HIS8_PYRFU      DIPLKEDF-TIDG-ERIAEEGKAASAIFIASPNNPTGNSQP----ENEVLKVLDSGRVVILDEAYSE-FS
HIS8_PSEPW      PVALDEQ-----FQIRVEDYQKPNAGIIFPNPNAPTGCLLPLQAIEQLLQ--ANRDSVVVVDEAY--IDF
HIS82_PASMU     EIPAKNYGADLDGFLQAIS-DKTKLIYLANP-NNPTGTFLSAGEISQFLNQVPAH-VIVVLDEAYTEFTL
HIS82_BORPE     GVPAGLE-LDLPATLAAIEAHQPKVVFLLPN--NPTGDLWPDAAVRAILDAA--PGLVVL-DEAYQP-FA
PATR_MYCS2      AVALRDHTHDLDAMLAAI-TDRTRLIF-VCNPNNPTSTVVDPGELARFVAAVPPHILVVL-DEAYVE-YI
HIS8_ECO7I      TVPTLDNWQDLQGISD--KLDGVKVVY-VCSPNNPTGQLINPQDFRTLLELTRGKA-IVVADEAYIE-FC
HIS8_BACLD      EVGLLENGHDLDAMLKAIDEQTK--VVWVCSPNNPTGTYESGRNLIRFLEKVPEHVLAVV-DEAYYEYVT
HIS81_IDILO     AVPAVDYGHDLDGMAKAV-TDKTKMIF-IANPNNPTGTFLSTSALKSFLDKIPQH-IIVVLDEAYYEYVP
HIS8_VIBF1      TVPLTSNWQDLPAIEASLENVKVVF---VCSPNNPTGNIVDRKDILSLLEMTKDRAIVVM-DEAYIDFCM
HIS8_SHIB3      TVPTLDNWQDLQGISD--KLDGVKVVY-VCSPNNPTGQLINPQDFRTLLELTRGKA-IVVADEAYIE-FC
HIS8_SERP5      TVAAKQDWQDLPAIADSLDNVK---LIYVCSPNNPTGNLIDANDLRSLLEMAKGKAIVAV-DEAYIEF--
HIS8_PSEP1      QVALDEQ-----FQIRIEDYKKPNAGIIFPNPNAPTGCLMPLQVVEQLLQ--ANRDSVVVVDEAY--IDF
HIS8_PELPB      TVPM---LPDLDDLEAILRTAHDEAVIVISTPNNPTGKSLTFEEVRLIAQ---SSDAIVLVDEAYIEF--
HIS8_NITSB      RSSCYRH--DLEEFYDLYKKHHPDIIHICTP-NNPTGDALDAEYLYSFLDNVQEP--LVIVDGAYMEYAA
HIS8_METTH      AVHANENRLDLESVLDAVD-ESTRLVFLCTP-NNPTGGLID---KKDIRAVLESTDTLVVVDEAYTE-FA
HIS8_ECOLU      TVPTLDNWQDLQGISD--KLDGVKVVY-VCSPNNPTGQLIN-PQDFRILLELTRGKAIVVADEAYIE-FC
HIS8_CHLP8      SVPLNPDSFDVDAIIAAAEREKVDFI-VLSTPNNPAG---KSMSHDEVERIVSTCDAIVLADEAYIEF--
HIS8_CALS8      EIPLKNYTHDLEEFSKHI-NERTRVIW-ICNPNNPTGTIVKKDELYNFIKSVPSE-IAVVVDQAYKE-YI
PATR_RHOSR      KVPTADHGHDLDAMLAAIT-DRTRLIFVCNP-NNPTGTALTKAELERFLDAVPADVLVAL-DEAYFEYNR
HIS8_TOBAC      KVPRNPDSLDVERIAEVVEHEKPKCIFL-TSPNNPDGSIVD----DETLLKILDLPILVILDEAYVEFSG
HIS8_PSEPG      QVALDEQ-----FQIRIEDYNKPNAGIIFPNPNAPTGCLMPLQAVEQLL--LANRDSVVVVDEAY--IDF
HIS8_ENT38      SLDDWQ--LDLPAIADNLDGVKVVF---VCSPNNPTGQIINPQDVRTLLEMTRGKALVVA-DEAYIE-FC
HIS81_PASMU     TVPTADFQLNLPEIERQLTGVKVVF---VCSPNNPTGTLVNRTDLLALLEMTRNKAIVVV-DEAYIEF--
AAT_SULAC       KMKWREDGFSLNLNDLENKITDKTKMVVLNNPHNPTGMVFDPKEIDQLIEIAKSKNLIVLSDEIY-DYFV
HIS8_NICPL      KVPRNPDSLDVERIAEVVEHEKPKCIFL-TSPNNPDGSIID----DETLLKILDLPILVILDEAYVEFSG
HIS8_METPP      GVPTADFELDAAAMLAAVREHRPALTYLAYP-NNPTANLWDDAVIERVVDAVREHGGLVVIDEAYQP---
HIS8_LEPBL      TETVLH---DLNAFLDLAKSIRPKIIFLCTP-SNPIGDALFKSDVYDFLRQIPSNTLVVI-DAAYME--F
HIS8_LEPBJ      TETVLH---DLNAFLDLAKSIRPKIIFLCTP-SNPIGDALFKSDVYDFLRQIPSNTLVVI-DAAYME--F
HIS81_BACC1     EVPLKDGIHDLDALEQVDDKTK---IVWICNPNNPTGTYVEKQKLLSFLESVPKSALVIM--DXXXXXXX
HIS8_ROSCS      AVPRTEQFXXXXXXXXXXXXXXXXKLLFLAAPNNPTG----TPLARTTVERLLDLPIILAIDEAYAE-FA
HIS8_NOVAD      VAPDADYGTDVDALLACV-TERTRVVFL-ANPNNPTGSWLPREEVAR-LHAGLRSDILLVLDGAYAE-YL
HIS8_ECOSM      TVPTLKNWQDLQGISD--KLDGVKVVY-VCSPNNPTGQLINPQDFRTLLELTRGKA-IVVADEAYIE-FC
PATR_STRCO      QVPLTPEVHDLDAMADAIT-DRTRLIFVCNP-NNPTGTVVRRAELERFLDRVPSDVLVVL-DEAYRE-FI
HIS8_DESPS      VIPLKDMHHDLQTILDTV-NEKTRLIF-IDNPNNPTGTYLEPELLIDFINSLPEH-VILVLDEAYVDFMD
HIS8_VIBVY      TVPLTEDWQDLSGIEANLDKVK---LVFVCSPNNPTGNLVKREDIIALLEMTKDRAIVVM-DEAYID-FC
HIS8_VIBVU      TVPLTEDWQDLSGIEANLDKVK---LVFVCSPNNPTGNLVKREDIIALLEMTKDRAIVVM-DEAYID-FC
HIS8_LACPL      SVPTLPN--DHVNFEGLMKAITPHVMVWLCNPNNPTGTVESLAAIEAFVQQVPPETMVLI-DEAYIDFTP
HIS8_STRMK      EVPLSEDGADLDAVIDTARARNAKLVFLCAP-SNPAGSDIALDEVERVAVALRGQALVVV-DEAYVEY--
HIS8_PROVI      RVPKASLDFDVDAIIQSAQEESVDFV-VLSSPNNPTGKSITFDDIRRIASSC---DALVLVDEAYIEFSR
HIS8_HALLT      EYALSPDDGFAQDAETVLSAYGGERIVYLTSPHNPSGSVMPLDEVRAIADATAEETLVVV-DEAYGEFAE
HIS8_SULDN      RTSSQEH--DLDEFYELYKQEKPEIIFICTP-NNPTGDALDAQKIYNFLEKIDNDTLVVV-DAAYMEYAI
DAPAT_MOOTA     FMPLTAANPDLGAIPSDVARRAKLMFINYPN--NPTGAVADLKFFQEVVEFARSYDLIVCHDAAYSEITY
HIS8_METST      YATWNIEENKLD-VDSVLNNDKTKVIFLCTP-NNPTGGLIP---QEDIVRIIEATDALVVIDEAYWE--F
HIS8_GEOKA      EVPLVDGRHDLEAMLAVID-ENTRIVW-ICNPNNPTGTYVNDTELRAFLDRVPRHVLVVV-DEAYYE-YA
HIS8_AZOSE      TVPLDDDRPD----DYLPHGSVAAGGIIFPNPNAPTGRLMPLSDIERIVAGNPQ--CVVVIDEAYVD-FG
HIS81_PSEF5     AVPLDEQ-----FQIRVADYARPNGGIIFPNPNAPTGCLLALDAVEQILKASPDS--VVVVDEAY--IDF
HIS8_LISIN      EIPLLQDGEDLEGMLNAI--DEKTTIVWICNPNNPTGNYIELADIQAFLDRVPSDVLVVL-DEAYIEYVT
HIS81_LEGPL     ECPLDRRTNTLDQIENSWKPNCKVIMFCSPN--NPTGNLVDLNLIAKTCELYTNQSIIVV-DEAYIEF--
HIS8_ACEPA      NVPLTD-----DMQVNVADYAGPCSGVVVANPNAPTGIALDLADVRKLLELQPNR--VVLIDEAYVD--F
AAT_PYRKO       R--------EVEVIKTTLERWIPRVLIIINYPNNPTGRVLSGKEIRGLLDVAEENGVKVLSDEVYAELSF
HIS8_XANCB      EVPLGADGADVPVIVQAALDAKAKLVFLC-SPSNPAGSAIPLAEIEVALQALQGKAVVVV-DEAYGEF--
HIS8_GEOSW      EIPLVDGRHDLEAMLNAID-EQTRVVW-ICNPNNPTGTYVNEQELTSFLERVPSHVLAVL-DEAYYE-YA
HIS8_DESHD      XXXXXXXXXSRDFVEGILKAAAQPQVHMIVNPNNPTGTLFP---REEILRIVAESGKIVIVDEAYGE-FS
HIS8_BUCSC      QIPLLNHSWQLDL--KVIKKCINNFLIYLCNPNNPTGSLINFRDVLALLKMTYGKSLVII-DEAYIEF--
HIS81_PSEPF     AVP-------LDAQFRINPADKPNGGIIFPNPNAPTGCLLALEAVEQILKGSPDS--VVVVDEAY--IDF
PATR_STRGG      KVPLTDEVHDLDAMAEAIT-DRTRLIFVCNP-NNPTGTVVRRAELERFLDRVPSDVLVVL-DEAYKE-FI
HIS8_BUCAP      EIPTFKNTWKIDLLNIRSNLNKVKLIY-ICNPNNPTGNIVSQEDLKSLLKVTLGQSLVII-DEAYIEFSP
HIS8_BACCN      EVPLKDGIHDLDALEQVDYNTR---IVWVCNPNNPTGTYVEKQKLLSFLENVPKSSLVIM--DXXXXXXX
HIS8_AERS4      EQPTACRQPDWPAIADRLSDVK---LVFLCSPNNPTGDLVGRDGLIALLEKARNRAIIVV-DEAYIEF--
HIS82_BACAN     EVALNNGVYDLDEISSVVDNDTKIVWICNPN--NPTGTYVNDRKLTQFIEGISENTLIVI-DEAYYE-YV
DAPAT_DESVM     FIPLVEENPDLDAIPAATW-DRAKMIFV--NYXXXXXXXXXXRAYEKLIGICRKHNVIIAHDTAYTEVYY
HIS8_MACCJ      SIPLKEGKFDLESFKDKMNDETSIIWICNPN--NPTGTYVTETELTGFLESVHE-DVMVVLDEAYFEFVL
HIS8_HALMA      EYTLSKADDFAQTADTVLKDYDGERIVYLTSPHNPTGAEFTTDAVRTIAEETDEQTLVVV-DEAYGEFTE
HIS8_AKKM8      EVPNKEDWTDLDGFLAAI-TENTRVVF-ITNPTNPVGTVVGQQEIDDFMAKVPEHVLVVF-DEAYREF--
HIS81_LEGPH     ECPLDRRTNFRLTLDQIENSWKPNCIIMFCSPNNPTGNLVDLNLIAKTCELYANQSIIVV-DEAYIEF--
DAPAT_DESDA     YLPCIKENPDFPAV-------RPDMIYLCYP-NNPTGTVLSRAALQGWVEYARREGCVILYDSAY-EAFI
HIS8_PSEU2      TVP-------LDEQFQIRAEDRPNAGIIFPNPNAPTGCLLGLDKVEQIIKASPDS--VVVVDEAY--IDF
HIS8_LISMF      EIPLLVDGADLDGMLNAIDDNTTIVWVCNPN--NPTGNYIDLADIQAFLDKVPSDVLVVL-DEAYIEYVT
HIS8_GEOTN      EVPLVDGRHDLEALKEIDENTR---IVWVCNPNNPTGTYVNETELRAFLDRVPSHVLVVL-DEAYYE-YV
HIS8_SYNJB      RVPRDPEALDLERCQQAL-REHPIRVVCLVDPNSPTGGLTA--AEWEWVEGLPEEILVILD-----EAYF
HIS8_ROSDO      VAPEKDRTVDIDAIIDRLT-PATRLVY-IANPANPTGTAIGLEALRRLAQSVPPTSLLVL-DGAYAEFFE
HIS8_PHOPR      TVPLTPEWQDLPSIQNNLDGVK---LVFVCSPNNPTGNVMNRRDIEKLLDMTTDKALVVI-DEAYIDFCL
HIS8_LISMC      EIPLLVDGADLDGMLNAIDDNTTIVWVCNPN--NPTGNYIDLADIQAFLDKVPSDVLVVL-DEAYIEYVT
HIS8_HAEIG      TVPLTDDF-QLN-LPEIKNHLNDVKVVFVCSPNNPTGNLLKQSDILDLLQITAGKAIVVV-DEAYIE-FC
HIS8_HAEIE      TVPLTDDF-QLN-LPEIKNHLNDVKVVFVCSPNNPTGNLLKQSDILDLLQITAGKAIVVV-DEAYIE-FC
HIS8_BUCDN      EVPTIKNTWQLDLLNIKLNLNSVKLIYICNP-NNPTGSTCSKKDLFDLLEMTLNTSLVVV-DEAYIEF--
HIS8_BACSU      EIALRPDGSDLDAMLEAIDEQTQ--VVWICSPNNPTGTYTSEGELLAFLERVPSRVLVVL-DEAYYEYVT
HIS82_BACCZ     EVALNNGVYDLDEISSVVDNNTKIVWICNPN--NPTGTYVNDRKLTQFIEGISENTLIVI-DEAYYE-YV
HIS81_HAEIN     TVPLTDDF-QLN-LPEIKNHLNDVKVVFVCSPNNPTGNLLKQSDILDLLQITAGKAIVVV-DEAYIE-FC
1A112_ARATH     -IPVHCRSSDVSALEQALNQARKRILFSNPS--NPVGNILSRETLCDILRFAQEKNIHVISDEIFAGSVY
PATR_NOCFA      QVPLSPDYXXXXXXXXXXVTEHTRLIF-VCNPNNPTGTAHGRAALERFLDAVPAHVLVVLDEAYYEYMRL
HIS8_XANAC      DVPLGPDGADIPAIVAMALSSNAKLVFLC-SPSNPAGSAIALDQIEQALQALQGKALVVV-DEAYGEF--
HIS8_LISW6      EIPLLADGEHLDAIDE------KTTIVWICNPNNPTGNYIELADIQAFLDKVPSDVLVVL-DEAYIEYVT
HIS8_LISMH      EIPLLVDGADLDGMLNAIDDNTTIVWVCNPN--NPTGNYIDLADIQAFLDKVPSDVLVVL-DEAYIEYVT
HIS8_DEHSC      NVPRDASYXXXXXXXXXXXTPQTKLIF-IAAPNNPTG----TAISKEEIRQILDLGVPTVVDEAYYE-FT
HIS8_DEHSB      NVPRDASYXXXXXXXXXXXTPQTKLIF-IAAPNNPTG----TAISKEEIRQILDLGVPTVVDEAYYE-FT
HIS8_BACNA      EIALRPDGSDLDAMLEAIDEQTQ--VVWICSPNNPTGTYTSEGELLAFLERVPSRVLVVL-DEAYYEYVT
HIS8_ALISL      TIPLTSEWQDLPSIERNLDNVK---LVFVCSPNNPTGNVINRKDILSLLEMTKDRAIVVM-DEAYIDFCM
HIS82_DECAR     TLPLADDF----SINPADYCDRPNGGIIFPNPNAPTGRLLPLDAIEQMLKANPDS--VVVVDEAYVD--F
HIS81_LEGPA     ECPLDRRTNTLDQIENSWKPNCKVIMFCSPN--NPTGNLVDLNLIAKTCELYANQSIIVV-DEAYIEF--
HIS8_ROSS1      PVPRTDQDVDIXXXXXXXXXXXXKLLFLAAP-NNPTG----TPLARSDVERLLDLPIILAIDEAYAE-FA
HIS8_PSESM      PVYCGLYGIDYEALDEQFQYARPNAGIIFPNPNAPTGCLLGLDAVEQIIKASPDS--VVVVDEAY--IDF
HIS8_DEHE1      NVPR-DAGYDVNGIKNALTPKTK--LIFIAAPNNPTG----TAISKEDIRQILDLGVPTVIDEAYYE-FT
PATR_MYCTU      QVPLTDHTFDLYAMLATVT-DRTRLIFVCNP-NNPTSTVVGPDALARFVEAVPAHILIAI-DEAYVE-YI
PATR_MYCTA      QVPLTDHTFDLYAMLATVT-DRTRLIFVCNP-NNPTSTVVGPDALARFVEAVPAHILIAI-DEAYVE-YI
PATR_MYCBT      QVPLTDHTFDLYAMLAAVT-DRTRLIFVCNP-NNPTSTVVGPDALARFVEAVPAHILIAI-DEAYVE-YI
PATR_MYCBP      QVPLTDHTFDLYAMLAAVT-DRTRLIFVCNP-NNPTSTVVGPDALARFVEAVPAHILIAI-DEAYVE-YI
PATR_MYCBO      QVPLTDHTFDLYAMLAAVT-DRTRLIFVCNP-NNPTSTVVGPDALARFVEAVPAHILIAI-DEAYVE-YI
HIS8_LISMO      EIPLLTDGADLEGMLNAI--DEKTTIVWICNPNNPTGNYIDLADIQAFLDKV-PSDILVVLDEAYIEYVT
HIS8_BACP2      DGGAHDLKGMLDEIDENTK------VVWVCNPNNPTGNHLSESELVAFLDQVPAHVLVVL-DEAYVE-YV
ALAT_SCHPO      YSLSEENNWDIDSFDEASKKGINVRLCVVINPGNPTGACISENSMEKVLRFAKAKGIVLLADEVYQ----
AAT2_METJA      DF-------TVESLEEALSDKTKAIIINSPS--NPLGEVID----REIYEFAYENIPYIISDEIYNGLVY
HIS8_METM5      WAKFDEENGFKLDVESVLNNEKTKVIFLCTP-NNPTGNVIPTEDIKKIVE---STDALVMIDHAYIEYSK
HIS81_HAEI8     SVPLTDDF-QLN-LPEIKNHLNDVKVVFVCSPNNPTGNLLKQSDILDLLQITAGKAIVVV-DEAYIE-FC
HIS81_BACCR     EVSLKDGIHDLDAMLEQVD-EKTKIVW-ICNPNNPTGTYVEKQKLLSFLESVPKSALVIM--XXXXXXXX
HIS81_ANAVT     EIPY-QENNVLPVAELIAADGAVTF---IASPNSPSGHIVP---NDDLRKLASELSGVLVIDEAYVD--F
HIS8_XANC5      DVPLGPDGADIPAIVARALASNAKLVFLC-SPSNPAGSAIALDQIEQALQALQGKALVVV-DEAYGEF--
HIS8_STAS1      QVPLQNGEFDLDGILSEIDNDTKLVWLCNPN--NPTGRYFTHDALRNFLERVPSH-IPVIVDEAYVE--F
HIS8_CHLPD      FVPLPGLAFDADAIIRKAGEERVDFI-VLSTPNNPTGMSL---ASEEVCRIAEAADALVLVDEAYIEF--
HIS81_BACHK     EVSLKDGIHDLDAMLQQVDDQTK--IVWICNPNNPTGTYVEKQKLLSFLESVPKSALVIM--DXXXXXXX
HIS81_BACAN     EVSLKDGIHDLDAMLQQVDDQTK--IVWICNPNNPTGTYVEKQKLLSFLESVPKSALVIM--DXXXXXXX
PATR_RHOE4      KVPLTEDGHDLDAMLAAIT-DRTRLIFVCNP-NNPTGNALSKAELESFLDAVPAH-VVVALDEAYFEYSR
PATR_PROAC      PVPLTVDRHDLDAMADAIT-DRTRVIFLCTP-NNPTGTVLHTDEVVEFLARVPEN-VVVVMDEAYCHFNR
HIS81_BACCZ     EVSLKDGIHDLDAMLQQVDDQTK--IVWICNPNNPTGTYVEKQKLLSFLEAVPKSALVIM--DXXXXXXX
HIS8_HELHP      KTPSDEH--ILEEFFQLYQSEKERSAVFLCAPNNPLGECLDAAAIEQFIQAVDKDTLVIV-DGAYQEFAA
HIS8_GEOSF      TFGLTEDW----KLKDFPKIYEGRIFFL----TNPNAPLGFTFSQTYIEELAGRVSGTLVIDETYADF--
HIS8_BAUCH      AIQALDNWQDLDTIYAQL--DCVKLIYICHP-NNPTGNIINPSDIRQLLDITHGRTILVV-DEAYIDFY-
HIS8_STAHJ      QVPLLNGGFDLENIIKEVDEETALVWLCNPN--NPTGTYFNHDELESFLERVPSHVPVLI-DEAYFEFVT
HIS8_NEIMB      GVPLGDFTLNLPAVLEAVRKHRPALTFIAYP-NNPTGVCF---TRAEIEAVIEASDGIVVVDEAYGA-FN
ATTY_RAT        LLPEKSWEIDLKQLESLIDEKTACLVVNNPS--NPCGSVFSKRHLQKILAVAERQCVPILADEIYGDMVF
ATTY_DICDI      LLEKQGFNVDLEHLRSLIDDKTKAILVNNPS--NPCGIVYSKQHLLDIIQVAREYCLPIIADEIYSDLTF
PATR_STRAW      QVPLTPDVHDLDAMADAIT-DRTRLIFVCNP-NNPTGTVVRRAELERFLDRVPSDVLVVL-DEAYRE-FI
HIS8_CHRSD      SVALDDQRVPLTAFD----TDNGGIVFANPN--APTGHGHSRDAIAALLERNTES--VVLVDEAYVD-FG
ATTY_HUMAN      LLPEKSWEIDLKQLEYLIDEKTACLIVNNPS--NPCGSVFSKRHLQKILAVAARQCVPILADEIYGDMVF
ATTY_BOVIN      LLPEKNWEIDLKQLESLIDEKTVCLIVNNPS--NPCGSVFSRRHLQKILAVAARQCVPILADEIYGDMVF
HIS8_PARDP      QVAERDRVTDIDAL---IAGATPRTLIFVANPNNPTGTMVGLPELERLARAVPQAILVV--DAAYAE-YV
HIS8_NEIMF      GVPLGDFTLNLPAVLEAVRKHRPALTFIAYP-NNPTGVCF---TRAEIEAVIEASDGIVVVDEAYGA-FN
HIS8_NEIMA      GVPLGDFTLNLPAVLEAVRKHRPALTFIAYP-NNPTGVCF---TRAEIEAVIEASDGIVVVDEAYGA-FN
HIS8_NEIM0      GVPLGDFTLNLPAVLEAVRKHRPALTFIAYP-NNPTGVCF---TRAEIEAVIEASDGIVVVDEAYGA-FN
HIS81_PSYA2     EVPAQRFGHDLKAMSQAIENNSNTKIVFIANPNNPTG--TQLEGELREFXXXXXXXXXXXXDEAYIE-YS
HIS81_METCA     TVPLTESFEI--RIEDYL---RPNGGVVFPNPNAPTGRLLPLADIETLLSK--NRDSVVIVDEAYID--F
HIS8_LACF3      EVPVNPATGHFDFAGALAVINEATRLVWICNPNNPTGVLESPQAIEDFVRQVPKDTLVFI-DEAYLDFAD
ATTY_MOUSE      LLPEKSWEIDLKQLESLIDEKTACLVVNNPS--NPCGSVFSKRHLQKILAVAERQCVPILADEIYGDMVF
ALAM_YEAST      PYYLDENSTNPEEIETVVKEAKPTVLVVINP-GNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIF
1A16_ARATH      PVTCHSSNGTVEALEAAYENARKSNILLVTNPSNPLGTTLDRECLKSLVNFTNDKGIHLIADEIYAATTF
HIS8_CAMC1      TKSVEHNLSEFLEIYNAHKDEISVIFLCLPN--NPLGECIDADEVYKFIKNIDENTLVVL-DCAYNEFAF
HIS82_IDILO     LLNSGEVNNWQLDTESIIEAAAECKVIFLCSPSNPLGNALNTDDIEQVLQH-SPRSIVVV-DEAYIEFSS
HIS81_CARHZ     VSYRDDFSLDLDETKKAIEKYQPHLVFL-ANPNNPTGTLVDIETIKKLLAY----DHLLVVDEAYVE-FS
AVTA_ECOLI      LLPEGQFKYHVDFEHLHIGEETGMICVSRPT--NPTGNVITDEELLKLDALANQHGIPLVIDNAYGVPFP
HIS8_SULSO      KVNLKEDNEWKENTDDLLAQAEKVELVIIDDPNNPTGS-PMLNGKKELIGQLAEKGFVVI-DEAYYE-FG
HIS8_MYCSS      ALRADDFGLDVDTAVREIAARRPDLVF-VTSPNNPSGQSVPLEDLRRLLD-AMETGILIL-DEAYGEF--
HIS8_MYCSK      ALRADDFGLDVDTAVREIAARRPDLVF-VTSPNNPSGQSVPLEDLRRLLD-AMETGILIL-DEAYGEF--
HIS8_MYCSJ      ALRADDFGLDVDTAVREIAARRPDLVF-VTSPNNPSGQSVPLEDLRRLLD-AMETGILIL-DEAYGEF--
HIS8_METMP      WAKFDEENGFKLDVESVLNNEKTKAIFLCTP-NNPTGNVIPTEDIKKIVE---STDALVMIDHAYIEYSK
HIS8_BUCMH      EVPLLNFSWQLD-INNIAKYISDAKLIYICNPNNPTGNLINYQDIITLLNITLGKTLVIV-DEAYIEF--
DAPAT_SYNY3     TGDANEKGEYGGLVYLPISAEND-FVAAIPSKKNPTGATATKAYLKQWVDYALAHGSIIFFDAAY-EAFI
DAPAT_NATTJ     SMPLKQDNGFIPELESIPQSRLSKGKIVFMNYNNPTSAVASKDFYSHAVKFCQKNKLLLCNDAAYSEIAF
HIS8_METVS      WAKFDKEKDFKLDVESVLNNEKTKAIFLCTP-NNPTGNVI---SNEDIKKIIESTDALIMIDHAYIEYSK
HIS8_GEOSL      TFGLTD---DLRIAGFPGRYEGKLFFLTTPN--SPLGFAFPL---AYIEELATRCAGVLVVDEAYADFAD
HIS8_DINSH      EVPERERVTDVDALAGVTDRTR---LVFIANPNNPTGTMIGGNALARLADGLPE-GCLLVLDGAYAE-YV
CBL_BACSU       HNPLGAYAIDFEDLETKLS-DPSVTLFILCNPHNPSGRSWSREDLLKLGELCLEHGVTVVSDEIHSDLLY
AAT_RICBR       FANCGIESNSGEALEQLITPKTKWLIINSPS--NPTGASYSHSELKNIAEVLRKHPYVVMSDDIYEHITF
HIS8_PELCD      TFLLDEGW----ALKDFPERYTGK-LFFLTNPNAPLGFCYPQEFIEELAGRV--DGMLVV-DEAYADF--
HIS8_NEIG2      GVPLGDFTLNLPAVLEAVRKHRPALTFIAYP-NNPTGVCF---TRAEIEAAIEASDGIVVVDEAYGA-FN
HIS8_NEIG1      GVPLGDFTLNLPAVLEAVRKHRPALTFIAYP-NNPTGVCF---TRAEIEAAIEASDGIVVVDEAYGA-FN
HIS8_HALVO      QYEVSKDDDFEQTADLVLDAYDGERMVYLTTPHNPTGSVLPRXXXXXXXXXXXXHTLLVV-DEAYGEF--
HIS8_HALSA      DVAEGADGFEMTADAVVDAYDGERVVYLTTP-HNPTGARFTLDEIVAVADRTDEDTLVLV-DEAYGE-FT
HIS8_HALS3      DVAEGADGFEMTADAVVDAYDGERVVYLTTP-HNPTGARFTLDEIVAVADRTDEDTLVLV-DEAYGE-FT
HIS82_THIDA     AIPLD------DAFERVDDYLAPKGGVIFPNPNAPTGRLLALGEIERLL--AANRDSVVVIDEAYVD-FG
HIS82_CAUCR     DVPR-LANFDIDVPAVCAAAALGPKLLVLCTPNNPTGNALKAADFQAIL-AATPRSTVVFVDEAYREYH-
COBD_THETN      KLEE-EEGFRVNFAKVISKIEEADGL-ILGNPNNPTGQGIIREEIGILLKKAELMNIPVLIDEAFIEFMK
HIS8_PSEA6      GIERAGLNDDFSLNVDAIKAFKGKVLVFICSPNNPTGTSVD---KNQLLEVVFADSAIVVIDEAYIEFDK
HIS8_MYCUA      TARADGFGLDIDAAIAVVSDRRPDVVF-ITSPNNPTGQSVSLTELRRLLDVV--PGILIV-DEAYGEF--
HIS8_METM7      WAKFDEENEFKLDIESVLNNEKTKAIFLCTP-NNPTGNVIPTEDIKKIVE---STDALVMIDHAYIE-YS
HIS8_METJA      YAKYDKEKDFKLNVESVLNNDKTKVIFLCTP-NNPTGNII---ENRDVERVINETDALVVIDHAYIEYAK
HIS8_XANC8      EVPLGADGADVPAIVQAALDAKAKLVFLC-SPSNPAGSXXXXXXXXXXXXXXXGKAVVVV-DEAYGEF--
HIS8_STRMU      EIPLAE---DFTINTEDYLADNGGIILTNPN--APTGIYKPLNEIEKLLK--ANQDTVVIIDEAY--ISF
HIS8_POLNA      GV---DLTPDFEAMLAAIAEHKPSITYLAYP-NNPTANLWDDAVIENIINAVGEQGGLVVIDEAYQP---
AAT_RICFE       FVNCGIENNSAEALERSI-TDKTKWL-IINSPSNPTGASYNFEELENIAKVLRKYPHVVMSDDIYEHITF
AAT_RICCN       FVNCGIENNSAEALERSI-TDKTKWL-IINSPSNPTGASYNFEELENIAKVLRKYSHVVMSDDIYEHITF
HIS8_MESSB      VAREKDERADVDAILAAVT-ERTKIVFLANP-NNPTGTYLPMEEVKR-LRSGLPRKVLLVLDAAYAE-YV
HIS8_CAMC5      TRSQEHDLAEFLEIYEAHKDEISVIFLCLPN--NPLGECLDTKEVYEFLKRIDEDVLVVL-DCAYNEFAF
HIS8_ARCB4      AIKTNSEQHNLEEFSELYKKHGADIIFLIPN--NPLGECLDKNDVYEFLKTIDKNTLVVV-DGAYQEYAA
HIS81_RALSO     GVPLRADLTDREAMLAAMAEHQPAVIYLAYP-NNPTGNLFXXXXXXXXXXXXXGQSLVVV-DEAYQP-FA
HIS81_BRAJA     EVPL-----DAAMRIEIADYRRPSSAILLCNPNAPTGIALPRDAVAALLAENPDR--LVVVDEAYVD-FG
DAPAT_PROMS     AI--NEANNFLPELPE----KKVDILYLFPN--NPTGATINKEELKKWVDYALQNKSLILFDAAY-EAFI
Y1479_METJA     LDPYNYWYPDIDDLEKRIKYNPAVSGILVINPDNPTGAVYPKKILNEIVDLANEYDLFIICDEIYCNLVY
PATR_MYCMM      QVPLTNHTFDLEALAAVTERTR---LIIVCNPNNPTSTVVQPEALAEFVRSVPPHILVAI-DEAYVE-YL
HIS8_MYCMM      TARADGFGLDIDAAIAVVSDRRPDVVF-ITSPNNPTGQSVSLTELRRLLDVV--PGILIV-DEAYGEF--
HIS81_RHILO     RVTVNDDTINADALIDAV-RERPRML-LFSNPMNPVGSWLSAGDLSKVLDAVSDETLIVVXXXXXXXXXX
HIS81_GLUOX     AIPMTADARDLPQLHQAVTSD-PLKVLMFSNPSNPVGCLMTGDAMQSLIDACPADTLIVI-DEAYWEYAR
PATR_MYCUA      QVPLTNHTFDLEALAAVTERTR---LIIVCDPNNPTSTVVQPEALAEFVRSVPPHILVAI-DEAYVE-YL
KAT1_HUMAN      SIQNGELGSQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMHI
HIS8_GLUDA      PVPLD------DAMRDVDDYRRPCAGLVLPNPNAPTGIALGLGQIETLLRAQPDR--VVVIDEAYVD-FG
HIS81_CAUCR     EVRMAKEVNHRVDIDEVIKDERTRLVF-IANPANPTG--TWLTGEERALHAALPPSVVLVLDGAYAE-FC
DAPAT_CLOPH     NVPCTKENKFVPSLPA----ETPDIIYLFPN--NPTGSAITKMKLQKWVDYAIEKGAVIIYDAAY-EAYI
HIS8_STRGC      EIPLTA---DFEVHPSDYFGDNGGIILANPNA--PTGIYLPLKQLEEIL--ASNQDAVVVVDEAYIN-FG
HIS8_BEII9      VVPEKDLTTDVDAILAAV-TPRTRIVY-IANPNNPTGTYLPFAEVKRLATSLPPNVLLVL-DAAYGE-YV
HIS81_PSEAE     PVYCGLYGHEKIALDEVEDYARPNGGIIFPNPNAPTGCLLPLDAIEAMLKASPDS--VVVVDEAYVD-FG
HIS8_STRSV      EIPLTD---DFEVHPSDYFGDNGGIILANPNA--PTGIYLPLEQLEEIL--ASNQDVVVVVDEAYIH-FG
HIS8_CLOBK      PVYA-----NLYKLDYKLAKIREDFSIDINDFKNPTGVYLSLDSIKQILEDNVNK--VVIVDEAYID--F
HIS8_CLOBH      PVYA-----NLYKLDYELAKLREDFSIDIEDFKNPTGLYLSLDSIKQILEDNINK--VVMVDEAYID--F
HIS8_CLOB1      PVYA-----NLYKLDYELAKLREDFSIDIEDFKNPTGLYLSLDSIKQILEDNINK--VVMVDEAYID--F
AAT_RICTY       FVNCGIENNTVEALERSI-TDKTKWL-IINSPSNPTGAGYNCKELENIAKTLRKYPNVIMSDDIYEHITF
PATR_CORJK      GVPLKSGRHDLKAMSEAI-GERTRLVF-VCNPNNPTGTTVSRDEFREFMGRV-PADVTVVLDEAYVE-YN
HIS8_CLOBL      PVYA-----NLYKLDYKLAKLREDFSIDIEDFKNPTGLYLSLDSIKQILEDNINK--VVMVDEAYID--F
HIS8_CLOAB      LIPLKEDSLDLDNFC------RCNGGVIIPNPNAPTAKYIGLSDIKKILDW--NKDSVVIIDEAYID-FG
HIS82_CARHZ     EIPLKEHRLDLKTMAEAV-NEKTRLVYLC-NPNNPTG---------------------------------
