[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tthe0:AAS80413.1

[Show Plain Result]


## Summary of Sequence Search
    1::76
   99::143     8e-04  45%  164 aa  EFCB2_MOUSE RecName: Full=EF-hand calcium-binding domain-containing
    1::76

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxVMRAVEALRLATFKEIQRYLDEEGEPFSKKELLDTLKALVxxxxxxxxxxxxxxxxxxxxxxxx
EFCB2_MOUSE     ------LLRAFEVLDPATKDELVKYMTEEGEPFSQEEMEEMLSAAI------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxx
EFCB2_MOUSE     ------