[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tthe0:AAS80551.1

[Show Plain Result]


## Summary of Sequence Search
    1::136
   15::147     1e-12  30%  188 aa  SP21_STIAU RecName: Full=Spore protein SP21;
   59::145     3e-09  33%  163 aa  HSPC4_RICFE RecName: Full=Small heat shock protein C4;
   27::130     5e-09  30%  143 aa  HSP16_SCHPO RecName: Full=Heat shock protein 16;AltName: Full=16
   28::110     1e-08  35%  130 aa  HSP15_LEPIN RecName: Full=Probable 15 kDa heat shock protein;
   28::110     1e-08  35%  130 aa  HSP15_LEPIC RecName: Full=Probable 15 kDa heat shock protein;
   30::127     6e-08  29%  139 aa  HSP15_SCHPO RecName: Full=Heat shock protein homolog C338.06c;
   37::139     2e-07  34%  154 aa  HSP15_SOYBN RecName: Full=17.6 kDa class I heat shock
   36::138     2e-07  33%  153 aa  HSP11_SOYBN RecName: Full=17.3 kDa class I heat shock
   42::129     2e-07  31%  416 aa  Y0215_DICDI RecName: Full=Heat shock protein DDB_G0280215;
   76::167     3e-07  32%  197 aa  HSP41_PEA RecName: Full=22.7 kDa class IV heat shock protein;Flags:
   37::133     5e-07  34%  154 aa  HSP14_SOYBN RecName: Full=17.5 kDa class I heat shock
   36::132     5e-07  35%  153 aa  HSP13_SOYBN RecName: Full=17.5 kDa class I heat shock
   46::138     8e-07  30%  151 aa  HSP18_CLOAB RecName: Full=18 kDa heat shock protein;AltName:
   59::159     1e-06  33%  192 aa  HSP41_SOYBN RecName: Full=22.0 kDa class IV heat shock
   45::138     1e-06  36%  157 aa  HSP12_ARATH RecName: Full=17.6 kDa class I heat shock
   47::140     2e-06  33%  161 aa  HSP16_SOYBN RecName: Full=18.5 kDa class I heat shock
   50::142     2e-06  29%  154 aa  HSPC2_RICFE RecName: Full=Small heat shock protein C2;
   55::149     2e-06  31%  161 aa  HSP23_ORYSJ RecName: Full=17.4 kDa class I heat shock protein 3;
    9::118     3e-06  32%  143 aa  HSP18_STRAL RecName: Full=18 kDa heat shock protein;AltName:
  305::383     4e-06  40%  390 aa  Y2128_STRCO RecName: Full=Uncharacterized protein SCO2128;
   38::142     9e-06  29%  142 aa  ASP2_STRTR RecName: Full=Heat shock protein HSP.16.4;
   44::131     1e-05  37%  154 aa  HSP23_MAIZE RecName: Full=17.0 kDa class II heat shock
   51::138     1e-05  37%  161 aa  HSP21_MAIZE RecName: Full=17.5 kDa class II heat shock protein;
    4::113     1e-05  34%  148 aa  18KD_MYCLE RecName: Full=18 kDa antigen;AltName: Full=HSP 16.7;
   33::115     2e-05  24%  132 aa  HSPL_DICDI RecName: Full=Small heat shock protein hspL;
   43::134     2e-05  30%  155 aa  HSP21_ARATH RecName: Full=17.6 kDa class II heat shock protein;
   38::139     2e-05  33%  154 aa  HSP12_SOLPE RecName: Full=17.6 kDa class I heat shock
   24::81      3e-05  32%  161 aa  IBP_BUCAP RecName: Full=Small heat shock protein ibp;