HIS82_BURS3     NVPLADDFSIRDYLDDAGG-------VLFPNPNAPTGRALPLADVERI--VAANPSSVVVIDEAYVD--F
MTNE_BACSU      MMPLVKDRPDYSSITAEI-REQAKLMYLYPN--NPTGAVATSEFFEDTVRFAAENGICVVHDFAYGAVGF
HIS8_VESOH      LLTDDFEIDD-DTMQKAIKTYNPKLIFIAYP-NNPTGNMFN---REIIEHIISSTKAMVVLDEAYYA-YT
HIS8_RHOBA      QVPFNDPWELPQSFGE--NREDLK-LVLLPNPNSPSGTIVSKP---QIAELSNSLNCPLVVDEAYAD--F
HIS8_DESVV      EFRQADLRPDFDWDAFLAATDENTAIAFVTTPDNPSGWCPPVSELEHVARTLPPSCLFVI-DEAYMD-FC
HIS8_DESVH      EFRQADLRPDFDWDAFLAATDENTAIAFVTTPDNPSGWCPPVSELEHVARTLPPSCLFVI-DEAYMD-FC
ALA2_PANMI      DEKTGW-GLEISDLKKQLEDARSKGILVVINPGNPTGQVLAEDNQCDIVRFCKNEGLVLLADEVYQEIYV
AAT_RICPR       FVNCGIENNSVEALEHSI-TDKTKWL-IINSPSNPTGAGYNCKELENIAKTLRKYPNVIMSDDIYEHITF
HIS8_XANCP      EVPLGADGADVPAIVQAALDAKAKLVFLC-SPSNPAGSXXXXXXXXXXXXXXXGKAVVVV-DEAYGEF--
HIS8_STRAW      SGPRGEDFTDLAAARQAIAESRPDVVF-ITTPNNPTGTAVPPETVLALYEAAQAKPSMVVVDEAYIEFSH
HIS8_RHORT      LAPESDLTADIDAMLAAV-RDTTKLVFLANP-NNPTGTCLPTSEVVRLREGLRD-DIILVVDAAYAEYYD
HIS8_HAHCH      GVPLNDDFQDAQTTLDAIKRHQPALVFIAQP-NNPTGNLFD---DETLRQIVAASPGLVVIDEAYTAFTN
HIS8_GEOUR      TYGLTDDW----KLANFPERYDGKIFFL----TNPNAPYGFTFSREFIEELAGRVAGMLVVDETYAD-FA
HIS8_GEOMG      TF--GLTG-DFRIAGFPERYEGKVFFLTTPN--APLGPSFPLEYIDELARRC--AGMLVL-DETYAE--F
HIS8_CLOB8      NYELVKLDDNFDIPLEELKKTNGGVI--IPNPNAPTGKYINTESLKSLIEANKDR--VVIIDEAYID-FG
CBL_MYCLE       EAPLGRDGRDLAALQDAFSRARRKVAYLLCNPHNPTGSVHTVAELHGVAELARRFGVRVISDEIHAPLVL
ALAT_YEAST      LDEESNWSTNSDEIEKVVKQIRPSVLIVINP-GNPTGAVLSEETIARICLIAAKYGITIISDEVYQENIF
KAT1_RAT        TLPKGKLGAQLDPAELASKFTPRTKILVLNTPNNPLGKVFSRMELELVANLCQQHDVVCISDEVYQWLVY
KAT1_MOUSE      FVPKGQLGSQLDPTELASKFTPRTKILVLNTPNNPLGKVFSKKELELVAALCQQHDVLCFSDEVYQWLHI
HIS8_SILST      EVKERERVTDVDALLAGCTAQTK--LVFIANPNNPTGTMISEAEVARLADGIPEDAILVL-DGAYAEYVE
HIS8_LEUCK      SIPVNQDHVDFDAMFDAVDEHTTMVWLANPN--NPTGVFETRSDILSFLQK-LPQSVVLVVDEAYYD--F
HIS8_DIAST      GVPLTADFEDEAAMLDAIAQHRPAITFLAYP-NNPTATLWDEAVVQRIIDAAGAQGGIVVMDEAYQP-FA
YFBQ_SHIFL      CDESSDWFPDLDDIRAKITPRTRGIVIINPN--NPTGAVYSKELLMEIVEIARQHNLIIFADEIYDKILY
YFBQ_ECOLI      CDESSDWFPDLDDIRAKITPRTRGIVIINPN--NPTGAVYSKELLMEIVEIARQHNLIIFADEIYDKILY
YFBQ_ECOL6      CDESSDWFPDLDDIRAKITPRTRGIVIINPN--NPTGAVYSKELLMEIVEIARQHNLIIFADEIYDKILY
HIS8_PSE14      PVYCGLYGIDYEALDDQFQIRKPNAGIIFPNPNAPTGCLLGLDKVEQIIKASPDS--VVVVDEAYID--F
HIS8_CLOB6      PVYA-----NLYKLDYKLAKLREDFSIDINDFKNPTGVYLSLDSVKQILEDNVNK--VVIVDEAYID--F
HIS8_CAMFF      TKSKEHNLAEFREIYRTNKNDISVIFLCLPN--NPLGECLDADEVFSFIKDVSEDTLVVI-DGAYMEFAK
ALA2_HORVU      NESTGW-GLETSDVKKQLEDARSRGILVVINPGNPTGQVLAEENQYDIVKFCKNEGLVLLADEVYQEIYV
Y286_HAEIN      HYLCDEDAPTIDDIKAKVNAKTKAIVIINPN--NPTGAVYSKELLQEIVEIARQNNLIIFADEIYDKILY
HIS82_GLUOX     HIPLNDDAIDIDAYTGDCGG------IIIANPNANTGIALPLEQIETLLKRHPDRTVII--DEAYVD--F
HIS81_ANASP     EIPYREYN-ILPVADLIAAHGSVTF---IASPNSPSGHVVP---SDDLRKLASELSGVLVIDEAYVD--F
ALAT1_MOUSE     ALDIAELRR---ALCQARDRCCPRVLCVINP-GNPTGQVQTRECIEAVIRFAFEEGLFLMADEVYQDNVY
HIS8_GEOBB      TFGLSESFEP----EGIPEHYDGKLFFL----TNPNAPLGFTYSQRYIADLAGRLSGVLVVDEAYVD--F
HIS8_CHLCH      EVPMKSDSFDVEAIMKAAHNEAVDVIVLXXXXXXXXXXMSYDAVRK----IAESTQALVLVDEAYIEFSR
HIS8_ACISJ      GVPLTADFEDEAAMLAAIAQHRPAITFLAYP-NNPTATLWDEAVVQRIIDAAGAQGGIVVMDEAYQP-FA
DAPAT_LEPBL     YMPATKE----NGFQPEIPKEKADIIYLCYP-NNPTGTVTTKKALRAWVEYAKKNNSIILYDSAY-EAFI
DAPAT_LEPBJ     YMPATKE----NGFQPEIPKEKADIIYLCYP-NNPTGTVTTKEALRAWVEYAKKNNSIILYDSAY-EAFI
AAT_STRGR       EVVADETRVSVEQLEAARTEKTKVVLFVSPS--NPTGAVYSEADAEAIGRWAVEHGLWVMTDE-------
AAT_MYCTU       CDETQGWQPDIADLESKITERTKALVVINPN--NPTGAVYSCEILTQMVDLARKHQLLLLADEIYDKILY
AAT_MYCBO       CDETQGWQPDIADLESKITERTKALVVINPN--NPTGAVYSCEILTQMVDLARKHQLLLLADEIYDKILY
HIS8_UNCMA      ARRA-DFSLDVDA---VLKQDRTKFIF-ITSPNNPTGNLTSLAEIRSVANAV--DGIVFV-DEAYIDFSG
DAPAT_DESAP     TAGNGFL-PDLAAIPAETARRAKVMFINYPN--NPTGAVASKEFFARVVDFAREYGILVCHDAAYSEIAF
CBL_MYCTU       PAPLRGDGRDLDALQEAFXXXXXNVAYLLCNPHNPTGSVHTADELRGIAERAQRFGVRVVSDEIHAPLIP
CBL_MYCBO       PAPLRGDGRDLDALQEAFXXXXXNVAYLLCNPHNPTGSVHTADELRGIAERAQRFGVRVVSDEIHAPLIP
HIS8_RHOPB      IAEEKNLTCDVDAI--LAKVSPSTKLVWLANPNNPTGTYVPFDEVKRLRAGLPEH-VILVLDGAYAD-YV
HIS8_MYCS2      ASRAEDFGLDIDVAVSAVTERKPDVVF-VTSPNNPSGQSVPLDDLRRVLD-AMQGGILIV-DEAYGEF--
HIS8_MARMM      SAPERDYRSDVDAILEA-AGDDTRIVFL-ANPNNPTGTYIS-AAEVRRLRDGLPASTLLVLDAAYAE-FV
HIS8_CAMLR      TPSLTHDLNELYELYQKHKNEIKVIFLCLPN--NPLGECLDASAVFEFLEKIDEDCLVAI-DGAYNEFAS
DAPAT_METTH     --PCTEENSFIPSLPE----ERVDLIYLCYP-NNPTGTTLTEKQLAEWVDYARDSGSLILFDAAY-EAYI
HIS8_FRAP2      TLKLKEENNFEINITELLANDNCKLLFLCTP-NNPTGKSIPLADIEQILS-ELAGNCVVVVDEAYIE-FS
HIS8_ACIBT      EIPLNENF-EID----VRDYTQPNGGVIITNPNAPTSIALSLAEIEQVLQANPDR--VVVIDEAYVD--F
HIS8_ACIB5      EIPLNESF-EID----VRDYTQPNGGVIITNPNAPTSIALSLAEIEQVLQANPDR--VVVIDEAYVD--F
HIS8_ACIB3      EIPLNESF-EID----VRDYTQPNGGVIITNPNAPTSIALSLAEIEQVLQANPDR--VVVIDEAYVD--F
HIS82_ANASP     -VVSVSRNPDLTAAQSAIEQNPPIRVVFVVHPNSPTAN--PLTANERWLKSLSERILVVV-DEAYFE--F
YBDL_ECOLI      RMALQPPHFRVDWQEAALLSERTR-LVILNTPHNPSATVWQQADFAALWQAIAGHEIFVISDEVYEHINF
MALY_ECOLI      VMPVALEKQDMGKLEAVLAKPECKIM-LLCSPQNPTGKVWTCDELEIMADLCERHGVRVISDEIHMDMVW
HIS8_GEOSM      TFGLTESFEP----EGIPEHYDGKLFFL----TNPNAPLGFTYSQRYIADLAGRLSGVLVVDEAYVD--F
HIS8_ACIBY      EIPLNENF-EID----VRDYTQPNGGVIITNPNAPTSIALSLAEIEQVLQANPDR--VVVIDEAYVD--F
HIS8_ACIBC      EIPLNENF-EID----VRDYTQPNGGVIITNPNAPTSIALSLAEIEQVLQANPDR--VVVIDEAYVD--F
DAPAT_SYNS9     TGDAGAEGADNNFSAEIPSEPVDLIYLCFPN--NPTGAVATRAQLKAWVDYARSHNALILFDAAY-EAFI
DAPAT_DESPS     FADGRYQNVYLDSTKEELPTEKVDLIYLFPN--NPTGSTITKAGLKRWVDYAIENKALILFDAAY-EAFI
BNA3_YEAST      YVPIGEEWTDFEQFEKAITSKTKAVIINTP--HNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLYF
1A1C_SOYBN      PVMCDSSNNTKQALEDAYEKAKEDNILLITNPSNPLGTVMDRNTLRTVMSFINEKRIHLVSDEIYSATVF
HIS81_ARCFU     LVRRGENYRIDESIFDAITQKTKIILICNPN--NPTGNAED---AKLIEELVNSTNALIFLDEAYVE---
DAPAT_ARATH     NIEYMRCTPENGFFPDLSTVGRTDIIFFC-SPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAY-AMYM
CSD_CHLPN       KIRVHDSGIDLDDLEKLL-NEGAQFV-SIPHVSNVTGCVQPL----------------------------
1A17_ARATH      PIHCDSSNHTPEALESAYQTARDANIVLITNPSNPLGATVQKKVLEDLLDFCVRKNIHLVSDEIYSGSVF
HIS8_SULTO      RVNLIENDNWWKMFEKFLDEAKNARLVIIDDPNNPTGS-PMLKAEEDKVRALAENGFILIDEAYYEFSGY
HIS8_COLP3      SVPLVNTPEDLEGLKQQVGKAKVVFLC---SPGNPTGNTLSSAQIKAAIEIFKDSAMVVV-DEAYYE-YT
DAPAT_PARUW     RITYMSCLPENNFFPDLANLPKTDLIYFC-SPNNPTGSAATNEQLRELVQFAKKRQSIIIFDAAYASFVR
YDT4_SCHPO      PVSAGAWKLDMNKLRNAITEKTKMIVINTP--HNPLGKIFSEEELNEIADLVLKHNLLVVSDEVYDRLSF
HIS8_MYCSM      ASRAEDFGLDIDVAVSAVTERKPDVVF-VTSPNNPSGQSVPLDDLRRVLD-AMQGGILIV-DEAYGE---
HIS8_LACLA      KVPVDDD-----------------FKVLIKDYCIENGGITALALNLKDIEEILKKNSIVLINEAYID-FG
ALAM_DICDI      LNEEKGWSLEISQLEHVSKGINPRALVIINP-GNPTGQCLDRANMEEIVKFCLEKNVVLLADEVYQEVYV
1A11_ORYSJ      PVHCASANGTRPALDDAYRRAQKRRLVLITNPSNPLGTASPRADLETIVDFVAAKGIHLISDEIYAGTAF
1A11_ORYSI      PVHCASANGTRPALDDAYRRAQKRRLVLITNPSNPLGTASPRADLETIVDFVAAKGIHLISDEIYAGTAF
HIS8_ACIBS      EIPLNENF-EID----VRDYTQPNGGVIITNPNAPTSIALSLAEIEQVLQ--ANPDCVVVIDEAYVD--F
HIS8_ACIAC      AVPLTADFEDEPAMLAAIAQHRPAITYLAYP-NNPTATLWDEGAVQRVIDAAGAQGGIVVMDEAYQ----
HIS82_BURPS     GVPLRADLTDIDAMLAALAEHRPALVYLAYP-NNPTGTLYP-----------------------------
HIS82_BURP1     GVPLRADLTDIDAMLAALAEHRPALVYLAYP-NNPTGTLYP-----------------------------
HIS82_ANAVT     TVSRNPENFEIDAQSAIEQTQNPRVVFVVHP-NSPTAN--PLTTNERWLKSLSEQILVVVD-----EAYF
HIS81_BURMA     GVPLRADLTDIDAMLAALAEHRPALVYLAYP-NNPTGTLYP-----------------------------
DAPAT_DESAH     DCTAENNFPDLP-------QEQVDLIYLFPN--NPTGTTITKPELKRWVDYAHEAKALILFDAAY-EAFI
HIS8_CAMJR      TQSITHDLNEFKKLYEAHKDEIKLIFLCLPN--NPLGECLDASEVTKFIKGVDEDCLVVI-DAAYNEFAS
HIS8_CAMJJ      TQSITHDLNEFKKLYEAHKDEIKLIFLCLPN--NPLGECLDASEVTKFIKGVDEDCLVVI-DAAYNEFAS
HIS8_CAMJ8      TQSITHDLNEFKKLYEAHKDEIKLIFLCLPN--NPLGECLDASEVTKFIKGVDEDCLVVI-DAAYNEFAS
1A1C_PHAAU      PVMCDSSNNFVEALEDAYEKAREDNILLITNPSNPLGTIMDRKTLRTVVSFINEKRIHLVCDEIYAATVF


                         .         .         .         +         .         .         .:280
query           GEARLPSLFELAREAGYPGVIYLGSFSKVLSPGLRVAFAVAHPEALQKLVQAKQGADLHTPMLNQMLVHE
Y104_SULSO      EGESPPPIKAFDKEGR---VIYTSTFSKILAPGLRLGWVIAHEDFIKEMELYKQNVDLHTPSLSQYIAME
YISV_BACSU      EEKPPQPLKAMDHEG---NILYLGAFSKTVSPGLRIGWLAGPEPVIERLADIKMQTDYGSSGLSQWAAAE
AADAT_HUMAN     NKFRVPTFLSMDVDG---RVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQ
YDCR_ECOLI      GEKPLPA----KAWDRHDGVLHCSSFSKCLVPGFRIGWVAAHARKIQRL-QLMSTLSTSSPM-QLALVDY
AADAT_RAT       TKPWEPTFLSMDVDG---RVIRADSLSKVISSGLRVGFITGPKSLIQRIVLHTQISSLHPCTLSQLMISE
AATR2_DICDI     ESSENANLGKSLLSMDVDGVLRFDSLSKILSSGLRIGFVTGNKQLLEKINFHQQSTTLHSSGLSQAVVLS
YDFD_BACSU      DEIP-PYPIKTIDKNGH--VLYIGSLSKTLSPGLRIGWIVGPEPVIERLSDIKMQTDYGSSSLSQRVAAE
AADAT_MOUSE     SKPWEPTFLSMDVDG---RVIRADTFSKTVSSGLRVGFMTGPKTLIQNIVLHTQVSSVHACTLSQLMILQ
MOCR_RHIME      RGRPVPAMQGLDKSG---RVIYMGTFAKTLFPSLRIGFIVVPPQLADGFKRVVSNTGHYPSLLLQAALAD
AADAT_BOVIN     NKPWAPTFLSMDEDG---RVIRADSFSKVLSSGLRIGFITGPKPLIERIVLHIQVSTMHPSTFAQLLVSQ
AATR3_SCHPO     KKKLIPSLLHLDTDG---RVLRVDSFSKLIVPGLRLGWITGNSLFIDRITRYAEVCTESPSGVSQVVLYA
YJIR_ECOLI      EYPRPRTIHSWDIDGR---VLLCSSFSKSIAPGLRVGW-VAPGRYHDKLMHMKYAISSFNVPSTQMAAAT
AATR1_SCHPO     VKELIPSFLSMDVDG---RVIRMDSLSKVVAPGSRVGWFTAQPLFIERGLRAAETATQSASGISQGILYA
NORG_STAAC      XSDPTPSIKTYDKLGK---VIHISSFSKTIAPAIRIGWIVASEKIIEQLADVRMQIDYGSSILSQMVVYE
NORG_STAA8      XSDPTPSIKTYDKLGK---VIHISSFSKTIAPAIRIGWIVASEKIIEQLADVRMQIDYGSSILSQMVVYE
NORG_STAA3      XSDPTPSIKTYDKLGK---VIHISSFSKTIAPAIRIGWIVASEKIIEQLADVRMQIDYGSSILSQMVVYE
NORG_STAAN      XSDPTPAIKTYDKLGK---VIHISSFSKTIAPAIRIGWIVASEKIIEQLADVRMQIDYGSSILSQMVVYE
NORG_STAAM      XSDPTPAIKTYDKLGK---VIHISSFSKTIAPAIRIGWIVASEKIIEQLADVRMQIDYGSSILSQMVVYE
AATR1_DICDI     GKRVLKSFLSIDKE---DRVIRLDTFSKFLSSGIRMGFVTTNSKLFGVIAFELNASIFHSSGLTQIALEK
NORG_STAAB      XSDPTPAIKTFDKLGK---VIHISSFSKTIAPAIRIGWIVASEKIIEQLADVRMQIDYGSSILSQMVVYE
AATR2_SCHPO     LKSLVPSLLSLDTEG---RVLRLDSFSKLIAPGTRLGYITGNSMFIDHITRIAEVCTESPSGICQSVLYA
YDEL_BACSU      TGQPVPSLQGLDQ---HNRVIYMGTFSKSLLPSLRISYMILPSPLLKKGHEIKQTVSCH----SQLTLAE
YCXD_BACSU      NKKADPYAYDLSSH-----VIYLKSFSKMMFPGLRVGAAVL-PEALTDTFYAKKLNDIDCSMISQAALEI
YHDI_BACSU      SGHPIPSLQGLDPNG---RVIYLGTFSKSLLPSLRLSFMIVPPELMEPIQNNVQLMKQTVSAHSQLALAD
GABR_BACSU      DVDSIPALQSLDR---FQNVIYMGTFSKSLLPGLRISYMVLPPELLRAYKQ-------------------
ARO9_YEAST      NDFLMKSFLTLDTDAR---VIRLETFSKIFAPGLRLSFIVANKFLLQKILDLADITTRAPSGTSQAIVYS
DAPAT_DESDG     NENNRPSIMEI--PGAMDVAIEFNSLSKPYNTGWRIAMAVGNASLVAGLGKVKENMDSGAFQAVQEAAIV
DAPAT_CARHZ     DGYRAPSFLEVAKDVG----IEFHSLSKTYNTGWRIGWAVGNAKAIDALGRLKSNIDSGVFQAIQYAGIK
AAT_AQUAE       GDAKFVSPASFSDEVKNI-TFTVNAFSKSYSTGWRIGY-VACPEEYAKVIASLNSQSVNVTTFAQYGALE
HIS8_ERWCT      ----CPQASTASWLAEFPHLVILRTLSKAFSAGLRCGFTLANPEVIQLLLKVIAPYPLSTPVADQALSHE
ARO8_YEAST      NDEFLKSLANTFLSLDTEGVIRMDSFSKVLAPGTRLGWITGSSKILKPYLSLHEMTIQAPAGFTQVLVNA
DAPAT_DEHE1     DGYRPVSFLEAAKEVG----IEFHSLSKSYNTGWRIGMAVGNAKMIDALRRFKSNLDSGIPQAIQLMAIA
AAT_THEAQ       EGAH----FSPGTLAPEHTITVNGAAKAFAMTGWRIGYACGPKAVIKAMADVSSQSTTSPDTIAQWATLE
AAT_PYRHO       EDAKHYPMIKFAPE----NTILANSFSKTFATGWRLGFVVAPSQVIKEMTKLHAYVIGNVASFVQIAGIE
AAT_SULSO       -EGKMRSTLEDSDWRDF--LIYVNGFSKTFSTGWRLGYIVAKREIIQKM--GILAANVYTAPTS--FVQK
AAT_THEMA       TD-EFTSILDVSE--GFDRIVYINGFSKSHSTGWRVGYLISS----EKVATAVSKIQSHTTSCINTVAQY
AAT_PYRAB       DDVKHYSIASL--DGMFERTITVNGFSKTFATGWRLGFVAAPSWIIEKMVKFQMYNATCPVTFIQYAAAK
HIS8_PECCP      ----CPQATTAVWLDEFPHLVILRTLSKAFSAGLRCGFTLANPEVIQLLLKVIAPYPLSTPVAD-IAAQA
AAT_THET8       GEH-----FSPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSSQSTTSPDTIAQWATLE
AAT1_BACSU      GGKKHVSIAQLSDRLKEQTVIINGVSKSHSMTGWRIGYAAGSEDIIKAMTNLASHSTSNPTSIAQY----
HIS8_CHLTE      --SREQSALDLIDR--YPNLIVLRTMSKALAAGMRIGFAIANPELLAEISKPK-----------------
HIS8_BLOPB      PDASLVRWLPM-----YPHLVILRTLSKAFAAGLRCGFTLANPEIIKLLEKVIAPYPLSTPVID------
HIS8_BACHD      TADDYPDTVPMIRT--YKNLVVLRTFSKVFGAALRIGYGVANQALIEKI---------------------
HIS8_ANADF      DAPGFQDGLALRRK--YPNVVVLRTFSKIYGAGMRLGYGLARPEVVE-----------------------
DAPAT_DEHSB     DGYKPVSFLEAAKDVG----IEFHSLSKSYNTGWRIGMAVGNAKMIDALRRFKSNLDSGIPQAIQLMAIA
DAPAT_DESVH     DENRPPSI--LSVPGAKDVAIEFHSLSKTYNTGWRVGMAVGNPTLVAGLGKIKENMDSGIFQAVQEASIV
YEY2_YEAST      PSDELPSMVHIDREDSFGNTVSNATFSKLIAPGLRFGYHESINANLARQL-SKGGANVSTPQLNSMIVGE
HIS8_HALWD      --SNNPSAIKLIQE--YDNIAVLRTFSKAYGAGLRIGYA-AVPES-------------------------
DAPAT_DEHSC     DGYKPVSFLEAAKDVG----IEFHSLSKSYNTGWRIGMAVGNAKMIDALRRFKSNLDSGIPQAIQLMAIA
HIS82_NITMU     PALKGDSIAWLKQ---FPNLLITRTFSKAYGAGVRVGFGLGHPDVAGLMNRVRQ----------------
DAPAT_DESVV     DENRPPSI--LSVPGAKDVAIEFHSLSKTYNTGWRVGMAVGNPTLVAGLGKIKENMDSGIFQAVQEASIV
HIS8_WOLSU      FKDSQKRIDPKDLIERFPSSIFLGTFSKAFGGGMRVGYGIAQPSIIQALMKMRAPFNITTLSLKAAIVEE
HIS81_MANSM     KEERVNSLALLKK---YPNLVVSRSLSKAYGAGLRIGFAVSNPE--------------------------
HIS8_THEGJ      GK----SLWRLIEE--YPNLVVLRTFSKAFGAGIRAGYMLAGEEIVDALYRIK-----------------
HIS81_RALEJ     DDQQYDSVAWVRR---YPNLLVSRTFSKAYGAGLRIGYAVAQPELTDLLNRIRQ----------------
YFDZ_ECOLI      DGWKAPSIMQVARDVAVEFFTLSKSYNMA---GWRIGFMVGNKTLVSALARIKSYHDYGTFTPLQVAAIA
HIS8_PSEST      G-TNCQRLNYLVR---YPNLLVSRTLSKVYGAGLRVGYSASSPQIADVLNRVRQ----------------
AAT_STRVG       GEAKFTSLPVLVPALRDKCIIVNGVAKTYAMTGWRVGWVIAPQDVIKAATNLQSHATSNVSNVAQVAALA
HIS8_MOOTA      TAEHYPNSLAYVR-AGRANVIILRTFSKIYGAGLRVGYGVAVPEIIRDLNRVRE----------------
YDEF_BACSU      NKNPLPALASFAPQQ----VIHIASLSKSLAPGLRLAYVAVPRQYKEPISKALYNLNITSPLLAELTART
HIS8_SULNB      AKDQKHAIADLLK---YENVIYLGTFSKAHGGGMRVGYGIAQAKLIKELYKMRPPFNITT----------
DAPAT_SYNFM     GGYRPLSFLELP-GAGEVGVEFHSLSKTYNMTGWRLGFAVGNADILAGLGQVKSNIDSGAFNAVQWAGIT
DAPAT_HALOH     DGYNPPSFFEGAKKVG----IEFNSLSKPFNTGWRVGWAVGRSDVIESLGRIKTNIDSGIFEAIQYAGIE
HIS8_BREBN      VDPEYPQTVPMLAE--YPNLIILRTFSKIYGAALRIGYGIASEELISSLEHVRE--PFNTGTLGQVAARA
AAT_BACST       GGAKHVSIAELSPELKAQTVIINGVSKSHSMTGWRIGYAAGPKDIIKAM---------------------
HIS8_THETN      GKTLVPYIDR------FENLIVLRTLSKAFGAGLRVGYALSNGEIVKYLNLVKSPYNLNS--LSQRIALE
HIS82_RALSO     PEQQYDSIAWVRR---YPNLLVSRTFSKAYGAGLRVGYGIAQPQLTALLNRIRQ----------------
DAPAT_DESAD     DEDKKP--ISILETPGAKDVIEFHSLSKTYNTGWRCGMAVGNASLVAGLGKIKENVDSGIFQAVQEAGIV
HIS8_VIBCH      PEASTVDLL-----AQYPNLAILRTLSKAFAAGLRCGFTLANAELINVLLK-------------------
HIS8_THEP3      N-----TIVDVINE--FENLIVLRTLSKAFGAGLRVGYAVANENILKYLNLVKSPYNINS--LSQVIALK
HIS8_SYMTH      DETPFDS---RALVQDYPNVVIARTFSKIYGAGFRLGYGVMRPEVLAPLYTAR-----------------
DAPT2_ANAVT     DGYKPPSVLQI------PGAIEFHSLSKSYNTGWRIGFAVGNAYAIQGLSQVKTNVD-------------
AAT_SULTO       YEGKMKSVLEDPDWRDY--VIYVNGFSKTFSTGWRLGYVVAKEKVIKKM--AEIAANIYT----------
HIS8_SALPK      PQATLTGWL-----VEYPHLVILRTLSKAFAAGLRCGFTLANEEVINLLLKVIAPYPLSTPV--------
HIS8_SALPA      PQATLTGWL-----VEYPHLVILRTLSKAFAAGLRCGFTLANEEVINLLLKVIAPYPLSTPV--------
HIS8_SALDC      PQATLTGWL-----VEYPHLVILRTLSKAFAAGLRCGFTLANEEVINLLLKVIAPYPLSTPV--------
AATC_RHIME      DDAPPPSVLEVPGATDV--TVEFTSMSKTFSPGWRMGFAVGNERLIAALTRVKSYLDYGAFTPIQVAATQ
AAT_BACY2       NGAEHFSIAQISEEVKAQTIVINGVSKSHSMTGWRIGYAAGNADIINAMTDLASHSTSNPTTASQYAAIE
HIS8_VIBPA      PEASTVDLL-----AQYPNLAILRTLSKAFAAGLRCGFTLANEELINVLLK-------------------
HIS8_THEPX      GNTIVDAINE------FENLIVLRTLSKAFGAGLRVGYAVANENILKYLNLVKSPYNINS--LSQIIALK
HIS8_SALTY      PQATLTGWL-----VEYPHLVILRTLSKAFAAGLRCGFTLANEEVINLLLKVIAPYPLSTPV--------
HIS8_SALTI      PQATLAGWL-----VKYPHLVILRTLSKAFAAGLRCGFTLANEEVINLLLKVIAPYPLSTPV--------
HIS8_SALSV      PQATLTGWL-----VEYPHLVILRTLSKAFAAGLRCGFTLANEEVINLLLKVIAPYPLSTPV--------
HIS8_SALPC      PQATLTGWL-----VEYPHLVILRTLSKAFAAGLRCGFTLANEEVINLLLKVIAPYPLSTPV--------
HIS8_SALPB      PQATLTGWL-----VEYPHLVILRTLSKAFAAGLRCGFTLANEEVINLLLKVIAPYPLSTPV--------
HIS8_SALNS      PQATLTGWL-----VEYPHLVILRTLSKAFAAGLRCGFTLANEEVINLLLKVIAPYPLSTPV--------
HIS8_SALHS      PQATLTGWL-----VEYPHLVILRTLSKAFAAGLRCGFTLANEEVINLLLKVIAPYPLSTPV--------
HIS8_SALG2      PQATLTGWL-----VEYPHLVILRTLSKAFAAGLRCGFTLANEEVINLLLKVIAPYPLSTPV--------
HIS8_SALEP      PQATLTGWL-----VEYPHLVILRTLSKAFAAGLRCGFTLANEEVINLLLKVIAPYPLSTPV--------
HIS8_SALA4      PQATLTGWL-----VEYPHLVILRTLSKAFAAGLRCGFTLANEEVINLLLKVIAPYPLSTPV--------
HIS81_NITOC     NEAQYP--YSLAWMSRYPNLMITRTFSKIYGAGLRIGYGVSHPD--------------------------
DAPT2_ANASP     DGYKPPSVLQI------PGAIEFHSLSKSYNTGWRIGFAVGNAYAIKGLSQVKTNVD-------------
HIS8_VIBCM      PEASTVDLL-----AQYPNLAILRTLSKAFAAGLRCGFTLANAELINVLLK-------------------
HIS8_VIBC3      PEASTVDLL-----AQYPNLAILRTLSKAFAAGLRCGFTLANAELINVLLK-------------------
HIS8_PYRKO      GKDLLGLLDE------YPNLVLLRTFSKAFSAGARVGYALASEEIIEALYRIK-----------------
HIS8_DESHY      GESVVDQI------PYCPNLLVMKTFSKLFAAALRLGYLLGQPSIIGALNRARQ----------------
DAPAT_AQUAE     GQEKPPSILQV------PGAIEFHSLSKTYNTGWRIGMAVGNKELVAGLGKVKTNVD-------------
Y1527_METMP     GDKPLSFLVKDAKEVG----VEIHSFSKAYNTGWRLAFVAGNELIVRGFAAVKDNYD-------------
PATA_BACSU      DRPH----YSIATYLRDQTIVINGLSKSHSMTGWRIGFLFAPKDIAKHILKVHQYNVSCASSISQKAALE
HIS81_DECAR     PAERVDTATWI---KDFPNLVVCRTFSKIFGAGLRVGYALASTEVADLMNRIRQ----------------
HIS8_SODGM      ----CPQASVVNWLAEYPHLVILRTLSKAFAAGLRCGFVLANVEVIQLLLK-------------------
HIS8_SALCH      PQATLTGWL-----VEYPHLVILRTLSKAFAAGLRCGFTLANEEVINLLLKVIAPYPLSTPV--------
HIS8_ANOFW      QAEDYPNTVSLLQQ--YENMMILRTFSKAYGAALRIGYGIAHEHLLQAIEPARE----------------
HIS82_THICR     HDEYANGLNYLEQ---YPNLIVSRTFSKAYGAALRIGYMVANEELI------------------------
HIS82_HAEIN     SEERVDS-FSLLKK--YSNLIISRSLSKAYGAGLRIGYAVSNPEIADLLNRVRQ----------------
HIS8_ENTS8      PQATLAGWL-----GEYPHLVVLRTLSKAFAAGLRCGFTLANEEVINLLLKVIAPYPLSTPV--------
HIS8_CLONN      GDSILDYIKK------YDNLIVLRTASKAISAALRLGFLITNDTLLREIKKVKPPFNVNS--VSQVIGEI
HIS82_ARCFU     SD---DSKIEMVRD--YNNLIVLRSFSKFFGAGMRVGYAVCSAEIAEAIEKVR-----------------
DAPAT_GLOVI     DGYKPPSILQVARDV---AIEFLSCSKAYNMTGWRVGFVIGNRTGIAGLGQVKTNID--SGVFKXXXXXX
HIS8_PHOLL      PENSIASWLK-----NYPNLVILRTLSKAFAAGLRCGFTLASVDIITLLLKVIAPYPLSTPV--------
PATR_MYCA9      REDFTDSL-ALVRE--HPNVVVLRTFSKAYGAGLRVGYAVGDPDVITTL---------------------
HIS8_PROA2      EESALTLIDE------FPNLIILRTMSKALAAGMRIGFAITNPQLLSEIAKPK-----------------
HIS82_HAEI8     SEERVDS-FSLLKK--YSNLIISRTLSKAYGAGLRIGYAVSNPEIADLLNRVRQ----------------
AAT1_METJA      DKKHYSPMQFTDR------CILINGFSKTYATGWRIGYLAVSDELNKEL-----------DLINNMIIHQ
HIS8_ECO45      ----CPQASLVGWLAEYPHLAILRTLSKAFAAGLRCGFTLANEEVINLLMKVIAPYPLSTPV--------
HIS8_CLOCE      DTTVIPFIKE------YENLLILRTFSKAFGAGIRCGYSIA-----------------------------
HIS81_THIDA     PASRCDTAAWVVR---FPNLLISRTFSKAYGAGLRVGYGIGHADVVDLL---------------------
Y1391_METJA     DGKPLSFLVKDAKEVG----VEIHSFSKAFNTGWRLAFLVGNELIIKAFATVKDNFD-------------
PATR_MYCVP      RDGLAPDSFGLVR--AHSNVVVLRTFSKAYGAGLRIGYAVADPDIIAAL---------------------
PATR_MYCPA      RDGLLPNSLELALSRS--NVVVLRTFSKAYGAGLRVGYAIGHPEALDKVV--------------------
HIS8_XYLFA      --SDVPSVVPLL--ARYPHLVVLRTLSKAHAAAVRIGSVIADAHLVAILRRCQAPYPLPTPCVS------
HIS8_SHIFL      PQASLAGWL-----AEYPHLAILRTLSKAFAAGLRCGFTLANEEVINLLMKVIPPYPLSTPV--------
HIS8_SHIF8      PQASLAGWL-----AEYPHLAILRTLSKAFAAGLRCGFTLANEEVINLLMKVIPPYPLSTPV--------
HIS8_SHIDS      PQASLAGWL-----AEYPHLAILRTLSKAFAAGLRCGFTLANEEVINLLMKVIAPYPLSTPV--------
HIS8_ECOK1      PQASLAGWL-----AEYPHLAILRTLSKAFAAGLRCGFTLANEEVINLLMKVIAPYPLSTPV--------
HIS8_ECO81      PQASLAGWL-----AEYPHLAILRTLSKAFAAGLRCGFTLANEEVINLLMKVIAPYPLSTPV--------
HIS8_ECO5E      PQASLAGWL-----AEYPHLAILRTLSKAFAAGLRCGFTLANEEVINLLMKVIAPYPLSTPV--------
HIS8_ECO57      PQASLAGWL-----AEYPHLAILRTLSKAFAAGLRCGFTLANEEVINLLMKVIAPYPLSTPV--------
HIS8_ECO55      PQASLAGWL-----AEYPHLAILRTLSKAFAAGLRCGFTLANEEVINLLMKVIAPYPLSTPV--------
HIS82_BORPA     GHTWMPRIMD------EPNAVVMRTVSKIGLAGLRFGYLAGHP---------------------------
HIS82_BORBR     GHTWMPRIMD------EPNAVVMRTVSKIGLAGLRFGYLAGHP---------------------------
PATR_MYCA1      RDGLLPNSLELALSRS--NVVVLRTFSKAYGAGLRVGYAIGHPEALDKVV--------------------
HIS8_XYLFT      --SDVPSVVPLL--ARYPHLVVLRTLSKAHAAAVRIGSVIADAHLVAVLRRCQAPYPLPTPCVS------
HIS8_XYLFM      --SDVPSVVPLL--ARYPHLVVLRTLSKAHAAAVRIGSVIADAHLVAVLRRCQAPYPLPTPCVS------
HIS8_XYLF2      --SDVPSVVPLL--ARYPHLVVLRTLSKAHAAAVRIGSVIADAHLVAVLRRCQAPYPLPTPCVS------
HIS8_SHIBS      PQASLAGWL-----AEYPHLAILRTLSKAFAAGLRCGFTLANEEVINLLMKVIAPYPLSTPV--------
HIS8_PELLD      HPSALPLVDEL------PNVVILRTMSKALAAGMRIGFAIA-PEAL------------------------
HIS8_METFL      AELKSEAFSWLAE---FDNLLISRTLSKAYGAGLRVGFGVTSPGVADLMNRVRQ----------------
HIS82_METCA     EYARRPDHPDALEWLGFPGLIVTRTFSKAYGAGLRVGYAVTGVEIADLLNRARQPFNVNTLGL-XXXXXX
PATR_MYCSS      GD-QVPDSFGLVR--AHPNVVVLRTFSKAYGAGLRIGYAVADADIVTAL---------------------
PATR_MYCSK      GD-QVPDSFGLVR--AHPNVVVLRTFSKAYGAGLRIGYAVADADIVTAL---------------------
PATR_MYCSJ      GD-QVPGSFGLVR--AHPNVVVLRTFSKAYGAGLRIGYAVADADIVTAL---------------------
HIS8_YERPY      PQASVSNWLK-----DYPNLVILRTLSKAFAAGLRCGFTLANSDIIQLLLKVIAPYPLSTPV--------
HIS8_YERPP      PQASVSNWLK-----DYPNLVILRTLSKAFAAGLRCGFTLANSDIIQLLLKVIAPYPLSTPV--------
HIS8_YERPN      PQASVSNWLK-----DYPNLVILRTLSKAFAAGLRCGFTLANSDIIQLLLKVIAPYPLSTPV--------
HIS8_YERPG      PQASVSNWLK-----DYPNLVILRTLSKAFAAGLRCGFTLANSDIIQLLLKVIAPYPLSTPV--------
HIS8_YERPE      PQASVSNWLK-----DYPNLVILRTLSKAFAAGLRCGFTLANSDIIQLLLKVIAPYPLSTPV--------
HIS8_YERPA      PQASVSNWLK-----DYPNLVILRTLSKAFAAGLRCGFTLANSDIIQLLLKVIAPYPLSTPV--------
HIS8_YERP3      PQASVSNWLK-----DYPNLVILRTLSKAFAAGLRCGFTLANSDIIQLLLKVIAPYPLSTPV--------
HIS8_SALAR      PQATLAGWL-----VEYPHLVILRTLSKAFAAGLRCGFTLANEEVINLLLKVIAPYPLSTPV--------
HIS8_LEPIN      GKKKDPNKFIPAKEVTFPNVFYTGTFSKV-----------------------------------------
HIS8_LEPIC      GKKKDPNKFIPAKEVTFPNVFYTGTFSKV-----------------------------------------
HIS8_KLEP3      PQATLAGWL-----SDYPHLVVVRTLSKAFAAGLRCGFTLANAEVINVLLKVIAPYPLSTPV--------
HIS8_BLOFL      DFCRHASLIQLLTE--YPNLIILRTLSKAFAAGLRCGFTLANPKIINLLTK-------------------
HIS8_RHISN      DSA-------LRLVNRYSNLLLLRTFSKYAAAGIRVGFGFGHPEVIGRL---------------------
HIS8_PSEE4      GGETAISLVD-----RYDNLLVTQTLSKSRSAGLRVGLAVGHPDLIEALERIK-----------------
HIS8_ESCF3      PQASLAGWL-----AEYPHLAILRTLSKAFAAGLRCGFTLANEDVINLLMKVIAPYPLSTPV--------
HIS8_ECOUT      PQASLAGWL-----AEYPHLAILRTLSKAFAAGLRCGFTLANEEVINLLMKVIAPYPLSTPV--------
HIS8_ECOSE      PQASLAGWL-----AEYPHLAILRTLSKAFAAGLRCGFTLANEEVINLLMKVIAPYPLSTPV--------
HIS8_ECOLI      PQASLAGWL-----AEYPHLAILRTLSKAFAAGLRCGFTLANEEVINLLMKVIAPYPLSTPV--------
HIS8_ECOLC      PQASLAGWL-----AEYPHLAILRTLSKAFAAGLRCGFTLANEEVINLLMKVIAPYPLSTPV--------
HIS8_ECOL6      PQASLAGWL-----AEYPHLAILRTLSKAFAAGLRCGFTLANEEVINLLMKVIAPYPLSTPV--------
HIS8_ECOL5      PQASLAGWL-----AEYPHLAILRTLSKAFAAGLRCGFTLANEEVINLLMKVIAPYPLSTPV--------
HIS8_ECOHS      PQASLAGWL-----AEYPHLAILRTLSKAFAAGLRCGFTLANEEVINLLMKVIAPYPLSTPV--------
HIS8_ECODH      PQASLAGWL-----AEYPHLAILRTLSKAFAAGLRCGFTLANEEVINLLMKVIAPYPLSTPV--------
HIS8_ECOBW      PQASLAGWL-----AEYPHLAILRTLSKAFAAGLRCGFTLANEEVINLLMKVIAPYPLSTPV--------
HIS8_ECO8A      PQASLAGWL-----AEYPHLAILRTLSKAFAAGLRCGFTLANEEVINLLMKVIAPYPLSTPV--------
HIS8_ECO27      PQASLAGWL-----AEYPHLAILRTLSKAFAAGLRCGFTLANEEVINLLMKVIAPYPLSTPV--------
HIS8_ECO24      PQASLTGWL-----AEYPHLAILRTLSKAFAAGLRCGFTLANEEVINLLMKVIAPYPLSTPV--------
HIS8_CHLL2      --SREHSVLALIEEC--PNLIVLRTMSKALAAGMRIGFAIANPLLMAEIAKPK-----------------
HIS8_ARATH      VESRMKWVKK------YENLIVLRTFSKRAGAGLRVGYGAFPLSIIEYLWRAKQ----------------
HIS82_NITEU     PEANKAN--SIAWLKNFQNLVITRTFSKAYGASVRVGFALAHADIANLMNRIRQ----------------
HIS82_MANSM     ----SPETSMIKQLGNYPHLAIIRTLSKAFAAGLRCGFTLANPEVLQKVI--------------------
PDXR_CORGL      ----VGMXXXXXXXXXXDRTILLGTFSSVITPQVACGYLIA-----------------------------
HIS8_LYSSC      HPEHKDTLPIIDQ---YPNVLLLRTFSKAYGASFRVGYAIGQPTIIEKL---------------------
HIS8_AERHH      PEASVVDLL-----ARFPNLVVTRTLSKAFAAGIRCGFTLASPEVIAMLAK-------------------
Y3073_RHOS4     ----------------------------------------------------------------------
HIS8_YERPS      PQASVSNWLK-----DYPNLVILRTLSKAFAAGLRCGFTLANSDIIQLLLKVIAPYPLSTPV--------
HIS8_YERPB      PQASVSNWLK-----DYPNLVILRTLSKAFAAGLRCGFTLANSDIIQLLLKVIAPYPLSTPV--------
HIS8_VIBFM      EKSTVDLL------ADYPHLAILRTLSKAFAAGLRCGFTLANEELINVLLK-------------------
HIS8_SHISS      PQASLAGWL-----TEYPHLAILRTLSKAFAAGLRCGFTLANEEVINLLMKVIAPYPLSTPV--------
HIS8_YERE8      PQASVSSWLK-----DYPNLVILRTLSKAFAAGLRCGFTLANSDIIQLLLKVIAPYPLSTPV--------
HIS8_PSEPK      GGETAISLVD-----RYDNLLVTQTLSKSRSAGLRVGLAVGHPDLIEALERIK-----------------
HIS8_KLEP7      PQATLAGWL-----SDYPHLVVLRTLSKAFAAGLRCGFTLANAEVINVLLKVIAPYPLSTPV--------
HIS8_CITK8      PQATLAGWL-----SEYPHLVVLRTLSKAFAAGLRCGFTLANEEVINLLLKVIAPYPLSTPV--------
HIS8_VIBHB      PEASTVDLL-----AQYPNLAILRTLSKAFAAGLRCGFTLANEELINVLLK-------------------
HIS8_PYRFU      GKSFIPKISE------YENLVILRTFSKAFGAGIRCGYMIANEKIIDAL---------------------
HIS8_PSEPW      GGQTAISLVD-----RYDNLLVTQTLSKSRSAGLRVGLAVGHPDLIEALERIK-----------------
HIS82_PASMU     PEERVDSFTLLKK---HSNLVICRTLSKAYGAGLRIGYAVSSAEIADLFNRVRQ----------------
HIS82_BORPE     GHTWMPRIMD------EPNAVVMRTVSKIGLAGLRFGYLAGHP---------------------------
PATR_MYCS2      RDGLLPDSLGLVRE--HRNVVVLRTFSKAYGAGLRVGYAVADPEIVTAL---------------------
HIS8_ECO7I      PQASLAGWL-----TEYPHLAILRTLSKAFAAGLRCGFTLANEEVINLLMKVIAPYPLSTPV--------
HIS8_BACLD      AEDYPETIPLLER---FPNLMILRTFSKAYGASLRVGYGIASEQLIQAIEPARQ----------------
HIS81_IDILO     EDQRAPSV-EWIKE--YPNLVVSRTFSK------------------------------------------
HIS8_VIBF1      EKSTVDLLVD------YPHLAILRTLSKAFAAGLRCGFTLANEELINVLLK-------------------
HIS8_SHIB3      PQASLAGWL-----TEYPHLAILRTLSKAFAAGLRCGFTLANEEVINLLMKVIAPYPLSTPV--------
HIS8_SERP5      ----CPQASVAGWLNDYPHLAILRTLSKAFAAGLRCGFTLGNEDLIALLLKVIAPYPLSTPV--------
HIS8_PSEP1      GGETAISLVD-----RYDNLLVTQTLSKSRSAGLRVGLAVGHPDLIEALERIK-----------------
HIS8_PELPB      --SRQRSVLELIDE--LPNLVVLRTMSKAIAAGIRIGFALANPLLMAEIAKPK-----------------
HIS8_NITSB      FKDEKKRIHPQDLIKKYPNVIYLGTFSKAYGGGMRVGYGIADQSVIGQLYKLR-----------------
HIS8_METTH      GVDNTDLL------PDHENLFILRTFSKVMGAGMRIGYGLGDPQIIEYMHRVK-----------------
HIS8_ECOLU      PQASLAGWL-----TEYPHLAILRTLSKAFAAGLRCGFTLANEEVINLLMKVIAPYPLSTPV--------
HIS8_CHLP8      --SQQESVVDLIDR--YPNLIVLRTMSKALAAGMRIGFAITNPELMAEITKPK-----------------
HIS8_CALS8      DDPEYPDAIHWLDE--FKNLIVLQTFSKIYGASLRIGYAIASEEIIEKL---------------------
PATR_RHOSR      SDADGIELFR-----GRPNVVVLRTFSKAYGAGIRVGYAVADPAVVTALTK-------------------
HIS8_TOBAC      MESKMKWVKK------HENLIVLRTFSKRAGAGLRVGYGAFPKSIIEFLWRAKQ----------------
HIS8_PSEPG      GGETAISLVD-----RYDNLLVTQTLSKSRSAGLRVGLAVGHPDLIEALERIK-----------------
HIS8_ENT38      PQATLTGWLE-----EYPHLVVLRTLSKAFAAGLRCGFTLANKDVIDLLMKVIAPYPLSTPV--------
HIS81_PASMU     ----CPQATMVTELKNYPHLAIIRTLSKAFAAGLRCGFTLANKEVLQKVI--------------------
AAT_SULAC       YEGKMRSVLEDPDWKNFS--IYVNGFSKTFSTGWRLGYVVAKENVIKKM--SEIAANVYT--CPTSFAQK
HIS8_NICPL      MESKMKWVKK------HENLIVLRTFSKRAGAGLRVGYGAFPKSIIEFLWRAKQ----------------
HIS8_METPP      ----FASRSYIDRLAHHDHVLLMRTLSKFGLAGVRLGYLMG-PTAL------------------------
HIS8_LEPBL      GKKKDSNTFISAKEVTFPNVFYTGTFSK------------------------------------------
HIS8_LEPBJ      GKKKDSNTFISAKEVTFPNVFYTGTFSK------------------------------------------
HIS81_BACC1     XXXDYPQTLPLLEK--YGNLMILRTFSKAYGAAFRIGYAVGNEQLIGQLEVAR-----------------
HIS8_ROSCS      G----TSVIDLV--GTRPNLVVLRTFSKWAGAGLRIGYAAMHEDVITYLWKIKQ----------------
HIS8_NOVAD      DPANDDGALDLAVTA--CNVLVTRTFSKIYGAGERIGWGTGHPAIVDML---------------------
HIS8_ECOSM      PQASLAGWL-----AEYPHLAILRTLSKAFAAGLRCGFTLANEEVINLLMKVIAPYPLSTPV--------
PATR_STRCO      RDAEVPDGVEFYRER--PNVCVLRTFSKAYGAGLRVGFAIAH----------------------------
HIS8_DESPS      LDKWLDVPSLIKNQAGRCGIVSLRTFSKAYGSGLRVGFGLMAEEIVTCLHKVRQ----------------
HIS8_VIBVY      PEASTVDLL-----AQYSNLAILRTLSKAFAAGLRCGFTLANEELINVLLK-------------------
HIS8_VIBVU      PEASTVDLL-----AQYSNLAILRTLSKAFAAGLRCGFTLANEELINVLLK-------------------
HIS8_LACPL      GAAQVTA---MQLPAKYPNVVVMRTFSKAYGANFRIGYAV------------------------------
HIS8_STRMK      --AQRPSATTLL--VAHANLAVLRTLSKAHAAAARIGTLIAAPELIAVLRRCQAPYPVPTP---------
HIS8_PROVI      QDSALPLIEE------FPNLVVLRTMSKALAAGMRIGFAIGRPELIAEIAKPK-----------------
HIS8_HALLT      VDSAIPLVDE------RDDVAVLRTFSKAYGAGLRIGYSVV-PEA-------------------------
HIS8_SULDN      VKDAKKEINVKELIQKHSNVIYLGTFSKAYGGGMRVGYGISEAKIIKELYKLRPPFNITTLSLEAATV--
DAPAT_MOOTA     DGYRAPSFLQAAKEVG----IEFNSVSKPYNTGWRLGWACGRADVIEALARIKSNID-------------
HIS8_METST      SE-----XXXXXXXXXXXXIFIIRTFSKVMGAGLRIGYGLSNPDFIEKMSRIKPVFSVTVPSQKAVIAEE
HIS8_GEOKA      TAPDYPQTVPLLNE--YEQLVVMRTFSKAYGAALRVGYGVASEMLIRAVEPARE----------------
HIS8_AZOSE      GESAIP----LVRH--HPNLLVVQTLSKSRSAGLRVGFAVGNPDLIEALDRVK-----------------
HIS81_PSEF5     GGQTAISLVD-----RYPNLLVTQTLSKSRSAGLRVGLAVGHPDLIEALERVK-----------------
HIS8_LISIN      PQPEKHE--KLVRT--YKNLIITRTFSKIYGASARVGYGIADKEIIRQLNIVR--PPFNTTSIGQKLAIE
HIS81_LEGPL     --ANAPSATSLIGE--FENLIVLRTLSKAFGAGLRLGCIIAQSPIIQAFNKIIAPYSIATPSM-------
HIS8_ACEPA      GAESAVSLIK-----EYPNLLVVQTFSKSRAAGLRVGFAFGQPELIEGLVRIK-----------------
AAT_PYRKO       ------TRFTPAREL-YENVVTVKGFSKLYSTGFRLGYAIGERNEIRRIQRFIESTVTCVPPFVQRLRDE
HIS8_XANCB      --SDVPSAIGLL--ARYDNLAVLRTLSKAHAAAARIGSLIANAELIALLRRCQAPYPVPTPC---AVMAE
HIS8_GEOSW      TANDYPQTVPLLRQ--YDNLMILRTFSKAYGAALRVGYGIASETLIREIEPARE----------------
HIS8_DESHD      GESVVDQI------PYCPNLLVMKTFSKLFAAALRLGYLLGQPSIIGALNRARQ----------------
HIS8_BUCSC      --SPMNSLVNLISQ--YSNLVVLRTLSKAFSAGLRCGFVLANFSVIKFLLKVINPYPISTP---------
HIS81_PSEPF     GGETAISLVD-----RYPNLLVTQTLSKSRSAGLRVGLAVGHPDLIEALERIK-----------------
PATR_STRGG      RDAEVPDGIEIYRDR--PNVAVLRTFSKAYGAGLRVGFAVAH----------------------------
HIS8_BUCAP      KNSMVNYL------KTFPNLIILRTLSKAFAAGIRCGFTLAQKEVIDIL---------------------
HIS8_BACCN      XXXDYPQTLPLLEK--YENLMVLRTFSKAYGAAFRIGYAVGYAELIKKLEVAR-----------------
HIS8_AERS4      ----CPKASVVDLLARFPNLVVTRTLSKAFAAGIRCGFTLASTEVIAMLAK-------------------
HIS82_BACAN     TAKDFPETLPLLEK--HKNILVLRTFSKAYGASFRVGYAVGHEELIEKL---------------------
DAPAT_DESVM     DENDKPSILEV--EGAKDVTIEFHSLSKTYNTGWRVGMAVGNASLVAGLGKVKENVDSGIFQAVQEASIV
HIS8_MACCJ      REDYPDGVALLKR---FPNLIVLRTFSKAYGAGLRVGYAI------------------------------
HIS8_HALMA      KPSKRPLL------SDRDDVALLRTFSKAYGAGIRLGYAV------------------------------
HIS8_AKKM8      -SDNPPDTLKFVREG--RNVVVLRTFSKAYGAGLRVGYGIAPEPVCSMLHKARAPFNLH-----------
HIS81_LEGPH     --ANAPSATSLIGE--FENLIVLRTLSKAFGAGLRLGCIIAQSPIIQAFNKIIAPYSIATPSM-------
DAPAT_DESDA     TEADIPSIYEI--DGAEEVAVEFRSFSKTAGTGLRCAYTVV-PKAL-RISDGKSGSVSLNALWNRYIVQR
HIS8_PSEU2      GGETAITLVD-----RYPNLLVTQTLSKSRSAGLRVGLAVGHPDLIEALERVK-----------------
HIS8_LISMF      PQPEKHE--KLIRT--YKNLIITRTFSKIYGASARVGYGIADKAIIEQLNIVR--PPFNTTSIGQKLAIE
HIS8_GEOTN      TADDYPQTVPLLQE--YEQLVIMRTFSKAYGAALRVGYGIASESLIRAVEPARE----------------
HIS8_SYNJB      EFSRHTALPKLAE---HPNWVILRTFSKAFRLAARVGYAVGHPQLMQVL---------------------
HIS8_ROSDO      GYDGGASLVD-----EFDNVVMTRTFSKLYGGGLRVGWAYATQEVIDVL---------------------
HIS8_PHOPR      ETSTVDLL------AKYPHLVILRTLSKAFAAGLRCGFTLANTDVINLLLK-------------------
HIS8_LISMC      PQPEKHE--KLIRT--YKNLIITRTFSKIYGASARVGYGIADKAIIEQLNIVR--PPFNTTSIGQKLAIE
HIS8_HAEIG      PEASVINLLK-----NYPHLAIIRTLSKAFAAGLRCGFVLANPELIDIL---------------------
HIS8_HAEIE      PEASVINLLK-----NYPHLAIIRTLSKAFAAGLRCGFVLANPELIDIL---------------------
HIS8_BUCDN      ----LPKESMTLYLKKYPNLVILRTLSKAFAAGIRCGFVLAQKEIINIL---------------------
HIS8_BACSU      AEDYPETVPLLSK---YSNLMILRTFSKAYGAALRVGYGIADENLIRQIEPARE----------------
HIS82_BACCZ     TAKDFPETLPLLEK--HKNILVLRTFSKAYGASFRVGYAVGHEELIEKL---------------------
HIS81_HAEIN     PEASVINLLK-----NYPHLAIIRTLSKAFAAGLRCGFVLANPELIDIL---------------------
1A112_ARATH     GDKEFVSMAEIAGSGEFTRVHIIYGLSKDLSPGFRAGVIYSFHEAAKKLMRFSS-----VPVLVQRILIS
PATR_NOCFA      TPQDRPDGVEVGRNR--PNVVVLRTFSKAYGAGLRVGYAVGDPEVITALMK-------------------
HIS8_XANAC      --SDVPSAVGLL--GRYDNLAVLRTLSKAHAAAARIGTLIANAELIALLRRCQAPYPVPTPMAEQALSAP
HIS8_LISW6      PQPEKHE--KLIRT--YKNVIITRTFSKIYGASARVGYGIADKEIINQLNIVR--PPFNTTSIGQKLAIE
HIS8_LISMH      PQ---PEKHELIRT--YKNLIITRTFSKIYGASARVGYGIADKAIIEQLNIVR--PPFNTTSIGQKLAIE
HIS8_DEHSC      GQTMVSDM------SKYPNLMILRTFSKWAGAGLRVGYGLFPP---------------------------
HIS8_DEHSB      GQTMVSDM------SKYPNLMILRTFSKWAGAGLRVGYGLFPP---------------------------
HIS8_BACNA      AEDYPETVPLLSK---YSNLMILRTFSKAYGAALRVGYGIADENLIRQIEPARE----------------
HIS8_ALISL      EVSTVDLL------ATYPNLAILRTLSKAFAAGLRCGFTLANKELIDVL---------------------
HIS82_DECAR     GGETAISLVD-----RYDNLLVVHTLSKSRSAGMRVGFAVGHAALIEALERVK-----------------
HIS81_LEGPA     --ANAPSATSLIGE--FENLIVLRTLSKAFGAGLRLGCIIAQSPIIQAFNKIIAPYSIATPSM-------
HIS8_ROSS1      GTSVVDMV------GACPNLVVLRTFSKWAGAGLRIGYAAMHEDVAAYVWKIKQ----------------
HIS8_PSESM      GGETAITLVD-----RYPNLLVTQTLSKSRSAGLRVGLAVGHPDLIEALERVK-----------------
HIS8_DEHE1      GQTMVTDM------PSYPNLMILRTFSKWAGAGLRVGYGLFPPVIADYLSRIK-----------------
PATR_MYCTU      RDGMRPDSLGLVR--AHNNVVVLRTFSKAYGAGLRIGYAIGHPDVITAL---------------------
PATR_MYCTA      RDGMRPDSLGLVR--AHNNVVVLRTFSKAYGAGLRIGYAIGHPDVITAL---------------------
PATR_MYCBT      RDGMRPDSLGLVR--AHNNVVVLRTFSKAYGAGLRIGYAIGHPDVITAL---------------------
PATR_MYCBP      RDGMRPDSLGLVR--AHNNVVVLRTFSKAYGAGLRIGYAIGHPDVITAL---------------------
PATR_MYCBO      RDGMRPDSLGLVR--AHNNVVVLRTFSKAYGAGLRIGYAIGHPDVITAL---------------------
HIS8_LISMO      PQPKKHE--KLIRT--YKNLIITRTFSKIYGASARVGYGIADKEIINQLNIVR--PPFNTTSIGQKLAIE
HIS8_BACP2      RAEDYPNSLSLLH--SYQNVIVLRTFSKAYGAALRVGYGIASEELITAIEPARE----------------
ALAT_SCHPO      ----------------------------------------------------------------------
AAT2_METJA      -EGKCYSAIEF--DENLEKTILINGFSKLYATGWRIGYVISNDEIIEAILKLQQNLFISAPTISQYAALK
HIS8_METM5      GE------YDLTNWAKYDNVLVLRTFSKVFGAGQRVGFGVTSKKIVDYMMRIK-----------------
HIS81_HAEI8     PEASVINLLK-----NYPHLAIIRTLSKAFAAGLRCGFVLANPELIDIL---------------------
HIS81_BACCR     XXXXXPQTLPLLEK--YENLMVLRTFSKAYGAAFRIGYAIGDAKLIGQLEVAR-----------------
HIS81_ANAVT     AE---ESALDLVQE--YENVILIRTLSKGYSAGLRLGFGVGNPKLLDGLFKVKDSYNIDAIACKVAAV--
HIS8_XANC5      --SDVPSAVGLL--GRYDNLAVLRTLSKAHAAAARIGTLIANAELIALLRRCQAPYPVPTP---------
HIS8_STAS1      ATAKFPDTLALQQE--FENAFLLRTFSKAYGAGMRIGYVIAAKEAIEK----------------------
HIS8_CHLPD      --SRQKSV--VAEIARLKNLIVLRTMSKALAAGMRIGFAIADPALMAEIAKPK-----------------
HIS81_BACHK     XXXDYPQTLPLLEK--YENLMVLRTFSKAYGAAFRIGYAVGNTELIGQLEVAR-----------------
HIS81_BACAN     XXXDYPQTLPLLEK--YENLMVLRTFSKAYGAAFRIGYAVGNTELIGQLEVAR-----------------
PATR_RHOE4      SDADGIELFR-----SRPNVVVLRTFSKAYGAGIRVGYAVADPEIIVAL------GKVHTP---------
PATR_PROAC      DDAAVDGLTLLE---DHPNVVVLRTFSKAYGAGLRIGFAISTPE--------------------------
HIS81_BACCZ     XXXDYPQTLPLLEK--YENLMVLRTFSKAYGAAFRIGYAVGNTELIGQLEVAR-----------------
HIS8_HELHP      YKDKAKAINPKQLIERFSNVIYLGTFSKVYGGGMRVGYGIASEHIISMLYKVRPPFNVTTLSLQAALI--
HIS8_GEOSF      --AEVTSL-ELVRK--YDNVVVTRTFSKSYSAGMRLGLAVARPEVISAL---------------------
HIS8_BAUCH      -----PTASISSWINHYPHLVILRTLSKAFAAGLRCGFILANPDIIKLLLKVIAPYPISRPVVD------
HIS8_STAHJ      AED-YPDTLKLQER--FDNAFLLRTFSKAYGAGLRVGYVVATNEAIEK----------------------
HIS8_NEIMB      GDSFLPQAGRI------PNLIVLRTLSKIGFAGLRIGYAAGCPEVIGEL---------------------