   45::131     3e-05  30%  147 aa  HSPS_METJA RecName: Full=Small heat shock protein HSP16.5;
  242::339     3e-05  31%  375 aa  HSP42_YEAST RecName: Full=Heat shock protein 42;AltName: Full=42
   53::138     3e-05  31%  159 aa  HSP22_ORYSJ RecName: Full=17.4 kDa class I heat shock protein 2;
   53::141     5e-05  35%  164 aa  HSP22_MAIZE RecName: Full=17.8 kDa class II heat shock protein;
   48::144     5e-05  32%  159 aa  HSP21_SOYBN RecName: Full=17.9 kDa class II heat shock protein;
   40::139     5e-05  33%  160 aa  HSP21_HELAN RecName: Full=17.9 kDa class II heat shock protein;
   30::113     5e-05  33%  149 aa  18K1_MYCIT RecName: Full=18 kDa antigen 1;AltName: Full=18 kDa
  176::216     6e-05  37%  228 aa  HSP30_NEUCR RecName: Full=30 kDa heat shock protein;
   44::143     6e-05  34%  158 aa  HSP11_PEA RecName: Full=18.1 kDa class I heat shock
   38::129     6e-05  28%  142 aa  ASP1_STRTR RecName: Full=Acid shock protein;AltName: Full=T786P28D;
    4::113     6e-05  31%  147 aa  18K1_MYCAV RecName: Full=18 kDa antigen 1;AltName: Full=Clone
   44::134     8e-05  31%  155 aa  HSP21_SOLPE RecName: Full=17.3 kDa class II heat shock
   38::133     8e-05  33%  154 aa  HSP11_SOLLC RecName: Full=17.8 kDa class I heat shock protein;
   18::126     1e-04  26%  142 aa  IBPB_SERP5 RecName: Full=Small heat shock protein ibpB;AltName:
   41::131     1e-04  34%  152 aa  HSP21_PEA RecName: Full=17.1 kDa class II heat shock protein;
   38::139     1e-04  32%  154 aa  HSP11_SOLPE RecName: Full=17.7 kDa class I heat shock
   26::127     2e-04  27%  154 aa  IBPB_YERPY RecName: Full=Small heat shock protein ibpB;AltName:
   26::127     2e-04  27%  154 aa  IBPB_YERPS RecName: Full=Small heat shock protein ibpB;AltName:
   26::127     2e-04  27%  154 aa  IBPB_YERPP RecName: Full=Small heat shock protein ibpB;AltName:
   26::127     2e-04  27%  154 aa  IBPB_YERPN RecName: Full=Small heat shock protein ibpB;AltName:
   26::127     2e-04  27%  154 aa  IBPB_YERPG RecName: Full=Small heat shock protein ibpB;AltName:
   26::127     2e-04  27%  154 aa  IBPB_YERPE RecName: Full=Small heat shock protein ibpB;AltName:
   26::127     2e-04  27%  154 aa  IBPB_YERPB RecName: Full=Small heat shock protein ibpB;AltName:
   26::127     2e-04  27%  154 aa  IBPB_YERPA RecName: Full=Small heat shock protein ibpB;AltName:
   26::127     2e-04  27%  154 aa  IBPB_YERP3 RecName: Full=Small heat shock protein ibpB;AltName:
   39::168     2e-04  22%  181 aa  HS22C_SOYBN RecName: Full=Small heat shock protein,
   92::222     2e-04  25%  235 aa  HS21C_SOLLC RecName: Full=Small heat shock protein,
   30::113     2e-04  30%  138 aa  18K2_MYCAV RecName: Full=18 kDa antigen 2;AltName: Full=Clone
   29::124     2e-04  33%  143 aa  HSP11_MEDSA RecName: Full=18.1 kDa class I heat shock
   45::145     3e-04  32%  167 aa  HSP22_IPONI RecName: Full=18.8 kDa class II heat shock protein;
   38::131     3e-04  33%  153 aa  HSP11_HELAN RecName: Full=17.6 kDa class I heat shock protein;
   30::115     4e-04  34%  130 aa  COTM_BACSU RecName: Full=Spore coat protein M;
   48::124     4e-04  30%  144 aa  14KD_MYCTU RecName: Full=14 kDa antigen;AltName: Full=16 kDa
   48::124     4e-04  30%  144 aa  14KD_MYCBO RecName: Full=14 kDa antigen;AltName: Full=16 kDa
   56::150     5e-04  32%  161 aa  HSP11_CHERU RecName: Full=18.3 kDa class I heat shock
   41::141     5e-04  32%  156 aa  HSP11_ARATH RecName: Full=17.4 kDa class I heat shock
   42::133     7e-04  31%  142 aa  IBPB_SALTY RecName: Full=Small heat shock protein ibpB;AltName:
   42::133     7e-04  31%  142 aa  IBPB_SALSV RecName: Full=Small heat shock protein ibpB;AltName:
   42::133     7e-04  31%  142 aa  IBPB_SALPK RecName: Full=Small heat shock protein ibpB;AltName:
   42::133     7e-04  31%  142 aa  IBPB_SALPB RecName: Full=Small heat shock protein ibpB;AltName:
   42::133     7e-04  31%  142 aa  IBPB_SALPA RecName: Full=Small heat shock protein ibpB;AltName:
   42::133     7e-04  31%  142 aa  IBPB_SALNS RecName: Full=Small heat shock protein ibpB;AltName:
   42::133     7e-04  31%  142 aa  IBPB_SALHS RecName: Full=Small heat shock protein ibpB;AltName:
   42::133     7e-04  31%  142 aa  IBPB_SALDC RecName: Full=Small heat shock protein ibpB;AltName:
   42::133     7e-04  31%  142 aa  IBPB_SALCH RecName: Full=Small heat shock protein ibpB;AltName:
   42::133     7e-04  31%  142 aa  IBPB_SALA4 RecName: Full=Small heat shock protein ibpB;AltName:
   42::133     7e-04  30%  142 aa  IBPB_CITK8 RecName: Full=Small heat shock protein ibpB;AltName:
   44::137     7e-04  34%  158 aa  HSP12_MEDSA RecName: Full=18.2 kDa class I heat shock protein;
  130::214     7e-04  25%  227 aa  HS21C_ARATH RecName: Full=Small heat shock protein,
   21::114     7e-04  33%  140 aa  18K2_MYCIT RecName: Full=18 kDa antigen 2;AltName: Full=18 kDa
   27::117     9e-04  28%  150 aa  IBPB_ERWCT RecName: Full=Small heat shock protein ibpB;AltName:
    1::136

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLERHDRLETLRKLKELQERIAELAYLLTGEEPAAWTPRVDLLETEEHYVLLVDLPGVRPEDLELLEEGQ
SP21_STIAU      --QRTREWDPFQQMQELMNELANHPWFANRQGPPAFVPAFEVRETKEAYIFKADLPGVDEKDIEVTLTGD
HSPC4_RICFE     ------------------------------------SPRTDITENESEYHLEVELPGVTQDNIDLKIDSN
HSP16_SCHPO     ---------------------------LNNQIPGELSPSIDVHEGKDTVSVDVELPGVKKEDVQVHYDSG
HSP15_LEPIN     -------------------------------------PRVDIYSDEENIYLLADLPGVEEKDVQVQLEKD
HSP15_LEPIC     -------------------------------------PRVDIYSDEENIYLLADLPGVEEKDVQVQLEKD
HSP15_SCHPO     ---------------------------------SCWGPALELRXXXXXXXXXXXXPGIDKQNLKVDLHGS
HSP15_SOYBN     ---------------------------VSAENSAFVNTRVDWKETQEAHVLKADIPGLKKEEVKVQIEDD