ATTY_RAT        SDCKYEPLANLS--TNVPILSCGGLAKRWLVPGWRLGWILIH----------------------------
ATTY_DICDI      GEHK---FYPMASLTDKVPILSIGGIAKFLVPGWRLGWVAIH----------------------------
PATR_STRAW      RDPEVPDGVAIYRER--PNVCVLRTFSKAYGAGLRVGFAIAH----------------------------
HIS8_CHRSD      GESAVPLV------ERFPNLLVTGTFSKSRSAGLRLGYAIGSRELIEGLERVK-----------------
ATTY_HUMAN      SDCKYEPLATLSTDV--PILSCGGLAKRWLVPGWRLGWILIH----------------------------
ATTY_BOVIN      SDSKFEPLATLSSKV--PILSCGGLAKRWLVPGWRMGWILIH----------------------------
HIS8_PARDP      GDTRLPNVF-------------------------------------------------------------
HIS8_NEIMF      GDSFLP------QAGSIPNLIVMRTVSKIGFAGLRIGYAAGCPEVIGEL---------------------
HIS8_NEIMA      GDSFLP------QAGSIPNLIVMRTVSKIGFAGLRIGYAAGCPEVIGEL---------------------
HIS8_NEIM0      GDSFLP------QAGSIPNLIVMRTVSKIGFAGLRIGYAAGCPEVIGEL---------------------
HIS81_PSYA2     PESNNRALLD-----EFDNVVIVRTFSKAYGAGLRVGYALSSAAVADLLNRIRQ----------------
HIS81_METCA     GGESAAALVNR-----FPHLLVIQTLSKSRSAGLRVGFALGEPGLIEALERVK-----------------
HIS8_LACF3      DPAKATCLPLVKR---YQNVAVLRTLSKAYGANVRVGFAVM-PVALAAILQ-------------------
ATTY_MOUSE      SDCKYEPMATLS--TNVPILSCGGLAKRWLVPGWRLGWILIH----------------------------
ALAM_YEAST      PGTKFHSMKKILRQREHPG---------------------------------------------------
1A16_ARATH      GQSEFISVAEVIEECNRDLIHIVYSLSKDMGPGLRVGIVYSYNDRVVQIARKMSSFGLVSSQTQHLIAKM
HIS8_CAMC1      KDSKKE--IKPSEVVKFKNAIYLGTFSKAYAGGMRVGYGVANEEIIGALSKLRAPFNITTPSLRAAIV--
HIS82_IDILO     GDSVVSWL------ERYPNLVVLRTLSKAFAAGIRCGFLLANDDIIELL---------------------
HIS81_CARHZ     GVSAIDLLKK------YQNLVILRTFSKXXXXXXXXXYLVASVDVVKEIIKVK-----------------
AVTA_ECOLI      G-----IIFSEARPLWNPNIVLCMSLSKLGLPGSRCGXXXXXXXXXXXXXXMNGIISLAPGGIGPAMMCE
HIS8_SULSO      GYTVSPYIYD------YPNVLVVRTLSKAFSASYRLGYTIANEEIVKALMKSSTPFDIPLPSL-------
HIS8_MYCSS      --SSQPSGVALIDQ--YPTKLVVSTMSKAFAAGGRLGYLVAAPAVIEAML--------------------
HIS8_MYCSK      --SSQPSGVALIDQ--YPTKLVVSTMSKAFAAGGRLGYLVAAPAVIEAML--------------------
HIS8_MYCSJ      --SSQPSGVALIDQ--YPTKLVVSTMSKAFAAGGRLGYLVAAPAVIEAML--------------------
HIS8_METMP      EEYDLTSW-----ALKYDNVLVLRTFSKVFGAGQRVGYGVTSKKVVDYMMRIK-----------------
HIS8_BUCMH      --SPIHSLTNLIDT--YPNLVILRTLSKAFAAGLRCGFILTNVNIVKFLLK-------------------
DAPAT_SYNY3     TDPTLPSIYEI--EGARDCAIEFRSFSKNAGTGTRCALTVV-PKTL--TAKAADGSDVELWKLWNRRQST
DAPAT_NATTJ     DDYQPQSLLSVAKEV----AIEFNSLSKTFNTGWRVGFVVGNEKAISALAKYKTNVDVFTPL--QLAATH
HIS8_METVS      KE------YDLTQWAKYDNVLVLRTFSKVFGAGQRIGYGVTNKKIVDYMMRIK-----------------
HIS8_GEOSL      GDA-----LDLVRR--HENVVVTRTLSKSYSAGMRLGFAVARPAVIAAL---------------------
HIS8_DINSH      PDYDAGKALVESRE----NVVMTRTFSKIYGLGLRVGWGYGPRHVIDVLNRVRGPFNLST----------
CBL_BACSU       GHKHTP--FASLSDDFADISVTCAAPSKTFNIAGLQASAIIIPDRLKR---AKFSASLQRNGLGGLNAFA
AAT_RICBR       DGFKFYTLAEIAPDL-KDRIFTVNGVSKAYSTGWRIGYG-AGSKALIKAMTIIQSQSTSNPSISQVAAVE
HIS8_PELCD      --AKENSL-DLVRR--LPNVVVTRTFSKSYSAGMRLGLAIAHPEVIAAL---------------------
HIS8_NEIG2      GDSFLPQAGRI------PNLIVLRTLSKIGFAGLRIGYATGCPEVIGEL---------------------
HIS8_NEIG1      GDSFLPQAGRI------PNLIVLRTLSKIGFAGLRIGYATGCPEVIGEL---------------------
HIS8_HALVO      --AEEPSAIDLLSE--YDNVAALRTFSKAYGAGLRIGYACV-PEA-------------------------
HIS8_HALSA      ETPSAVTLFDGQPAGGHDDIAVLRTFSKAYGAGIRLGYAV------------------------------
HIS8_HALS3      ETPSAVTLFDGQPAGGHDDIAVLRTFSKAYGAGIRLGYAV------------------------------
HIS82_THIDA     GDSAVPLV------ARHPQLLVTRTLSKSHAAGLRVGYAVGQAPLIEALNRVK-----------------
HIS82_CAUCR     ---EAFDTFAMLDAWGGPWV-SARTFSKAYGAGLRMGYGVASPELVDYL---------------------
COBD_THETN      DYKKYEALPLVKK---HDKLFVVRAVTKFFGPGIRLGYGIGSPSLIQKLEEYKE----------------
HIS8_PSEA6      DNSWAAEL------THYPNIAILRTLSKAFAAGLRCGFTLAQAPVIQALMKVIAPYPIPEPVA-QIAAQA
HIS8_MYCUA      --SSQPSAVGLIEE--YPRVVVTRTMSKAFAAGGRLGYLVATPALIDALL--------------------
HIS8_METM7      NED-----YDLTDWAKYDNVLVLRTFSKVFGAGQRVGYGVTSKKIVDYMMRIK-----------------
HIS8_METJA      KE------YDWTQKAEYDNVIVLRTFSKVFGAGMRVGYGVANKKIIDYMMRVK-----------------
HIS8_XANC8      --SDVPSAIGLL--ARYDNLAVLRTLSKAHAAAARIGSLIANAELIALLRRCQAPYPVPTPC---AVMAE
HIS8_STRMU      GGQSALSLLN-----KYNNLVITRTFSKAALAGLRVGYAIAN----------------------------
HIS8_POLNA      ----FASKSYAGRMARHSHVLLMRTLSKFGLAGVRLGYMMG-PKAL------------------------
AAT_RICFE       DDFKFYTLAQIAPDL-KERIFTVNGVSKAYSTGWRIGYGVGSKALIKAMTIIQSQSTSNPCSISQMAAIE
AAT_RICCN       DDFKFYTLAQIAPDL-KKRIFTVNGVSKAYSTGWRIGYGAGSKTLIKAMTIIQSQSTSNPCSISQMAAIE
HIS8_MESSB      RRNDYEAGVELV--SSNDNVVMTRTFSKIHGAGLRIGWMYA-----------------------------
HIS8_CAMC5      KDARKG--IESSEILKFKNVIYLGTFSKAYGGGMRVGYGIAKESIISELCKLRAPFNITTLSLKAAI--E
HIS8_ARCB4      FKDEKKRICPKDLIDTFPNAIYLGTFSKAYSGGMRVGYGFAQNEIIQNLYKIRAPFNITT----------
HIS81_RALSO     QHSWMPRLPE------FDHLLVMRTVSKLGLAGIRLGYVAGHPKWIAEL---------------------
HIS81_BRAJA     AESAVPLV------AHHDNLLVIQTFSKSRAAGLRVGFAIGQRPLIEALERVK-----------------
DAPAT_PROMS     QDNDIPSIYEI--EGAKDCAIEFRSFSKNAGTGVRCAFTVI-PKNLKGLSSTNEEIEL------------
Y1479_METJA     NGKKQHLLCEV-----------------------------------------------------------
PATR_MYCMM      RDGTVPDSPHLVRT--HSNVVVLRTFSKAYGAGLRVGYAVGQPDVIAAL---------------------
HIS8_MYCMM      --SSQPSAVGLIEE--YPRLVVTRTMSKAFAAGGRLGYLVATPALIDALL--------------------
HIS81_RHILO     XXSSLPDLCE--RDQPW---IVLRTFSKAFGAGLRIGFGIVGDPELRALL--------------------
HIS81_GLUOX     SSPDYADSLTILKNQSRPWMV-LRTFSKAYGAGLRVGYALTSDPGL------------------------
PATR_MYCUA      RDGTVPDSPHLVRT--HSNVVVLRTFSKAYGAGLRVGYAVGQPDVIAPL---------------------
KAT1_HUMAN      SIASLPGMWE--------RTLTIGSAGKTFSTGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAE
HIS8_GLUDA      ADTAIP----LVRR--FPNLLVVRTLSKSHAAGLRVGYAIGHPDLVEALNRVK-----------------
HIS81_CAUCR     SDPHFEDGLELARTA--ENVIVTRTFSKIHGAALRVGWGYA-----------------------------
DAPAT_CLOPH     SEENCPTIYEC--DGAKKCAIELRSFSKNAGTGTRLGFTIVPKE--------------------------
HIS8_STRGC      GQSALPLLDT------YPNLFITRTFSKDAAAGLRVGYGIGHPDLIAVMKAVK-----------------
HIS8_BEII9      TRNDYSAGLELV--STHENVVMTRTFSKI-----------------------------------------
HIS81_PSEAE     GES------AIALVDRYPNLLVTQTLSKSRSAGLRVGLAVGHADLVEALERIK-----------------
HIS8_STRSV      GQSALPLL------ETYPNLFITRTFSKDAAAGLRVGYGLGHPDLIAVMKAVK-----------------
HIS8_CLOBK      GGESSVNLIK-----DYPNVLVIQTLSKSRSAGMRIGFALGQKELIKGLNRIKNSFNSYT----------
HIS8_CLOBH      GGESSVSLIK-----DYPNLLVIQTLSKSRSAGMRIGFALGKKELIEGLNRIKNSFNSYT----------
HIS8_CLOB1      GGESSVSLIK-----DYPNLLVIQTLSKSRSAGMRIGFALGKKELIEGLNRIKNSFNSYT----------
AAT_RICTY       DDFKFYTLAQIAPDL-KERIFTVNGVSKAYSTGWRIGYG-AGSKALIKAMTVIQSQSTSNPSISQMAAIE
PATR_CORJK      RDAESPALEELQR---YPNLAVCRTFSK------------------------------------------
HIS8_CLOBL      GGESSVSLIK-----DYPNLLVIQTLSKSRSAGMRIGFALGQKELIEGLNRIKNSFNSYT----------
HIS8_CLOAB      GESAVKFIKD------YKNLLIVQTLSKSRSAGLRIGFAMGSPELIEGLSRVKNSINSYT----------
HIS82_CARHZ     ----------------------------------------------------------------------
HIS82_BURS3     GAQSAITLID-----RYPNLLVVHTTSKARSAGMRVGFAFGEAALIDALNRVK-----------------
MTNE_BACSU      DGCKPLSFLEGAKDIG----IEIYTLSKTYNAGWRVGFAVGNASVIE-AINLYQDHMFVSLFRXXXXXXX
HIS8_VESOH      TDSFLTDI------AKYPNLVLLRTVSKIGFAGLRLGLLIATQDTVNQLNKLRLPYNIN--ILTQVSANF
HIS8_RHOBA      AEENCLDLVQ-----SDENIFVTRTLSKSYGAGIRFGFLVAQPHVIAELTKIK-----------------
HIS8_DESVV      GDEAAHSL--LSRLDAFPNIAVLRTFSKSFGAGLRLGYGIL-PERL------------------------
HIS8_DESVH      GDEAAHSL--LSRLDAFPNIAVLRTFSKSFGAGLRLGYGIL-PERL------------------------
ALA2_PANMI      DDKKFNSFKKIARSVGY-----------------------------------------------------
AAT_RICPR       DDFKFYTLAQIAPDL-KERIFTVNGVSKAYSTGWRIGYG-AGSKALIKAMTIIQSQSTSNPSISQMAAIE
HIS8_XANCP      --SDVPSAIGLL--ARYDNLAVLRTLSKAHAAAARIGSLIANAELIALLRRCQAPYPVPTPC---AVMAE
HIS8_STRAW      GDSLLPLL--------------------------------------------------------------
HIS8_RHORT      AGARLVD--------SHPNTVMLRTFSKIGLGGLRLGWS-------------------------------
HIS8_HAHCH      ADY-------MSWVSEYDNVVVMRTFSKVGLAGLRFGMLFGAQEWIEQLNKVRLPYNINCLTQNAVL---
HIS8_GEOUR      GDTAL----DLVRK--YENVVVTRTLSKSYSAGMRLGLAVARPEVIAAL---------------------
HIS8_GEOMG      AES---NALELVRR--HENVVVTRTLSKSYSAGMRIGLAIARPEVIAAL---------------------
HIS8_CLOB8      GQSMVKYMHE------YDNLLVIQTLSKSRSAGLRVGFALGHKDLIEGLNRIKNSINSYT----------
CBL_MYCLE       SGARFTPYLSI---PGAENAFALMSATKGWNCGLKXXXXXXXXXXXXDLRRIPKEVS-HGPSHLGIIAHA
ALAT_YEAST      NDVKFHSMKKVLRKLQH---LYPGKFDNV-----------------------------------------
KAT1_RAT        DGHQHVSI------ASLPGMLTIGSAGKSFSTGWKVGWVMGPDNIMKHLRTVHQNSIFHCPTQAQAAV--
KAT1_MOUSE      SIASLPGMWERTLTIGSAG----KSFS---ATGWKVGWVMGPDNIMKHLRTVHQNSIFHCPTQAQAAV--
HIS8_SILST      GFDAGAQLI-----AARHNVVMTRTFSKIYGGGARVGWAYGPQEIIDVLNRVRGPFNVSTTAL-------
HIS8_LEUCK      VDQIDATVIRDVKD--YPNLVVLRTLSKAYGANLRIGYGVMQ-EPLYQVMQA------------------
HIS8_DIAST      SRSWIERMRAQPERNGH--VLLMRTLSKFGLAGVRLGYMIG-PAAL------------------------
YFBQ_SHIFL      DDAEHHSIAPLA----------------------------------------------------------
YFBQ_ECOLI      DDAEHHSIAPLA----------------------------------------------------------
YFBQ_ECOL6      DDAEHHSIAPLA----------------------------------------------------------
HIS8_PSE14      GGETAITLVDR-----YPNLLVTQTLSKSRSAGLRVGLAVGHSDLIEALERVK-----------------
HIS8_CLOB6      GGESSVSLIK-----DYPNLLVIQTLSKSRSAGMRIGFALGQKELIKGLNRIKNSFNSYT----------
HIS8_CAMFF      FKSSKKEIDPKTLIQTFSNALYLGTFSKAYGGGMRVGYGIANEEIIKAL---------------------
ALA2_HORVU      DNKKFHSFKKIVRSLGY-----------------------------------------------------
Y286_HAEIN      DGA-------------------------------------------------------------------
HIS82_GLUOX     GAQ---SAIELTHR--YDNLLVVQTLSKSYAAGLRVGFAIGSPELIEGLIRVK-----------------
HIS81_ANASP     AEESALNLVQ-----DHENVILIRTLSKGYSAGLRLGFGVGNPQLLNGLFKVK-----------------
ALAT1_MOUSE     AESQFHSFKKVLTEMGPP----------------------------------------------------
HIS8_GEOBB      AE---ETSLELVR--SFDNVVVTRTFSKSYSAGMRLGLAIARPEIIAAL---------------------
HIS8_CHLCH      ERSMVDTIEEL------PNVVVLRTMSKALAAGIRIGFALANAPLMAEISKPK-----------------
HIS8_ACISJ      SRSWIERMRAQPERNGH--VLLMRTLSKFGLAGVRLGYMIG-PAAL------------------------
DAPAT_LEPBL     SEPGVPSIYEVA--GAKEVAIEFRSFSKTAGTGLRCAYIVI-PKELKGRTRGGEEVSIHTTKFNG--VSY
DAPAT_LEPBJ     SEPGVPSIYEVA--GAKEVAIEFRSFSKTAGTGLRCAYIVI-PKELKGRTRGGEEVSIHTTKFNG--VSY
AAT_STRGR       ----------------------------------------------------------------------
AAT_MYCTU       DDAKHISLASIA----------------------------------------------------------
AAT_MYCBO       DDAKHISLASIA----------------------------------------------------------
HIS8_UNCMA      GKTALELMKE------------------------------------------------------------
DAPAT_DESAP     DGYRPPSFLEVAREVG------------------------------------------------------
CBL_MYCTU       SGAR------------------------------------------------------------------
CBL_MYCBO       SGAR------------------------------------------------------------------
HIS8_RHOPB      GKNDYESGIELVSTT--DNTVVTRTFSKI-----------------------------------------
HIS8_MYCS2      --SSQPSAVALLDD--YPAKLVVSTMSKAFAAGGRLGYLAAAPAVIDALL--------------------
HIS8_MARMM      DNPDYEAGIELARER--DDVIVTRTFSKI-----------------------------------------
HIS8_CAMLR      FKDSKKHINPKELIHKFQNAVYLGTFSKLYGGGMRVGYGIACKEII------------------------
DAPAT_METTH     QEDGIPSIYEV--EGAREVAIEFRSFSKNAGTGTRCAFTVV-PEELE--VPDSSGR-MHS-------VRE
HIS8_FRAP2      NEKSVSSIIN-----KYENLVVLRTLSKSFGAGLRLGVVITNSDRI------------------------
HIS8_ACIBT      GAESAVSLIN-----RYENLVVCQTTSKSRSAGLRVGFAIAQSHLIAALETVK-----------------
HIS8_ACIB5      GAESAVSLIN-----RYENLVVCQTTSKSRSAGLRVGFAIAQSHLIAALEAVK-----------------
HIS8_ACIB3      GAESAVSLIN-----RYENLVVCQTTSKSRSAGLRVGFAIAQSHLIAALEAVK-----------------
HIS82_ANASP     SQNTLVS--ELAQR---PNWIILRTFSKAFRAAMRVGYCVAHPEAIAILEKVR-----------------
YBDL_ECOLI      SQQGHASV--LAHPQLRERAVAVSSFGKTYMTGWKVGYCVA-----------------------------
MALY_ECOLI      GEQPHIPWSNVAR--GDWALLTSGSKSFNI-PALTGAYGIENSSSRDAYLSALKGRDLSSPSVLALTAHI
HIS8_GEOSM      AE---ETSLDLVR--SFDNVVVTRTFSKSYSAGMRLGLAIARPELIAAL---------------------
HIS8_ACIBY      GAESAVSLIN-----RYENLVVCQTTSKSRSAGLRVGFAIAQSHLIAALEAVK-----------------
HIS8_ACIBC      GAESAVSLIN-----RYENLVVCQTTSKSRSAGLRVGFAIAQSHLIAALEAVK-----------------
DAPAT_SYNS9     QDPEIPSIFEI--EGARECAIEFRSFSKNAGTGTRCAFTVV-PKGLKGTAANGELVELQSTKFNG--VSY
DAPAT_DESPS     QDDTLPSIYEI--EGADKVAIEFRSFSKNAGTGTRCAYTVV-PKACMAYDSEGNSHSLHS----------
BNA3_YEAST      TDS-------------------------------------------------------------------
1A1C_SOYBN      SHPSFISIAEILEERNLVHIVY--SLSKDMGPGFRVGIIYSYNDAVVHCARKMSSFGLVSTQTQYLLASM
HIS81_ARCFU     ----------------------------------------------------------------------
DAPAT_ARATH     SDDNPRSIFEIAEEV----AMETASFSKYAGTGVRLGWTV------------------------------
CSD_CHLPN       ----------------------------------------------------------------------
1A17_ARATH      HASEFTSVAEIVENIDDVSVVY--SLSKDLGPGFRVGTIYSYNDNVVRTARRMSSFTLVSSQTQHMLASM
HIS8_SULTO      TVAKLIN--------KYPNLLIVRTLSKAFSASYRVGYLIGNEEVIKNLMKGATPFDISLP---------
HIS8_COLP3      NKELGAEQVNIKLISQYDNVIILRTLSKAFAAGLRCGFTLSNKAVITLL---------------------
DAPAT_PARUW     SSHIPRSIYEI--EGAKEVAIEVGSFSKMIGTGVRLGWSV------------------------------
YDT4_SCHPO      VPVRLATL----RPELFKHVVTVGSGGKTFGTGWRVGWLI------------------------------
HIS8_MYCSM      ----------------------------------------------------------------------
HIS8_LACLA      GETCLPLLKK------YDNLVVVQTFSKSRSAGIRLGVAYGSAEAISHLYDVK-----------------
ALAM_DICDI      KESK------------------------------------------------------------------
1A11_ORYSJ      AE--------------------------------------------------------------------
1A11_ORYSI      AE--------------------------------------------------------------------
HIS8_ACIBS      GAESAVSLIN-----RYENLVVCQTTSKSRSAGLRVGFAIAQSHLIAALEAVK-----------------
HIS8_ACIAC      ----------------------------------------------------------------------
HIS82_BURPS     ----------------------------------------------------------------------
HIS82_BURP1     ----------------------------------------------------------------------
HIS82_ANAVT     EFSQTTLISELVQR---PNWVILRTFSKAFRAAMRVGYCVAHPEAIAILEKVRLPYNLPSFSITSALV--
HIS81_BURMA     ----------------------------------------------------------------------
DAPAT_DESAH     RDDTLPSIYEI--EGAKEVAVEFRSFSKTAGTGTRCAYTVV-PKACRVFDQKGAAIALH-PLWNR-----
HIS8_CAMJR      FKDSKKHLCELIKE--FDNVLYLGTFSK------------------------------------------
HIS8_CAMJJ      FKDSKKHLCELIKE--FDNVLYLGTFSK------------------------------------------
HIS8_CAMJ8      FKDSKKHLCELIKE--FDNVLYLGTFSK------------------------------------------
1A1C_PHAAU      SQPGFISIAEILEECDRNLVHIVYSLSKDMGPGFRVGIIYSYNDAVVNCARKMSSFGLVSTQTQYLLASM


                         .         *         .         .         .         .         +:350
query           LLKEGFSXXXXXXXXXXXXKAQAMLHALDREVPKEVRYTRPKGGMFVWMELPKGLSAEGLFRRALEENVA
Y104_SULSO      AIRRGIQNNLPKIRRVYKEKRDVMLEAIETYFPNDARWTKPVGGMFVFAWLPQKIDTTKMLEKALQRGVA
YISV_BACSU      WLSQGYEEHLTWVRRKLKERRDAAVHFLERYAGDIATWRIPAGGFYIWVTFHKNLPVSRFFYELLKRQVL
AADAT_HUMAN     LLEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKV-KGINKELIEEKAVKMGVL
YDCR_ECOLI      LSTRRYDAHXXXXXXQLAERKQRAWQALLRYLPAEVKIHHNDSGYFLWLELPEPLDAGELSLAALTHHIS
AADAT_RAT       LLEEGFLAHVDRAIDFYKNQRDFILAAADKWLRGLAEWHVPKAGMFLWIKVNGISDAKKLIEKAIEREIL
AATR2_DICDI     LLNEKWNQHISFIQRFYLEKRNQMIDSIDKHLKGLVEFNIPSAGMFIWFKLPVEDSKTLIFKNAVEKKIL
YDFD_BACSU      WFTSGYQQHVEKVRQQLKVRRELALSALETHLKEVATWNIPKGGFFVWIKILPSISMKLLYTKALSKGIL
AADAT_MOUSE     LLEEGFLAHIDRTIDFYKNQRDSILAAADKWLRGLAEWHVPKAGMFLWIKV-KGISKQLIEEKAIEREVL
MOCR_RHIME      FISEGYFATHLRRMRRLYAERQKVFVALRRHLADWLTIDENDAGMQLVARFTRALEDEVLWRAAQGQGVN
AADAT_BOVIN     LLEEGFLGHVDRVIDFYRKQRDALMAAADKWLSGLAEWHVPTAGMFLWVKI-KGIHRKLIEEKAFKKEIF
AATR3_SCHPO     ILQNGFLEWLQDLQNSYTMRRNALLLAADKHLPKSVKYHSPKAGLFLWVELDK-----------------
YJIR_ECOLI      FVLEGHYHRHIRRMRQIYQRNLALYTCWIREYPCEICITRPKGGFLLWIELPEQVDMVCVARQLCRMKIQ
AATR1_SCHPO     MFKDGYLEWLKHIRYSYTLRRNYLLYAMDTYLPKSVSYIPPVAGMFIWFEVDK-----------------
NORG_STAAC      MLKKSYDKHLVKLRYVLKDKRDFMLNILNNLFKDIAHWEVPSGGYFVWLVFKIDIDIKYLFYELLSKEKI
NORG_STAA8      MLKKSYDKHLVKLRYVLKDKRDFMLNILNNLFKDIAHWEVPSGGYFVWLVFKIDIDIKYLFYELLSKEKI
NORG_STAA3      MLKKSYDKHLVKLRYVLKDKRDFMLNILNNLFKDIAHWEVPSGGYFVWLVFKIDIDIKYLFYELLSKEKI
NORG_STAAN      MLKKSYDKHLVKLRYVLKDKRDFMLNILNNLFKDIAHWEVPSGGYFVWLVFKIDIDIKYLFYELLSKEKI
NORG_STAAM      MLKKSYDKHLVKLRYVLKDKRDFMLNILNNLFKDIAHWEVPSGGYFVWLVFKIDIDIKYLFYELLSKEKI
AATR1_DICDI     LLDEKFDSHVNFVQEVLIRKRRETIELLEKHLKGQVEYSVPKAGLYFWVKL-------------------
NORG_STAAB      MLKKSYDKHLVKLRYVLKDKRDFMLNILNNLFKDIAHWEVSSGGYFVWLVFKIDIDIKYLFYELLSKEKI
AATR2_SCHPO     MLQEGFCAWLQELQYSYTVRRNAFLNVANKYLPNSVIYHVPRAGLFLWVELKKSVSEMEIFLALVEKGVK
YDEL_BACSU      FIKNGWQKHINRMRKLYRKKRAIVLEAVQRELGEHVRIRGENSGLRILLDVYLPFGEKELIEKAKKHGVK
YCXD_BACSU      YLKSGMYGRHKEKIRDSYKERSLRLHQAIRTHRQSGRFTFSSGQMHTHLVLPQDLPASRVIHRLEKQGVL
YHDI_BACSU      FIETGWQKHINRMRSLYRKKHAVLLEAIRSELGNTVEILGKNSGLHILLRLLFPASEEEAIQAAADHGVT
GABR_BACSU      ----------------------------------------------------------------------
ARO9_YEAST      TIK-------------------------------------------------------------------
DAPAT_DESDG     ALRDG-DAFLAEIRDIYRKRRDTVIAALNK---IGITCRVPEASLYVWARVPEGYTSSDFVTRVLQEGVV
DAPAT_CARHZ     AL-EGPQDVVKELCDLYAQRRDLVIETLNK---LGWNLSKPKGTFYIWAPVPKGFTSASFAEYLIEKGVV
AAT_AQUAE       ALKNPKSKDFVNEMRNAFERRRDTAVEELSKIP-GMDVVKPEGAFYIFPDFSAYAEKLGLSEFLLEKKVA