HSP11_SOYBN     ---------------------------LSAENSAFVSTRVDWKETPEAHVFKADIPGLKKEEVKLIQDGR
Y0215_DICDI     -----------------------------------WKPRMDVCENKDYYKIILELPSFNKDEIEVQVNGR
HSP41_PEA       --------------------------------------RVDWKETPEGHVIMVDVPGLKKDDIKIEVEEN
HSP14_SOYBN     ---------------------------VSAENSAFVSTRVDWKETPEAHVFKADIPGLKKEEVKVQIEDD
HSP13_SOYBN     ---------------------------LSAENSAFVNTRVDWKETPEAHVFEADIPGLKKEEVKVQIEDD
HSP18_CLOAB     --------------------------------------KVDIKEDDDKYTVAADLPGVKKDNIELQYENN
HSP41_SOYBN     ------------------------------EASMAMSPRVDWKETPEGHVIMLDVPGLKREEIKVVEENR
HSP12_ARATH     ---------------------------------AAFTAKVDWRETPEAHVFKADLPGLRKEEVKVVEDGN
HSP16_SOYBN     ------------------------------ENSAFVSTRVDWKETPEAHVFKADIPGLKKEEVKVIEDDK
HSPC2_RICFE     -------------------------------------PRTDISETDSGYSLEVELPGXXXXXXXXXXXXX
HSP23_ORYSJ     --------------------------------------RIDWKETPEAHVFKADVPGLKKEEVKVVDDGN
HSP18_STRAL     --------------REFDRITRELTAPGTWSRPTAMP--MDACREGDTYVVSFDLPGVDPEAIEIDIERN
Y2128_STRCO     --------------------------------PVEW-PVTDRLAEDGVLVWHIPLPGAVREELDLVRRGD
ASP2_STRTR      --------------------------------------KTDIHETDNEYVVEAELPGIPKEDIQVNYENG
HSP23_MAIZE     ----------------------------------AATP-ADVKELAGAYAFVVDMPGLSTGDIRVQVEDE
HSP21_MAIZE     ----------------------------------AVTP-ADVKELPGAYAFVVDMPGLGTGDIKVQVEDE
18KD_MYCLE      ------RTDPFRELDRFAEQV-----LGTSARPAVMP--MDAWREGEEFVVEFDLPGIKADSLDIDIERN
HSPL_DICDI      --------------------------------------------TKSETILVADLPGVLPNDMKVNVDKD
HSP21_ARATH     ----------------------------------AATP-ADVIEHPNAYAFVVDMPGIKGDEIKVQVEND
HSP12_SOLPE     ----------------------------SGETSAFANTRIDWKETPEAHVFKADLPGLXXXXXXXXXXXD
IBP_BUCAP       -------------------QIDKIFSTLTGEKPLSDTPAYNLFQIDEHYELILSIPGYEEKELDISVHNS
HSPS_METJA      ---------------------------------------ISIIEGDQHIKVIAWLPGVNKEDIILNAVGD
HSP42_YEAST     -----------------------------------FSPEVNVYDTEDTYVVVLALPGAHPSSHEMLIKGK
HSP22_ORYSJ     --------------------------------------RIDWKETPEVHVFKADVPGLKKEEVKVVDDGN
HSP22_MAIZE     ----------------------------------AATP-ADVKELPGAYAFVVDMPGLGTGDIRVQVEDE
HSP21_SOYBN     ----------------------------------AATP-ADVKEYPNSYVFEIDMPGLKSGDIKVVEDDN
HSP21_HELAN     ------------------------AYVRDARAMAA-TP-ADVKECPNSYVFIVDMPGLKSGDIKVVERDN
18K1_MYCIT      ---------------------------------------MDAWRQGEEFVVEFDLPGIDADSLDIDIERN
HSP30_NEUCR     ----------------------------------------------------------------------
HSP11_PEA       ------------------------------ENPAFVSTRVDWKETPEAHVFKADLPGLXXXXXXXXXXDD
ASP1_STRTR      --------------------------------------KTDIHETDNEYLVEAELPGIPKENIQVTYENG
18K1_MYCAV      ------RSDPFRELDRLTNQV-----LGTPTRPAVMP--MDAWRVGRRLVVEFDLPGIDAESLDIDIERN
HSP21_SOLPE     ----------------------------------AATP-ADVKEYPNSYVFVVDMPGLKSGDIKVQVEED
HSP11_SOLLC     ----------------------------SGESSAFANTRIDWKETPEPHVFKVDLPGLXXXXXXXXXXXD
IBPB_SERP5      ----------------------KLASSMGGQEPQGFPPYNIEKSDDNHYRISLALAGFKQSELDIEVEGP
HSP21_PEA       ----------------------------------AATP-ADVKEHPNSYVFMVDMPGVKSGDIKVQVEDE
HSP11_SOLPE     ----------------------------SGETSAFANTRIDWKETPEAHVFKADLPGXXXXXXXXXXXXD
IBPB_YERPY      -----------------------------GQEPQGFPPYNIEKTDDNHYRISLALAGFKQSELDIEVEGP
IBPB_YERPS      -----------------------------GQEPQGFPPYNIEKTDDNHYRISLALAGFKQSELDIEVEGP
IBPB_YERPP      -----------------------------GQEPQGFPPYNIEKTDDNHYRISLALAGFKQSELDIEVEGP
IBPB_YERPN      -----------------------------GQEPQGFPPYNIEKTDDNHYRISLALAGFKQSELDIEVEGP
IBPB_YERPG      -----------------------------GQEPQGFPPYNIEKTDDNHYRISLALAGFKQSELDIEVEGP
IBPB_YERPE      -----------------------------GQEPQGFPPYNIEKTDDNHYRISLALAGFKQSELDIEVEGP
IBPB_YERPB      -----------------------------GQEPQGFPPYNIEKTDDNHYRISLALAGFKQSELDIEVEGP
IBPB_YERPA      -----------------------------GQEPQGFPPYNIEKTDDNHYRISLALAGFKQSELDIEVEGP
IBPB_YERP3      -----------------------------GQEPQGFPPYNIEKTDDNHYRISLALAGFKQSELDIEVEGP
HS22C_SOYBN     ILDPWSPMRSMRQILDTMDRVFEDTMTFPGRNIGGGEIRADIKDEEHEIRMRFDMPGLAKEDVKVSVEDD
HS21C_SOLLC     VLDPMSPMRTMRQMIDTMDRLFEDTMTFPGRNRASGTGEIDIHDDENEIKMRFDMPGLSKEDVKVSVEND
18K2_MYCAV      ---------------------------------------MDAWRDGDQFVVEFDLPGVNADSLDLDVERN
HSP11_MEDSA     ------------------------------ENSAFVSTRIDWKETPEAHVFKADLPGLXXXXXXXXIEDD
HSP22_IPONI     ------------------------AYVRDAKAMAA-TP-ADVKEYPNSYVFIADMPGVKAAEIKVVEDDN
HSP11_HELAN     ------------------------------ETAAIVNARIDWKETPEAHVLKADLPGMXXXXXXXXXDGR
COTM_BACSU      ------------------------------EDPFAWTLPIDLYETSQQYIIEADLTFLQPTQV-------
14KD_MYCTU      ---------------------------------------------EGRYEVRAELPGVDPDDVDIMVRDG
14KD_MYCBO      ---------------------------------------------EGRYEVRAELPGVDPDDVDIMVRDG
HSP11_CHERU     --------------------------------------RIDWKETPEAHVFKADLPGXXXXXXXXXXDGN
HSP11_ARATH     ------------------------------KDVAAFTAKVDWRETPEAHVFKADVPGLXXXXXXXXXDGN
IBPB_SALTY      ---------------------------------------------DNHYRITLALAGFRQEDLDIQLEGT
IBPB_SALSV      ---------------------------------------------DNHYRITLALAGFRQEDLDIQLEGT
IBPB_SALPK      ---------------------------------------------DNHYRITLALAGFRQEDLDIQLEGT
IBPB_SALPB      ---------------------------------------------DNHYRITLALAGFRQEDLDIQLEGT
IBPB_SALPA      ---------------------------------------------DNHYRITLALAGFRQEDLDIQLEGT
IBPB_SALNS      ---------------------------------------------DNHYRITLALAGFRQEDLDIQLEGT
IBPB_SALHS      ---------------------------------------------DNHYRITLALAGFRQEDLDIQLEGT