HIS8_ERWCT      ----------------------------------------------------------------------
ARO8_YEAST      TLQKGYLDWLLGLRHEYTLKRDCAIDALYKYLPQSDAFNPPIAGMFFTVNIDASVHPESLYHKVVERGVL
DAPAT_DEHE1     AL-NGSQDVISQNCAVYQRRRDRLVEAL-RNIGMEV--TAPKASLYIWAPVPEGYTSAS-FATELLDKXX
AAT_THEAQ       ALREASMAFIAMAREAYRKRRDLLLEGLSRIGLEAV---RPSGAFYVLMDTPFAPNEVEAAERLLMAGVA
AAT_PYRHO       ALRSEESWKAVEEMKKEYNERRKIVVKRLKNMP-GIKVKEPKGAFYVFPNISTGMSSEKFSEWLLEKRVV
AAT_SULSO       AAVKAFDTFDEVNQMVSLFKKRRDVMYDELTKVKGVEVSKPNGAFYMFPNVSKILKTSGFDVKSLEKGVV
AAT_THEMA       AALKALEVDNSYMVQTFKERKNFVVERLKK---MGVKFVEPEGAFYLFFKV-RGDDVKFCERLLEEKKVA
AAT_PYRAB       ALRDERSWKAVEEMRKEYDRRRKLVWKRLNEM--GLPTVKPKGAFYIFPRIDTGLTSKEFSELMLEAKVA
HIS8_PECCP      LSREGIA---------------------------------------------------------------
AAT_THET8       ALQEASRAFVEMAREAYRRRRDXXXXXXXXXXXKAV---RPSGAFYVLMDTPIAPDEVRAAERLLEAGVA
AAT1_BACSU      ----GAIAAYNGPSEPLEEMREAFEHRLNTIYAKLIEIVKPEGAFYLFPNAKEAAQSCGFFVKALEEKVA
HIS8_CHLTE      ----------------------------------------------------------------------
HIS8_BLOPB      ----------------------------------------------------------------------
HIS8_BACHD      ----------------------------------------------------------------------
HIS8_ANADF      ----------------------------------------------------------------------
DAPAT_DEHSB     AL-NGSQEIINQNCAIYQRRRDRLVEAL-RNIGMEV--TAPKASLYIWAPVPESYTSAS-FATELLDKXX
DAPAT_DESVH     ALRDG-DDFCRELRGIYRQRRDTVINALHK---AGIQCRVPQATFYVWARVPQGHTSADFVTRVLQEGVV
YEY2_YEAST      MLRSGAARCIAHLRSVYSERATVLTSALKKYMPLGTEIMPLKGGYFTWITLPPAYNAMEISTLAKKFNVI
HIS8_HALWD      ----------------------------------------------------------------------
DAPAT_DEHSC     AL-NGSQEIINQNCAIYQRRRDRLVESL-RNIGMEV--TAPKASLYIWAPVPESYTSAS-FATELLDKXX
HIS82_NITMU     ----------------------------------------------------------------------
DAPAT_DESVV     ALRDG-DDFCRELRGIYRQRRDTVITALHK---AGIQCRVPQATFYVWARVPQGHTSADFVTRVLQEGVV
HIS8_WOLSU      TIKENF----------------------------------------------------------------
HIS81_MANSM     ----------------------------------------------------------------------
HIS8_THEGJ      ----------------------------------------------------------------------
HIS81_RALEJ     ----------------------------------------------------------------------
YFDZ_ECOLI      AL-EGDQQCVRDIAEQYKRRRDVLVKGL-HEAGWMVE--MPKASMYVWAKIPEPYAAMGFAKKLLNEAKV
HIS8_PSEST      ----------------------------------------------------------------------
AAT_STRVG       AV-SGNLDAVAEMRKAFDRRRQTMVKMLNEPTPEGAFYAYPSVKELLGKEIRGKRPQSSVELAALEVEVA
HIS8_MOOTA      ----------------------------------------------------------------------
YDEF_BACSU      IVSNQF----------------------------------------------------------------
HIS8_SULNB      ----------------------------------------------------------------------
DAPAT_SYNFM     AL-EGDQGCVVEMQRIYKERLDILIEGLKRGLHPEV----PRATFYVWCPTPPGYSSKDFSSLLLREGIV
DAPAT_HALOH     AL-TGPEDNIEKMTELYSKRRDLLVEGL-RELGWEVPVN--KATFYIWAKVPEGYNSTEFSTHVFEKGIF
HIS8_BREBN      ALKD------------------------------------------------------------------
AAT_BACST       ----------------------------------------------------------------------
HIS8_THETN      VLKSG-----------------------------------------------------------------
HIS82_RALSO     ----------------------------------------------------------------------
DAPAT_DESAD     ALKEG-EPYVKEFRKIYKERRDCVIEALEKI---NISCKVPDASIFVWAKTPEGYTSSEFVSKLLKEGVV
HIS8_VIBCH      ----------------------------------------------------------------------
HIS8_THEP3      VLRTG-----------------------------------------------------------------
HIS8_SYMTH      ----------------------------------------------------------------------
DAPT2_ANAVT     ----------------------------------------------------------------------
AAT_SULTO       ----------------------------------------------------------------------
HIS8_SALPK      ----------------------------------------------------------------------
HIS8_SALPA      ----------------------------------------------------------------------
HIS8_SALDC      ----------------------------------------------------------------------
AATC_RHIME      AL-NGDGSDIAEVRAIYKRRRDVMVESFGKEVPP------PPATMFAWAKIPEKFRHLGSFSKLLVEDVA
AAT_BACY2       AYN--------GPQDSVEEMRKAFESRLETIYPKGFKVVKPQGAFYLLPDVSEAAQKTGFFASALEANVA
HIS8_VIBPA      ----------------------------------------------------------------------
HIS8_THEPX      VLR-------------------------------------------------------------------
HIS8_SALTY      ----------------------------------------------------------------------
HIS8_SALTI      ----------------------------------------------------------------------
HIS8_SALSV      ----------------------------------------------------------------------
HIS8_SALPC      ----------------------------------------------------------------------
HIS8_SALPB      ----------------------------------------------------------------------
HIS8_SALNS      ----------------------------------------------------------------------
HIS8_SALHS      ----------------------------------------------------------------------
HIS8_SALG2      ----------------------------------------------------------------------
HIS8_SALEP      ----------------------------------------------------------------------
HIS8_SALA4      ----------------------------------------------------------------------
HIS81_NITOC     ----------------------------------------------------------------------
DAPT2_ANASP     ----------------------------------------------------------------------
HIS8_VIBCM      ----------------------------------------------------------------------
HIS8_VIBC3      ----------------------------------------------------------------------
HIS8_PYRKO      ----------------------------------------------------------------------
HIS8_DESHY      ----------------------------------------------------------------------
DAPAT_AQUAE     ----------------------------------------------------------------------
Y1527_METMP     ----------------------------------------------------------------------
PATA_BACSU      AVTNGFDDALIMREQY----KKRLDYVYDRLVSMGLDVVKPSGAFYIFPSIKSGMTSFDFSMALLEDGVA
HIS81_DECAR     ----------------------------------------------------------------------
HIS8_SODGM      ----------------------------------------------------------------------
HIS8_SALCH      ----------------------------------------------------------------------
HIS8_ANOFW      ----------------------------------------------------------------------
HIS82_THICR     ----------------------------------------------------------------------
HIS82_HAEIN     ----------------------------------------------------------------------
HIS8_ENTS8      ----------------------------------------------------------------------
HIS8_CLONN      ILKD------------------------------------------------------------------
HIS82_ARCFU     ----------------------------------------------------------------------
DAPAT_GLOVI     XXXFGLDDERLHALMAVYQNRRNIIVEGLRSLPLEA----PKATLYVWAPIPKSFGSSVEFVGALLDKCG
HIS8_PHOLL      ----------------------------------------------------------------------
PATR_MYCA9      ----------------------------------------------------------------------
HIS8_PROA2      ----------------------------------------------------------------------
HIS82_HAEI8     ----------------------------------------------------------------------
AAT1_METJA      YSFACATTFAQYGALAALRGSQKCVEDMVREFKKDIKVNKPDGAFYIFPDVSEYGDGVEVAKKLIENKVL
HIS8_ECO45      ----------------------------------------------------------------------
HIS8_CLOCE      ----------------------------------------------------------------------
HIS81_THIDA     ----------------------------------------------------------------------
Y1391_METJA     ----------------------------------------------------------------------
PATR_MYCVP      ----------------------------------------------------------------------
PATR_MYCPA      ----------------------------------------------------------------------
HIS8_XYLFA      ----------------------------------------------------------------------
HIS8_SHIFL      ----------------------------------------------------------------------
HIS8_SHIF8      ----------------------------------------------------------------------
HIS8_SHIDS      ----------------------------------------------------------------------
HIS8_ECOK1      ----------------------------------------------------------------------
HIS8_ECO81      ----------------------------------------------------------------------
HIS8_ECO5E      ----------------------------------------------------------------------
HIS8_ECO57      ----------------------------------------------------------------------
HIS8_ECO55      ----------------------------------------------------------------------
HIS82_BORPA     ----------------------------------------------------------------------
HIS82_BORBR     ----------------------------------------------------------------------
PATR_MYCA1      ----------------------------------------------------------------------
HIS8_XYLFT      ----------------------------------------------------------------------
HIS8_XYLFM      ----------------------------------------------------------------------
HIS8_XYLF2      ----------------------------------------------------------------------
HIS8_SHIBS      ----------------------------------------------------------------------
HIS8_PELLD      ----------------------------------------------------------------------
HIS8_METFL      ----------------------------------------------------------------------
HIS82_METCA     LEDTGF----LEATVQANDAGRSQLEAGFRERGFDF---IPSAGNFVSFDL--GRPATPVFDALLREGVI
PATR_MYCSS      ----------------------------------------------------------------------
PATR_MYCSK      ----------------------------------------------------------------------
PATR_MYCSJ      ----------------------------------------------------------------------
HIS8_YERPY      ----------------------------------------------------------------------
HIS8_YERPP      ----------------------------------------------------------------------
HIS8_YERPN      ----------------------------------------------------------------------
HIS8_YERPG      ----------------------------------------------------------------------
HIS8_YERPE      ----------------------------------------------------------------------
HIS8_YERPA      ----------------------------------------------------------------------
HIS8_YERP3      ----------------------------------------------------------------------
HIS8_SALAR      ----------------------------------------------------------------------
HIS8_LEPIN      ----------------------------------------------------------------------
HIS8_LEPIC      ----------------------------------------------------------------------
HIS8_KLEP3      ----------------------------------------------------------------------
HIS8_BLOFL      ----------------------------------------------------------------------
HIS8_RHISN      ----------------------------------------------------------------------
HIS8_PSEE4      ----------------------------------------------------------------------
HIS8_ESCF3      ----------------------------------------------------------------------
HIS8_ECOUT      ----------------------------------------------------------------------
HIS8_ECOSE      ----------------------------------------------------------------------
HIS8_ECOLI      ----------------------------------------------------------------------
HIS8_ECOLC      ----------------------------------------------------------------------
HIS8_ECOL6      ----------------------------------------------------------------------
HIS8_ECOL5      ----------------------------------------------------------------------
HIS8_ECOHS      ----------------------------------------------------------------------
HIS8_ECODH      ----------------------------------------------------------------------
HIS8_ECOBW      ----------------------------------------------------------------------
HIS8_ECO8A      ----------------------------------------------------------------------
HIS8_ECO27      ----------------------------------------------------------------------
HIS8_ECO24      ----------------------------------------------------------------------
HIS8_CHLL2      ----------------------------------------------------------------------
HIS8_ARATH      ----------------------------------------------------------------------
HIS82_NITEU     ----------------------------------------------------------------------
HIS82_MANSM     ----------------------------------------------------------------------
PDXR_CORGL      ----------------------------------------------------------------------
HIS8_LYSSC      ----------------------------------------------------------------------
HIS8_AERHH      ----------------------------------------------------------------------
Y3073_RHOS4     ----------------------------------------------------------------------
HIS8_YERPS      ----------------------------------------------------------------------
HIS8_YERPB      ----------------------------------------------------------------------
HIS8_VIBFM      ----------------------------------------------------------------------
HIS8_SHISS      ----------------------------------------------------------------------
HIS8_YERE8      ----------------------------------------------------------------------
HIS8_PSEPK      ----------------------------------------------------------------------
HIS8_KLEP7      ----------------------------------------------------------------------
HIS8_CITK8      ----------------------------------------------------------------------
HIS8_VIBHB      ----------------------------------------------------------------------
HIS8_PYRFU      ----------------------------------------------------------------------
HIS8_PSEPW      ----------------------------------------------------------------------
HIS82_PASMU     ----------------------------------------------------------------------
HIS82_BORPE     ----------------------------------------------------------------------
PATR_MYCS2      ----------------------------------------------------------------------
HIS8_ECO7I      ----------------------------------------------------------------------
HIS8_BACLD      ----------------------------------------------------------------------
HIS81_IDILO     ----------------------------------------------------------------------
HIS8_VIBF1      ----------------------------------------------------------------------
HIS8_SHIB3      ----------------------------------------------------------------------
HIS8_SERP5      ----------------------------------------------------------------------
HIS8_PSEP1      ----------------------------------------------------------------------
HIS8_PELPB      ----------------------------------------------------------------------
HIS8_NITSB      ----------------------------------------------------------------------
HIS8_METTH      ----------------------------------------------------------------------
HIS8_ECOLU      ----------------------------------------------------------------------
HIS8_CHLP8      ----------------------------------------------------------------------
HIS8_CALS8      ----------------------------------------------------------------------
PATR_RHOSR      ----------------------------------------------------------------------
HIS8_TOBAC      ----------------------------------------------------------------------
HIS8_PSEPG      ----------------------------------------------------------------------
HIS8_ENT38      ----------------------------------------------------------------------
HIS81_PASMU     ----------------------------------------------------------------------
AAT_SULAC       AAVSAFDTFDDVKKMIDTFKKRRDVMYSELKKIKGIQVNKSQGAFYMFPYLGEILRKSGMSTKDFEKGVV
HIS8_NICPL      ----------------------------------------------------------------------
HIS8_METPP      ----------------------------------------------------------------------
HIS8_LEPBL      ----------------------------------------------------------------------
HIS8_LEPBJ      ----------------------------------------------------------------------
HIS81_BACC1     ----------------------------------------------------------------------
HIS8_ROSCS      ----------------------------------------------------------------------
HIS8_NOVAD      ----------------------------------------------------------------------
HIS8_ECOSM      ----------------------------------------------------------------------
PATR_STRCO      ----------------------------------------------------------------------
HIS8_DESPS      ----------------------------------------------------------------------
HIS8_VIBVY      ----------------------------------------------------------------------
HIS8_VIBVU      ----------------------------------------------------------------------
HIS8_LACPL      ----------------------------------------------------------------------
HIS8_STRMK      ----------------------------------------------------------------------
HIS8_PROVI      ----------------------------------------------------------------------
HIS8_HALLT      ----------------------------------------------------------------------
HIS8_SULDN      ----------------------------------------------------------------------