IBPB_SALDC      ---------------------------------------------DNHYRITLALAGFRQEDLDIQLEGT
IBPB_SALCH      ---------------------------------------------DNHYRITLALAGFRQEDLDIQLEGT
IBPB_SALA4      ---------------------------------------------DNHYRITLALAGFRQEDLDIQLEGT
IBPB_CITK8      ---------------------------------------------DNHYRITLALAGFRQEDLDIQLEGT
HSP12_MEDSA     ------------------------------ENSAFVSTRVDWKETPEAHVFKADLPGMXXXXXXXXIEDD
HS21C_ARATH     ----------------------------------------DIKEEEHEIKMRFDMPGLSKEDVKISVEDN
18K2_MYCIT      ----------------------------TAARPAAMP--MDAWRDGEQFVVEFDLPGIDEQSLDLDIERN
IBPB_ERWCT      ------------------------------QEPIDFPPYNIEKKDDNHYRITLALAGFRQSDLDIEVEGP


                         .         .         *         .         .         .         .:140
query           RVTLAGVRHPLPGTYLLEERPMGTFRRTLDLPGPIEEGTAQATLRNGVLEVRFRKRPATALPLKEA
SP21_STIAU      RVSVSGXXXXXXXXFYAYERTFGSFSRAFTLPEGVDGDNVRADLKNGVLTLTLPKRP---------
HSPC4_RICFE     ILTIDGKKEKKDHNYHMKERYYGSFSRSISLPSNVDEEHVTANFKDGIL-----------------
HSP16_SCHPO     KLTISGKNESTEGNQRWSERRFGSFSRTITIPAKIDADRIEANFSNGLLTVTLPK-----------
HSP15_LEPIN     QLIISGSNKDIQGELRYSEFRTGEYKRTFTLTESVEEDRISAVYKNGV------------------
HSP15_LEPIC     QLIISGSNKDIQGELRYSEFRTGEYKRTFTLTESVEEDRISAVYKNGV------------------
HSP15_SCHPO     KLTISGEREEKAGPLIRSERCVGAFSRTITLPQPVDEKLIHASLNNGILSIVMKKK----------
HSP15_SOYBN     RVQISGERNDKNDTWHRVDRSSGKFMRRFRLPENAKVEQVKACMENGVLTVTIPK-----------
HSP11_SOYBN     VLQISGERNDKNDTWHRVERSSGKLVRRFRLPENAKVDQVKASMENGVLTVTVPK-----------
Y0215_DICDI     FLSIKGIEHTTEWKYHRRERSGGEFHRAVALPEGIDGSSIQAKFQSGVL-----------------
HSP41_PEA       RVLRVSXXXXXXXXXXXXERSYGKFWRQFKLPQNVDLDSVKAKMENGVLTLTLHK-----------
HSP14_SOYBN     RVQISGERNDKNDTWHRVERSSGKFTRRFRLPENAKVNEVKASMENGVL-----------------
HSP13_SOYBN     RVQISGERNDKNDTWHRVERSSGNFMRRFRLPENAKVEQVKASMENGVL-----------------
HSP18_CLOAB     YLTINAKRDDIVETFVRRERSYGELRRSFYVDN-IDDSKIDASFLDGVLRITLPKK----------
HSP41_SOYBN     VLRVSGXXXXXXXXWHRVERSYGKFWRQFRLPQNVDLDSVKAKLENGVLTLTLDK-----------
HSP12_ARATH     ILQISGEREEKNDKWHRVERSSGKFTRRFRLPENAKMEEIKASMENGVLSV---------------
HSP16_SOYBN     VLQISGERNDKNDTWHRVERSSGKFMRRFRLPENAKVEQVKASMENGVL-----------------
HSPC2_RICFE     XXXXKGXXXXXXXXYHMRERYYGSFQRSISLPANINDDAINARFENGILHITIPKK----------
HSP23_ORYSJ     ILQISGERNEKTDQWHRVERSSGKFLRRFRLPDNAKPEQIKASMENGVLTVTVPKEEA--------
HSP18_STRAL     MLTVKAERGPAGNAMEVAERPLGVFSRQLVLADTLDTEQVRADYDAGVLTLR--------------
Y2128_STRCO     ELAVAA----------------GPFRRTVPLPSALRRCTVDAALRDGTLAVRFAPDP---------
ASP2_STRTR      VLTISGQREDEKGKLIHSERSLTSVRRQYLLEN-VKEDEIKASYSDGILKVTLNKEIKTSIPIE--
HSP23_MAIZE     RVVISGERRREEAKYLRMERRMGKFMRKFVLPDNADVDKVAAVCRDGVL-----------------
HSP21_MAIZE     RVVISGERRREEAKYLRMERRMGKFMRKFVLPDNADMDKISAVCRDGVL-----------------