DAPAT_MOOTA     ----------------------------------------------------------------------
HIS8_METST      FIKE------------------------------------------------------------------
HIS8_GEOKA      ----------------------------------------------------------------------
HIS8_AZOSE      ----------------------------------------------------------------------
HIS81_PSEF5     ----------------------------------------------------------------------
HIS8_LISIN      AIKD------------------------------------------------------------------
HIS81_LEGPL     ----------------------------------------------------------------------
HIS8_ACEPA      ----------------------------------------------------------------------
AAT_PYRKO       LIKE-----VRRAYLERVRMASKMLRGFD--------FVEPEGAFYIFLRTPQ--DGMAFAERLLSRGVA
HIS8_XANCB      QALSAPALAVTQRRVTEIRAERARLHAALVQV-AGVRQVYPSQGNFLLVRFD---DAEAAFQALLEAGV-
HIS8_GEOSW      ----------------------------------------------------------------------
HIS8_DESHD      ----------------------------------------------------------------------
HIS8_BUCSC      ----------------------------------------------------------------------
HIS81_PSEPF     ----------------------------------------------------------------------
PATR_STRGG      ----------------------------------------------------------------------
HIS8_BUCAP      ----------------------------------------------------------------------
HIS8_BACCN      ----------------------------------------------------------------------
HIS8_AERS4      ----------------------------------------------------------------------
HIS82_BACAN     ----------------------------------------------------------------------
DAPAT_DESVM     ALRDG-DDFCRELRGIYRKRRDVVVAALNK---VGIACRVPTAAFYIWAKVPAGYGSSAEFVTAVLEGVV
HIS8_MACCJ      ----------------------------------------------------------------------
HIS8_HALMA      ----------------------------------------------------------------------
HIS8_AKKM8      ----------------------------------------------------------------------
HIS81_LEGPH     ----------------------------------------------------------------------
DAPAT_DESDA     AAEAVYSERGQSEIMGIIAGYQAMLRTAASEMGFAV-----YGGVYIWLRVPDNTDSWGFFDRLLQQGLV
HIS8_PSEU2      ----------------------------------------------------------------------
HIS8_LISMF      AIKD------------------------------------------------------------------
HIS8_GEOTN      ----------------------------------------------------------------------
HIS8_SYNJB      ----------------------------------------------------------------------
HIS8_ROSDO      ----------------------------------------------------------------------
HIS8_PHOPR      ----------------------------------------------------------------------
HIS8_LISMC      AIKD------------------------------------------------------------------
HIS8_HAEIG      ----------------------------------------------------------------------
HIS8_HAEIE      ----------------------------------------------------------------------
HIS8_BUCDN      ----------------------------------------------------------------------
HIS8_BACSU      ----------------------------------------------------------------------
HIS82_BACCZ     ----------------------------------------------------------------------
HIS81_HAEIN     ----------------------------------------------------------------------
1A112_ARATH     LLSD------------------------------------------------------------------
PATR_NOCFA      ----------------------------------------------------------------------
HIS8_XANAC      ALE------VTRRRIAEVRSERERMHKALVQLP-GVRQVYPSQGNFLLVRFD---DAEGAFQALLEAGV-
HIS8_LISW6      AIKD------------------------------------------------------------------
HIS8_LISMH      AIKD------------------------------------------------------------------
HIS8_DEHSC      ----------------------------------------------------------------------
HIS8_DEHSB      ----------------------------------------------------------------------
HIS8_BACNA      ----------------------------------------------------------------------
HIS8_ALISL      ----------------------------------------------------------------------
HIS82_DECAR     ----------------------------------------------------------------------
HIS81_LEGPA     ----------------------------------------------------------------------
HIS8_ROSS1      ----------------------------------------------------------------------
HIS8_PSESM      ----------------------------------------------------------------------
HIS8_DEHE1      ----------------------------------------------------------------------
PATR_MYCTU      ----------------------------------------------------------------------
PATR_MYCTA      ----------------------------------------------------------------------
PATR_MYCBT      ----------------------------------------------------------------------
PATR_MYCBP      ----------------------------------------------------------------------
PATR_MYCBO      ----------------------------------------------------------------------
HIS8_LISMO      AIKD------------------------------------------------------------------
HIS8_BACP2      ----------------------------------------------------------------------
ALAT_SCHPO      ----------------------------------------------------------------------
AAT2_METJA      AFEK-----------ETEREINSMIKEFDRRRRLVLKYVKPIGAYYVFPNIGED-GREFAYKLLKEKFVA
HIS8_METM5      ----------------------------------------------------------------------
HIS81_HAEI8     ----------------------------------------------------------------------
HIS81_BACCR     ----------------------------------------------------------------------
HIS81_ANAVT     ------AITDQAYKNSCVAKVKASRTQLTKDLKQLGFHVWDSHGNFLLTKPPEG-NAEYLYEKLKEQKIL
HIS8_XANC5      ----------------------------------------------------------------------
HIS8_STAS1      ----------------------------------------------------------------------
HIS8_CHLPD      ----------------------------------------------------------------------
HIS81_BACHK     ----------------------------------------------------------------------
HIS81_BACAN     ----------------------------------------------------------------------
PATR_RHOE4      ----------------------------------------------------------------------
PATR_PROAC      ----------------------------------------------------------------------
HIS81_BACCZ     ----------------------------------------------------------------------
HIS8_HELHP      ----------------------------------------------------------------------
HIS8_GEOSF      ----------------------------------------------------------------------
HIS8_BAUCH      ----------------------------------------------------------------------
HIS8_STAHJ      ----------------------------------------------------------------------
HIS8_NEIMB      ----------------------------------------------------------------------
ATTY_RAT        ----------------------------------------------------------------------
ATTY_DICDI      ----------------------------------------------------------------------
PATR_STRAW      ----------------------------------------------------------------------
HIS8_CHRSD      ----------------------------------------------------------------------
ATTY_HUMAN      ----------------------------------------------------------------------
ATTY_BOVIN      ----------------------------------------------------------------------
HIS8_PARDP      ----------------------------------------------------------------------
HIS8_NEIMF      ----------------------------------------------------------------------
HIS8_NEIMA      ----------------------------------------------------------------------
HIS8_NEIM0      ----------------------------------------------------------------------
HIS81_PSYA2     ----------------------------------------------------------------------
HIS81_METCA     ----------------------------------------------------------------------
HIS8_LACF3      ----------------------------------------------------------------------
ATTY_MOUSE      ----------------------------------------------------------------------
ALAM_YEAST      ----------------------------------------------------------------------
1A16_ARATH      LSDEEF-------VDEFIRESKLRLAARHAEITTGIGWLKAKAGLFLWMDLRNLLSETELWRVIVHQKLN
HIS8_CAMC1      ----------------------------------------------------------------------
HIS82_IDILO     ----------------------------------------------------------------------
HIS81_CARHZ     ----------------------------------------------------------------------
AVTA_ECOLI      MIKRNLRLSETVIKPFYYQRVQETIAIIRRYLPERCLIHKPEGAIFLWLDLP--ITTKQLYQRLKARGVL
HIS8_SULSO      ----------------------------------------------------------------------
HIS8_MYCSS      ----------------------------------------------------------------------
HIS8_MYCSK      ----------------------------------------------------------------------
HIS8_MYCSJ      ----------------------------------------------------------------------
HIS8_METMP      ----------------------------------------------------------------------
HIS8_BUCMH      ----------------------------------------------------------------------
DAPAT_SYNY3     KFNGVSYIIQRGAEAVYSPEGQAQVQELIAFYLENARIIREKGGIYVWVKTPHGLSSWDFFDKLLHTNVV
DAPAT_NATTJ     ALEN------RHEYIPDILKAYKERRDLVIEFLEEAGFYHPKATFYVWAQVPGNQDSFNFTKSLLKTGVV
HIS8_METVS      ----------------------------------------------------------------------
HIS8_GEOSL      ----------------------------------------------------------------------
HIS8_DINSH      ----------------------------------------------------------------------
CBL_BACSU       VIEAAYSKGGPWLDELITYIEKNMNEALSTELPK-VKMMKPDASYLIWLDFSAGLSDAELQQRMLKKKVI
AAT_RICBR       AL-NGVQGYIAQNALNFEKKRDLALSILQR--VKYFECYKPEGAFYLFIKCDKIFGAKTKSGKVIEAKVA
HIS8_PELCD      ----------------------------------------------------------------------
HIS8_NEIG2      ----------------------------------------------------------------------
HIS8_NEIG1      ----------------------------------------------------------------------
HIS8_HALVO      ----------------------------------------------------------------------
HIS8_HALSA      ----------------------------------------------------------------------
HIS8_HALS3      ----------------------------------------------------------------------
HIS82_THIDA     ----------------------------------------------------------------------
HIS82_CAUCR     ----------------------------------------------------------------------
COBD_THETN      ----------------------------------------------------------------------
HIS8_PSEA6      LSSEG-----------------------------------------------------------------
HIS8_MYCUA      ----------------------------------------------------------------------
HIS8_METM7      ----------------------------------------------------------------------
HIS8_METJA      ----------------------------------------------------------------------
HIS8_XANC8      QALSAPALAVTQRRVTEIRAERARLHAALVQV-AGVRQVYPSQGNFLLVRFD---DAEAAFQALLEAGV-
HIS8_STRMU      ----------------------------------------------------------------------
HIS8_POLNA      ----------------------------------------------------------------------
AAT_RICFE       SL-NGPQDYIKPNALNFQKKRDLALSILKR--VKYFECYKPEGAFYLFVKCDKIFNSNDFAEYLLEEKVA
AAT_RICCN       AL-NGPQDYIKPNALNCQKKRDLALSILKR--VKYFECYKPEGAFYLFVKCDKIFNSNDFAEYLLEEKVA
HIS8_MESSB      ----------------------------------------------------------------------
HIS8_CAMC5      ALKD------------------------------------------------------------------
HIS8_ARCB4      ----------------------------------------------------------------------
HIS81_RALSO     ----------------------------------------------------------------------
HIS81_BRAJA     ----------------------------------------------------------------------
DAPAT_PROMS     ----------------------------------------------------------------------
Y1479_METJA     ----------------------------------------------------------------------
PATR_MYCMM      ----------------------------------------------------------------------
HIS8_MYCMM      ----------------------------------------------------------------------
HIS81_RHILO     ----------------------------------------------------------------------
HIS81_GLUOX     ----------------------------------------------------------------------
PATR_MYCUA      ----------------------------------------------------------------------
KAT1_HUMAN      ----------------------------------------------------------------------
HIS8_GLUDA      ----------------------------------------------------------------------
HIS81_CAUCR     ----------------------------------------------------------------------
DAPAT_CLOPH     ----------------------------------------------------------------------
HIS8_STRGC      ----------------------------------------------------------------------
HIS8_BEII9      ----------------------------------------------------------------------
HIS81_PSEAE     ----------------------------------------------------------------------
HIS8_STRSV      ----------------------------------------------------------------------
HIS8_CLOBK      ----------------------------------------------------------------------
HIS8_CLOBH      ----------------------------------------------------------------------
HIS8_CLOB1      ----------------------------------------------------------------------
AAT_RICTY       AL-NGTQDYIKPNALNFQKKRDLALSILEKVIYFEC--YKPEGAFYLFVKCDKIFGTKTKSGKIIEAKVA
PATR_CORJK      ----------------------------------------------------------------------
HIS8_CLOBL      ----------------------------------------------------------------------
HIS8_CLOAB      ----------------------------------------------------------------------
HIS82_CARHZ     ----------------------------------------------------------------------
HIS82_BURS3     ----------------------------------------------------------------------
MTNE_BACSU      XXXXXXXXCVAEQNARYESRRNAWITAC-REIGWDV--TAPAGSFFAWLPVPEGYTSEQFSDLLLEK---
HIS8_VESOH      LLQE------------------------------------------------------------------
HIS8_RHOBA      ----------------------------------------------------------------------
HIS8_DESVV      ----------------------------------------------------------------------
HIS8_DESVH      ----------------------------------------------------------------------
ALA2_PANMI      ----------------------------------------------------------------------
AAT_RICPR       AL-NGTQDYIKSNALNFQKKRDLALSILE-----EVTYYKPEGAFYLFVKCDKIFGTKTKSGRIIEAKVA
HIS8_XANCP      QALSAPALAVTQRRVTEIRAERARLHAALVQV-AGVRQVYPSQGNFLLVRFD---DAEAAFQALLEAGV-
HIS8_STRAW      ----------------------------------------------------------------------
HIS8_RHORT      ----------------------------------------------------------------------
HIS8_HAHCH      ----------------------------------------------------------------------
HIS8_GEOUR      ----------------------------------------------------------------------
HIS8_GEOMG      ----------------------------------------------------------------------
HIS8_CLOB8      ----------------------------------------------------------------------
CBL_MYCLE       AFRTGSSWLDALLQGLEANR--ALLRDLVTKHLPGVRYQRPQGTYLTWLQINEGLAASGPARWFLDHSRV
ALAT_YEAST      ----------------------------------------------------------------------
KAT1_RAT        ----------------------------------------------------------------------
KAT1_MOUSE      ----------------------------------------------------------------------
HIS8_SILST      ----------------------------------------------------------------------
HIS8_LEUCK      ----------------------------------------------------------------------
HIS8_DIAST      ----------------------------------------------------------------------
YFBQ_SHIFL      ----------------------------------------------------------------------
YFBQ_ECOLI      ----------------------------------------------------------------------
YFBQ_ECOL6      ----------------------------------------------------------------------
HIS8_PSE14      ----------------------------------------------------------------------
HIS8_CLOB6      ----------------------------------------------------------------------
HIS8_CAMFF      ----------------------------------------------------------------------
ALA2_HORVU      ----------------------------------------------------------------------
Y286_HAEIN      ----------------------------------------------------------------------
HIS82_GLUOX     ----------------------------------------------------------------------
HIS81_ANASP     ----------------------------------------------------------------------
ALAT1_MOUSE     ----------------------------------------------------------------------
HIS8_GEOBB      ----------------------------------------------------------------------
HIS8_CHLCH      ----------------------------------------------------------------------
HIS8_ACISJ      ----------------------------------------------------------------------
DAPAT_LEPBL     VTQKGAEACYSPQGKKEIQASIAYYAAKIREGLKKAGY-EVFGGVYIWLKTSDNLSSWDFFDRLLDKQVV
DAPAT_LEPBJ     VTQKGAEACYSPQGKKEIQASIAYYAAKIREGLKKAGY-EVFGGVYIWLKTSDNLSSWDFFDRLLDKQVV
AAT_STRGR       ----------------------------------------------------------------------
AAT_MYCTU       ----------------------------------------------------------------------
AAT_MYCBO       ----------------------------------------------------------------------
HIS8_UNCMA      ----------------------------------------------------------------------
DAPAT_DESAP     ----------------------------------------------------------------------
CBL_MYCTU       ----------------------------------------------------------------------
CBL_MYCBO       ----------------------------------------------------------------------
HIS8_RHOPB      ----------------------------------------------------------------------
HIS8_MYCS2      ----------------------------------------------------------------------
HIS8_MARMM      ----------------------------------------------------------------------
HIS8_CAMLR      ----------------------------------------------------------------------
DAPAT_METTH     LWNRRQTTKFNGVSYPVQRAAEAVYTPEQREIRESIDYLRYYGGVYIWIRTPEGMDSWQFFDTLLNDEVV
HIS8_FRAP2      ----------------------------------------------------------------------
HIS8_ACIBT      ----------------------------------------------------------------------
HIS8_ACIB5      ----------------------------------------------------------------------
HIS8_ACIB3      ----------------------------------------------------------------------
HIS82_ANASP     ----------------------------------------------------------------------
YBDL_ECOLI      ----------------------------------------------------------------------
MALY_ECOLI      AAYQQGAPWLDALRIYLKDNLTYIADKMNAAFP-ELNWQIPQSTYLAWLDLPLNIDDNALQKALIEEKVA
HIS8_GEOSM      ----------------------------------------------------------------------
HIS8_ACIBY      ----------------------------------------------------------------------
HIS8_ACIBC      ----------------------------------------------------------------------
DAPAT_SYNS9     IIQRG-AEAVYSTAGQAEVKTLVSFYMENASIIRQLQIYGGEHAPYVWIKTPNGMDSWGFFDHLLNKNVV
DAPAT_DESPS     ----------------------------------------------------------------------
BNA3_YEAST      ----------------------------------------------------------------------
1A1C_SOYBN      LNDDEFVESFLVESAKRLAQRHRVFTGGLAKV--GIKCLQSNAGLFVWMDLRQLLSEMELWRVIIDEKIN
HIS81_ARCFU     ----------------------------------------------------------------------
DAPAT_ARATH     ----------------------------------------------------------------------
CSD_CHLPN       ----------------------------------------------------------------------
1A17_ARATH      LSDEEFT---------------------------------------------------------------
HIS8_SULTO      ----------------------------------------------------------------------
HIS8_COLP3      ----------------------------------------------------------------------
DAPAT_PARUW     ----------------------------------------------------------------------
YDT4_SCHPO      ----------------------------------------------------------------------
HIS8_MYCSM      ----------------------------------------------------------------------
HIS8_LACLA      ----------------------------------------------------------------------
ALAM_DICDI      ----------------------------------------------------------------------
1A11_ORYSJ      ----------------------------------------------------------------------
1A11_ORYSI      ----------------------------------------------------------------------
HIS8_ACIBS      ----------------------------------------------------------------------
HIS8_ACIAC      ----------------------------------------------------------------------
HIS82_BURPS     ----------------------------------------------------------------------
HIS82_BURP1     ----------------------------------------------------------------------
HIS82_ANAVT     ----------------------------------------------------------------------
HIS81_BURMA     ----------------------------------------------------------------------
DAPAT_DESAH     ----------------------------------------------------------------------
HIS8_CAMJR      ----------------------------------------------------------------------
HIS8_CAMJJ      ----------------------------------------------------------------------
HIS8_CAMJ8      ----------------------------------------------------------------------
1A1C_PHAAU      LNDDEF--VERFLAESAKRLAQRFRVFTGGLAKVGIKCLQSNAGLFVWMDL-------------------


                         .         .         .         .         *         .         .:420
query           FVPGGPFFANGGGENTLRLSYATLDREGIAExxxxxxxxxxxxxxxx
Y104_SULSO      YVPGSSFYADYSGKNTMRINFSFPKKEELIE----------------
YISV_BACSU      VNPG--YIYDGEDRNSIRLSYS-------------------------
AADAT_HUMAN     MLPGNAFYVDSSAPSPLRASFSSASPE--------------------
YDCR_ECOLI      IAPGKMF---STGENWSR-----------------------------
AADAT_RAT       LVPGNSFFVD-------------------------------------
AATR2_DICDI     LVPGISFSTDSTKPSQVRASYSTASKEQIDE----------------
YDFD_BACSU      INLGSIYAQEKG--NYIRLSYAYASLEDL------------------
AADAT_MOUSE     LVPGNGFFIDG------------------------------------
MOCR_RHIME      FSPLSRQFFHSPPQQGAILGYAGIDREGI------------------
AADAT_BOVIN     MLPGCGFYTD-------------------------------------
AATR3_SCHPO     -----------------------------------------------
YJIR_ECOLI      VAAGSIFSASGKYRNCLRINCA-------------------------
AATR1_SCHPO     -----------------------------------------------
NORG_STAAC      LI--NPGYIYGSKEKSIRLSFAFESNENI------------------
NORG_STAA8      LI--NPGYIYGSKEKSIRLSFAFESNENI------------------
NORG_STAA3      LI--NPGYIYGSKEKSIRLSFAFESNENI------------------
NORG_STAAN      LI--NPGYIYGSKEKSIRLSFAFESNENI------------------
NORG_STAAM      LI--NPGYIYGSKEKSIRLSFAFESNENI------------------
AATR1_DICDI     -----------------------------------------------
NORG_STAAB      LI--NPGYIYGSKEKSIRLSFAFESNENI------------------
AATR2_SCHPO     TVCGQFFMANPERSTKIRFAYSIADFEDFEE----------------
YDEL_BACSU      IYPVSLSYQHHPPTKTVSLGFAGVSESDIRE----------------
YCXD_BACSU      LAIDRHYLSDYPKENLLKINISNVKTEDI------------------
YHDI_BACSU      LYPVSPSYIEQTPFTSVLIGYGGLSEEDI------------------
GABR_BACSU      -----------------------------------------------
ARO9_YEAST      -----------------------------------------------
DAPAT_DESDG     MTPGNGFGA--AGEGYFRISLTVND----------------------
DAPAT_CARHZ     ITPGNGYGTNGEGYFRISLTIPT------------------------
AAT_AQUAE       VVPGSAF----GAPGFLRLSYA-LSEERLVE----------------
HIS8_ERWCT      -----------------------------------------------
ARO8_YEAST      VVPGSWFKSEGETE---------------------------------
DAPAT_DEHE1     XXXXXXXXXXXSGEGYIRLSLTVPDEQGIAK----------------
AAT_THEAQ       VVPGTEFAAFG----HVRLSYAT------------------------
AAT_PYRHO       VIPGTAF--GRMGEGYVRISYAT------------------------
AAT_SULSO       TIPGEVFPLNIGKE-FLRLSFAVNEKEGI------------------
AAT_THEMA       LVPGSAFLKPG----FVRLSFAT------------------------
AAT_PYRAB       VVPGSAF--GKAGEGYVRISYAT------------------------
HIS8_PECCP      -----------------------------------------------
AAT_THET8       VVPGTDFAAFG----HVRLSYAT------------------------
AAT1_BACSU      IVPGSGF----GSPENVRLSYAT------------------------
HIS8_CHLTE      -----------------------------------------------
HIS8_BLOPB      -----------------------------------------------
HIS8_BACHD      -----------------------------------------------
HIS8_ANADF      -----------------------------------------------
DAPAT_DEHSB     XXXXXXXXXXXAGEGYIRLSLTVPDEQGIAK----------------
DAPAT_DESVH     VTPGNGFGTPGEG----------------------------------
YEY2_YEAST      LADGSNFEVIGDGQSCFRLSISFLEVDDI------------------
HIS8_HALWD      -----------------------------------------------
DAPAT_DEHSC     XXXXXXXXXXXAGEGYIRLSLTVPDEQGIAK----------------
HIS82_NITMU     -----------------------------------------------
DAPAT_DESVV     VTPGNGFGTPGEG----------------------------------
HIS8_WOLSU      -----------------------------------------------
HIS81_MANSM     -----------------------------------------------
HIS8_THEGJ      -----------------------------------------------
HIS81_RALEJ     -----------------------------------------------
YFDZ_ECOLI      CVSPGIGFGDYG-----------------------------------
HIS8_PSEST      -----------------------------------------------
AAT_STRVG       VVPGEAF----GTPGYLRLSYALGDED--------------------
HIS8_MOOTA      -----------------------------------------------
YDEF_BACSU      -----------------------------------------------
HIS8_SULNB      -----------------------------------------------
DAPAT_SYNFM     ATPGSGFGAPGEGYIRMAL---TVDKERVRE----------------
DAPAT_HALOH     FTPGNGYGEFGEGYVRIAL---TVTEERIKE----------------
HIS8_BREBN      -----------------------------------------------
AAT_BACST       -----------------------------------------------
HIS8_THETN      -----------------------------------------------
HIS82_RALSO     -----------------------------------------------
DAPAT_DESAD     VTPGNGFGESGEGYFRISLTVDT------------------------
HIS8_VIBCH      -----------------------------------------------
HIS8_THEP3      -----------------------------------------------
HIS8_SYMTH      -----------------------------------------------
DAPT2_ANAVT     -----------------------------------------------
AAT_SULTO       -----------------------------------------------
HIS8_SALPK      -----------------------------------------------
HIS8_SALPA      -----------------------------------------------
HIS8_SALDC      -----------------------------------------------
AATC_RHIME      VAPGIGFGEQG------------------------------------
AAT_BACY2       VIPGSGF----GAPSTIRISYAT------------------------
HIS8_VIBPA      -----------------------------------------------
HIS8_THEPX      -----------------------------------------------
HIS8_SALTY      -----------------------------------------------
HIS8_SALTI      -----------------------------------------------
HIS8_SALSV      -----------------------------------------------
HIS8_SALPC      -----------------------------------------------
HIS8_SALPB      -----------------------------------------------
HIS8_SALNS      -----------------------------------------------
HIS8_SALHS      -----------------------------------------------
HIS8_SALG2      -----------------------------------------------
HIS8_SALEP      -----------------------------------------------
HIS8_SALA4      -----------------------------------------------
HIS81_NITOC     -----------------------------------------------
DAPT2_ANASP     -----------------------------------------------
HIS8_VIBCM      -----------------------------------------------
HIS8_VIBC3      -----------------------------------------------
HIS8_PYRKO      -----------------------------------------------
HIS8_DESHY      -----------------------------------------------
DAPAT_AQUAE     -----------------------------------------------
Y1527_METMP     -----------------------------------------------
PATA_BACSU      LVPGSSF--STYGEGYVRLSFASMDREGL------------------
HIS81_DECAR     -----------------------------------------------
HIS8_SODGM      -----------------------------------------------
HIS8_SALCH      -----------------------------------------------
HIS8_ANOFW      -----------------------------------------------
HIS82_THICR     -----------------------------------------------
HIS82_HAEIN     -----------------------------------------------
HIS8_ENTS8      -----------------------------------------------
HIS8_CLONN      -----------------------------------------------
HIS82_ARCFU     -----------------------------------------------
DAPAT_GLOVI     IIPGNGYGEHGEG----------------------------------
HIS8_PHOLL      -----------------------------------------------
PATR_MYCA9      -----------------------------------------------
HIS8_PROA2      -----------------------------------------------
HIS82_HAEI8     -----------------------------------------------
AAT1_METJA      CVPGVAFGENGA--NYIRFSYAT------------------------
HIS8_ECO45      -----------------------------------------------
HIS8_CLOCE      -----------------------------------------------
HIS81_THIDA     -----------------------------------------------
Y1391_METJA     -----------------------------------------------
PATR_MYCVP      -----------------------------------------------
PATR_MYCPA      -----------------------------------------------
HIS8_XYLFA      -----------------------------------------------
HIS8_SHIFL      -----------------------------------------------
HIS8_SHIF8      -----------------------------------------------
HIS8_SHIDS      -----------------------------------------------
HIS8_ECOK1      -----------------------------------------------
HIS8_ECO81      -----------------------------------------------
HIS8_ECO5E      -----------------------------------------------
HIS8_ECO57      -----------------------------------------------
HIS8_ECO55      -----------------------------------------------
HIS82_BORPA     -----------------------------------------------
HIS82_BORBR     -----------------------------------------------
PATR_MYCA1      -----------------------------------------------
HIS8_XYLFT      -----------------------------------------------
HIS8_XYLFM      -----------------------------------------------
HIS8_XYLF2      -----------------------------------------------
HIS8_SHIBS      -----------------------------------------------
HIS8_PELLD      -----------------------------------------------
HIS8_METFL      -----------------------------------------------
HIS82_METCA     VRPLG----NYGLPNHLRVSVGTAE----------------------
PATR_MYCSS      -----------------------------------------------
PATR_MYCSK      -----------------------------------------------
PATR_MYCSJ      -----------------------------------------------
HIS8_YERPY      -----------------------------------------------
HIS8_YERPP      -----------------------------------------------
HIS8_YERPN      -----------------------------------------------
HIS8_YERPG      -----------------------------------------------
HIS8_YERPE      -----------------------------------------------
HIS8_YERPA      -----------------------------------------------
HIS8_YERP3      -----------------------------------------------
HIS8_SALAR      -----------------------------------------------
HIS8_LEPIN      -----------------------------------------------
HIS8_LEPIC      -----------------------------------------------
HIS8_KLEP3      -----------------------------------------------
HIS8_BLOFL      -----------------------------------------------
HIS8_RHISN      -----------------------------------------------
HIS8_PSEE4      -----------------------------------------------
HIS8_ESCF3      -----------------------------------------------
HIS8_ECOUT      -----------------------------------------------
HIS8_ECOSE      -----------------------------------------------
HIS8_ECOLI      -----------------------------------------------
HIS8_ECOLC      -----------------------------------------------
HIS8_ECOL6      -----------------------------------------------
HIS8_ECOL5      -----------------------------------------------
HIS8_ECOHS      -----------------------------------------------
HIS8_ECODH      -----------------------------------------------
HIS8_ECOBW      -----------------------------------------------
HIS8_ECO8A      -----------------------------------------------
HIS8_ECO27      -----------------------------------------------
HIS8_ECO24      -----------------------------------------------
HIS8_CHLL2      -----------------------------------------------
HIS8_ARATH      -----------------------------------------------
HIS82_NITEU     -----------------------------------------------
HIS82_MANSM     -----------------------------------------------
PDXR_CORGL      -----------------------------------------------
HIS8_LYSSC      -----------------------------------------------
HIS8_AERHH      -----------------------------------------------
Y3073_RHOS4     -----------------------------------------------
HIS8_YERPS      -----------------------------------------------
HIS8_YERPB      -----------------------------------------------
HIS8_VIBFM      -----------------------------------------------
HIS8_SHISS      -----------------------------------------------
HIS8_YERE8      -----------------------------------------------
HIS8_PSEPK      -----------------------------------------------
HIS8_KLEP7      -----------------------------------------------
HIS8_CITK8      -----------------------------------------------
HIS8_VIBHB      -----------------------------------------------
HIS8_PYRFU      -----------------------------------------------
HIS8_PSEPW      -----------------------------------------------
HIS82_PASMU     -----------------------------------------------
HIS82_BORPE     -----------------------------------------------
PATR_MYCS2      -----------------------------------------------
HIS8_ECO7I      -----------------------------------------------
HIS8_BACLD      -----------------------------------------------
HIS81_IDILO     -----------------------------------------------
HIS8_VIBF1      -----------------------------------------------
HIS8_SHIB3      -----------------------------------------------
HIS8_SERP5      -----------------------------------------------
HIS8_PSEP1      -----------------------------------------------
HIS8_PELPB      -----------------------------------------------
HIS8_NITSB      -----------------------------------------------
HIS8_METTH      -----------------------------------------------
HIS8_ECOLU      -----------------------------------------------
HIS8_CHLP8      -----------------------------------------------
HIS8_CALS8      -----------------------------------------------
PATR_RHOSR      -----------------------------------------------
HIS8_TOBAC      -----------------------------------------------
HIS8_PSEPG      -----------------------------------------------
HIS8_ENT38      -----------------------------------------------
HIS81_PASMU     -----------------------------------------------
AAT_SULAC       TIPGEVFPLDAGKE-FVRLSFA-------------------------
HIS8_NICPL      -----------------------------------------------
HIS8_METPP      -----------------------------------------------
HIS8_LEPBL      -----------------------------------------------
HIS8_LEPBJ      -----------------------------------------------
HIS81_BACC1     -----------------------------------------------
HIS8_ROSCS      -----------------------------------------------
HIS8_NOVAD      -----------------------------------------------
HIS8_ECOSM      -----------------------------------------------
PATR_STRCO      -----------------------------------------------
HIS8_DESPS      -----------------------------------------------
HIS8_VIBVY      -----------------------------------------------
HIS8_VIBVU      -----------------------------------------------
HIS8_LACPL      -----------------------------------------------
HIS8_STRMK      -----------------------------------------------
HIS8_PROVI      -----------------------------------------------
HIS8_HALLT      -----------------------------------------------
HIS8_SULDN      -----------------------------------------------
DAPAT_MOOTA     -----------------------------------------------
HIS8_METST      -----------------------------------------------
HIS8_GEOKA      -----------------------------------------------
HIS8_AZOSE      -----------------------------------------------
HIS81_PSEF5     -----------------------------------------------
HIS8_LISIN      -----------------------------------------------
HIS81_LEGPL     -----------------------------------------------
HIS8_ACEPA      -----------------------------------------------
AAT_PYRKO       VFPGMAF---GDYPNFIRIS---------------------------
HIS8_XANCB      -----------------------------------------------
HIS8_GEOSW      -----------------------------------------------
HIS8_DESHD      -----------------------------------------------
HIS8_BUCSC      -----------------------------------------------
HIS81_PSEPF     -----------------------------------------------
PATR_STRGG      -----------------------------------------------
HIS8_BUCAP      -----------------------------------------------
HIS8_BACCN      -----------------------------------------------
HIS8_AERS4      -----------------------------------------------
HIS82_BACAN     -----------------------------------------------
DAPAT_DESVM     LTPGNGFGTPGEGYFRISLTVDT------------------------
HIS8_MACCJ      -----------------------------------------------
HIS8_HALMA      -----------------------------------------------
HIS8_AKKM8      -----------------------------------------------
HIS81_LEGPH     -----------------------------------------------
DAPAT_DESDA     CTPGAGFGISGEG----------------------------------
HIS8_PSEU2      -----------------------------------------------
HIS8_LISMF      -----------------------------------------------
HIS8_GEOTN      -----------------------------------------------
HIS8_SYNJB      -----------------------------------------------
HIS8_ROSDO      -----------------------------------------------
HIS8_PHOPR      -----------------------------------------------
HIS8_LISMC      -----------------------------------------------
HIS8_HAEIG      -----------------------------------------------
HIS8_HAEIE      -----------------------------------------------
HIS8_BUCDN      -----------------------------------------------
HIS8_BACSU      -----------------------------------------------
HIS82_BACCZ     -----------------------------------------------
HIS81_HAEIN     -----------------------------------------------
1A112_ARATH     -----------------------------------------------
PATR_NOCFA      -----------------------------------------------
HIS8_XANAC      -----------------------------------------------
HIS8_LISW6      -----------------------------------------------
HIS8_LISMH      -----------------------------------------------
HIS8_DEHSC      -----------------------------------------------
HIS8_DEHSB      -----------------------------------------------
HIS8_BACNA      -----------------------------------------------
HIS8_ALISL      -----------------------------------------------
HIS82_DECAR     -----------------------------------------------
HIS81_LEGPA     -----------------------------------------------
HIS8_ROSS1      -----------------------------------------------
HIS8_PSESM      -----------------------------------------------
HIS8_DEHE1      -----------------------------------------------
PATR_MYCTU      -----------------------------------------------
PATR_MYCTA      -----------------------------------------------
PATR_MYCBT      -----------------------------------------------
PATR_MYCBP      -----------------------------------------------
PATR_MYCBO      -----------------------------------------------
HIS8_LISMO      -----------------------------------------------
HIS8_BACP2      -----------------------------------------------
ALAT_SCHPO      -----------------------------------------------
AAT2_METJA      LTPGIGF--GSKGKNYIRISYA-------------------------
HIS8_METM5      -----------------------------------------------
HIS81_HAEI8     -----------------------------------------------
HIS81_BACCR     -----------------------------------------------
HIS81_ANAVT     I----RYFQQPGLEDKLRITVGTDEQNHI------------------
HIS8_XANC5      -----------------------------------------------
HIS8_STAS1      -----------------------------------------------
HIS8_CHLPD      -----------------------------------------------
HIS81_BACHK     -----------------------------------------------
HIS81_BACAN     -----------------------------------------------
PATR_RHOE4      -----------------------------------------------
PATR_PROAC      -----------------------------------------------
HIS81_BACCZ     -----------------------------------------------
HIS8_HELHP      -----------------------------------------------
HIS8_GEOSF      -----------------------------------------------
HIS8_BAUCH      -----------------------------------------------
HIS8_STAHJ      -----------------------------------------------
HIS8_NEIMB      -----------------------------------------------
ATTY_RAT        -----------------------------------------------
ATTY_DICDI      -----------------------------------------------
PATR_STRAW      -----------------------------------------------
HIS8_CHRSD      -----------------------------------------------
ATTY_HUMAN      -----------------------------------------------
ATTY_BOVIN      -----------------------------------------------
HIS8_PARDP      -----------------------------------------------
HIS8_NEIMF      -----------------------------------------------
HIS8_NEIMA      -----------------------------------------------
HIS8_NEIM0      -----------------------------------------------
HIS81_PSYA2     -----------------------------------------------
HIS81_METCA     -----------------------------------------------
HIS8_LACF3      -----------------------------------------------
ATTY_MOUSE      -----------------------------------------------
ALAM_YEAST      -----------------------------------------------
1A16_ARATH      VSPGGSFHCHEPG--WFRVCFANMDHK--------------------
HIS8_CAMC1      -----------------------------------------------
HIS82_IDILO     -----------------------------------------------
HIS81_CARHZ     -----------------------------------------------
AVTA_ECOLI      MVPGHNFF---------------------------------------
HIS8_SULSO      -----------------------------------------------
HIS8_MYCSS      -----------------------------------------------
HIS8_MYCSK      -----------------------------------------------
HIS8_MYCSJ      -----------------------------------------------
HIS8_METMP      -----------------------------------------------
HIS8_BUCMH      -----------------------------------------------
DAPAT_SYNY3     GTPGSGFGAAGEG----------------------------------
DAPAT_NATTJ     VTPGIGFGKHGEGYFRIALT-VTKDR---------------------
HIS8_METVS      -----------------------------------------------
HIS8_GEOSL      -----------------------------------------------
HIS8_DINSH      -----------------------------------------------
CBL_BACSU       LEPGTKY--GPGGEGFMRLN---------------------------
AAT_RICBR       VVPGIAF----GLEGYFRISYAT------------------------
HIS8_PELCD      -----------------------------------------------
HIS8_NEIG2      -----------------------------------------------
HIS8_NEIG1      -----------------------------------------------
HIS8_HALVO      -----------------------------------------------
HIS8_HALSA      -----------------------------------------------
HIS8_HALS3      -----------------------------------------------
HIS82_THIDA     -----------------------------------------------
HIS82_CAUCR     -----------------------------------------------
COBD_THETN      -----------------------------------------------
HIS8_PSEA6      -----------------------------------------------
HIS8_MYCUA      -----------------------------------------------
HIS8_METM7      -----------------------------------------------
HIS8_METJA      -----------------------------------------------
HIS8_XANC8      -----------------------------------------------
HIS8_STRMU      -----------------------------------------------
HIS8_POLNA      -----------------------------------------------
AAT_RICFE       VVPGIAF----GLEGYFRISYAT------------------------
AAT_RICCN       VVPGIAF----GLEGYFRISYAT------------------------
HIS8_MESSB      -----------------------------------------------
HIS8_CAMC5      -----------------------------------------------
HIS8_ARCB4      -----------------------------------------------
HIS81_RALSO     -----------------------------------------------
HIS81_BRAJA     -----------------------------------------------
DAPAT_PROMS     -----------------------------------------------
Y1479_METJA     -----------------------------------------------
PATR_MYCMM      -----------------------------------------------
HIS8_MYCMM      -----------------------------------------------
HIS81_RHILO     -----------------------------------------------
HIS81_GLUOX     -----------------------------------------------
PATR_MYCUA      -----------------------------------------------
KAT1_HUMAN      -----------------------------------------------
HIS8_GLUDA      -----------------------------------------------
HIS81_CAUCR     -----------------------------------------------
DAPAT_CLOPH     -----------------------------------------------
HIS8_STRGC      -----------------------------------------------
HIS8_BEII9      -----------------------------------------------
HIS81_PSEAE     -----------------------------------------------
HIS8_STRSV      -----------------------------------------------
HIS8_CLOBK      -----------------------------------------------
HIS8_CLOBH      -----------------------------------------------
HIS8_CLOB1      -----------------------------------------------
AAT_RICTY       VVPGVAF----GLDGYFRISYATSMQE--------------------
PATR_CORJK      -----------------------------------------------
HIS8_CLOBL      -----------------------------------------------
HIS8_CLOAB      -----------------------------------------------
HIS82_CARHZ     -----------------------------------------------
HIS82_BURS3     -----------------------------------------------
MTNE_BACSU      -----------------------------------------------
HIS8_VESOH      -----------------------------------------------
HIS8_RHOBA      -----------------------------------------------
HIS8_DESVV      -----------------------------------------------
HIS8_DESVH      -----------------------------------------------
ALA2_PANMI      -----------------------------------------------
AAT_RICPR       VVPGIAF----GLDGYFRISYATSMQE--------------------
HIS8_XANCP      -----------------------------------------------
HIS8_STRAW      -----------------------------------------------
HIS8_RHORT      -----------------------------------------------
HIS8_HAHCH      -----------------------------------------------
HIS8_GEOUR      -----------------------------------------------
HIS8_GEOMG      -----------------------------------------------
HIS8_CLOB8      -----------------------------------------------
CBL_MYCLE       ALTSGHAFGT-GGVGHVRVNFAT------------------------
ALAT_YEAST      -----------------------------------------------
KAT1_RAT        -----------------------------------------------
KAT1_MOUSE      -----------------------------------------------
HIS8_SILST      -----------------------------------------------
HIS8_LEUCK      -----------------------------------------------
HIS8_DIAST      -----------------------------------------------
YFBQ_SHIFL      -----------------------------------------------
YFBQ_ECOLI      -----------------------------------------------
YFBQ_ECOL6      -----------------------------------------------
HIS8_PSE14      -----------------------------------------------
HIS8_CLOB6      -----------------------------------------------
HIS8_CAMFF      -----------------------------------------------
ALA2_HORVU      -----------------------------------------------
Y286_HAEIN      -----------------------------------------------
HIS82_GLUOX     -----------------------------------------------
HIS81_ANASP     -----------------------------------------------
ALAT1_MOUSE     -----------------------------------------------
HIS8_GEOBB      -----------------------------------------------
HIS8_CHLCH      -----------------------------------------------
HIS8_ACISJ      -----------------------------------------------
DAPAT_LEPBL     GTPGSGF--GPAGEGYFRLS---------------------------
DAPAT_LEPBJ     GTPGSGF--GPAGEGYFRLS---------------------------
AAT_STRGR       -----------------------------------------------
AAT_MYCTU       -----------------------------------------------
AAT_MYCBO       -----------------------------------------------
HIS8_UNCMA      -----------------------------------------------
DAPAT_DESAP     -----------------------------------------------
CBL_MYCTU       -----------------------------------------------
CBL_MYCBO       -----------------------------------------------
HIS8_RHOPB      -----------------------------------------------
HIS8_MYCS2      -----------------------------------------------
HIS8_MARMM      -----------------------------------------------
HIS8_CAMLR      -----------------------------------------------
DAPAT_METTH     GTPGSGFGPSGEG----------------------------------
HIS8_FRAP2      -----------------------------------------------
HIS8_ACIBT      -----------------------------------------------
HIS8_ACIB5      -----------------------------------------------
HIS8_ACIB3      -----------------------------------------------
HIS82_ANASP     -----------------------------------------------
YBDL_ECOLI      -----------------------------------------------
MALY_ECOLI      IMPGYTYGEEGRG----------------------------------
HIS8_GEOSM      -----------------------------------------------
HIS8_ACIBY      -----------------------------------------------
HIS8_ACIBC      -----------------------------------------------
DAPAT_SYNS9     GTPGSGFGA--AGEGYFRLS---------------------------
DAPAT_DESPS     -----------------------------------------------
BNA3_YEAST      -----------------------------------------------
1A1C_SOYBN      VSPGSSFHCTEPG--WFRVCYANMD----------------------
HIS81_ARCFU     -----------------------------------------------
DAPAT_ARATH     -----------------------------------------------
CSD_CHLPN       -----------------------------------------------
1A17_ARATH      -----------------------------------------------
HIS8_SULTO      -----------------------------------------------
HIS8_COLP3      -----------------------------------------------
DAPAT_PARUW     -----------------------------------------------
YDT4_SCHPO      -----------------------------------------------
HIS8_MYCSM      -----------------------------------------------
HIS8_LACLA      -----------------------------------------------
ALAM_DICDI      -----------------------------------------------
1A11_ORYSJ      -----------------------------------------------
1A11_ORYSI      -----------------------------------------------
HIS8_ACIBS      -----------------------------------------------
HIS8_ACIAC      -----------------------------------------------
HIS82_BURPS     -----------------------------------------------
HIS82_BURP1     -----------------------------------------------
HIS82_ANAVT     -----------------------------------------------
HIS81_BURMA     -----------------------------------------------
DAPAT_DESAH     -----------------------------------------------
HIS8_CAMJR      -----------------------------------------------
HIS8_CAMJJ      -----------------------------------------------
HIS8_CAMJ8      -----------------------------------------------
1A1C_PHAAU      -----------------------------------------------