18KD_MYCLE      VVT---VRAERPGVMLAAERPRGVFNRQLVLGENLDTERILASYQEGVLKL---------------
HSPL_DICDI      KLIIQGKRECEKHDYLFSNRWCGSFIHHISFAKEVKASDVNVGLGEGILKITISNTP---------
HSP21_ARATH     NVLVVSGERQRENKYVRMERRMGKFMRKFQLPENADLDKISAVCHDGVLKV---------------
HSP12_SOLPE     RVQISGERNDKNDTWHRVERSSGKFMRRFRLPENAKMDQVKASMENGVLTVTVPK-----------
IBP_BUCAP       QLTVQG------------------------------------------------------------
HSPS_METJA      TLEIRAKRSPLMITXXXXXXXXXXXXXTIKLPATVKEENASAKFENGVLSV---------------
HSP42_YEAST     IEDRVGIDEKF---LKITELKYGAFERTVKFPPRIKDEEIKATYNNGLLQIKVPK-----------
HSP22_ORYSJ     ILQISGEREEKSDKWHRVERSSGKFLRRFRLPENTKPEQIKASMENGVL-----------------
HSP22_MAIZE     RVLVVSGXXXXXAKYLRMERRMGKFMRKFVLPDNADVDKVAAVCRDGVL-----------------
HSP21_SOYBN     LLLICGEREKEGAKYLRMERRVGKLMRKFVLPENANTDAISAVCQDGVLSVTVQKLP---------
HSP21_HELAN     VLVISGKRNREEEKYVRMERRMGKFMKKFALPEDANTDKISAICQDGVLTV---------------
18K1_MYCIT      VVTVRAERPALDPNMLATERPRGVFSRQLVLGENLDTDKIQASYSEGVLSL---------------
HSP30_NEUCR     --------------YWVSERSIGEFSRTFNFPGRVDQNAVSASLNNGILTITVPK-----------
HSP11_PEA       RVQISGEREDKNDEWHRVERSSGKFLRRFRLPENAKMDKVKASMENGVLTVTVPK-----------
ASP1_STRTR      VLTISGVNEDKKGKLIRSERSLTSVQRQYLLEN-VKEDEIKASYSDGVLKVTLPK-----------
18K1_MYCAV      VLTVRAERPALDPNMLATERPRGVFSRELVLGDNLDTDKIEASYRDGVLSL---------------
HSP21_SOLPE     NVLLISXXXXXXAKFIRMERRVGKFMRKFSLPENANTDAISAVCQDGVLTV---------------
HSP11_SOLLC     RVQISGERNDKNDKWHRMERSSGKFMRRFRLPENAKMDQVKASMENGVL-----------------
IBPB_SERP5      RLTVRG--KPTPSEKQVEYLHQGLVCKEFALTFTLAEQVSEAQFENGLLHIDLVRQVPEAL-----
HSP21_PEA       NVLLISXXXXXXXKYLKMERRIGKLMRKFVLPENANIEAISAISQDGVLTV---------------
HSP11_SOLPE     RVQISGERNDKNDKWQRVERSSGKFMRRFRLPENAKMDQVKASMENGVLTVTVPK-----------
IBPB_YERPY      RLTVRG--KPTPVEKQVEYLHQGLVRKEFSLTFTLAENVDNAQFENGLLHIDLLRQVPEAL-----
IBPB_YERPS      RLTVRG--KPTPVEKQVEYLHQGLVRKEFSLTFTLAENVDNAQFENGLLHIDLLRQVPEAL-----
IBPB_YERPP      RLTVRG--KPTPVEKQVEYLHQGLVRKEFSLTFTLAENVDNAQFENGLLHIDLLRQVPEAL-----
IBPB_YERPN      RLTVRG--KPTPVEKQVEYLHQGLVRKEFSLTFTLAENVDNAQFENGLLHIDLLRQVPEAL-----
IBPB_YERPG      RLTVRG--KPTPVEKQVEYLHQGLVRKEFSLTFTLAENVDNAQFENGLLHIDLLRQVPEAL-----
IBPB_YERPE      RLTVRG--KPTPVEKQVEYLHQGLVRKEFSLTFTLAENVDNAQFENGLLHIDLLRQVPEAL-----
IBPB_YERPB      RLTVRG--KPTPVEKQVEYLHQGLVRKEFSLTFTLAENVDNAQFENGLLHIDLLRQVPEAL-----
IBPB_YERPA      RLTVRG--KPTPVEKQVEYLHQGLVRKEFSLTFTLAENVDNAQFENGLLHIDLLRQVPEAL-----
IBPB_YERP3      RLTVRG--KPTPVEKQVEYLHQGLVRKEFSLTFTLAENVDNAQFENGLLHIDLLRQVPEAL-----
HS22C_SOYBN     MLVIKGSEQEHGGDDSWSSRTYSSYDTRLKLPDNCEKDKVKAELKNGVLYITIPK-----------
HS21C_SOLLC     MLV-------IKGEHKKEERNYSSYDTRLSLPDNVVKDKIKAELKNGVLFISIPK-----------
18K2_MYCAV      VLTVRAERPDLDQNMVSAERPRGVFSRQLFLGDNLDTDKIEANYHDGVLRL---------------
HSP11_MEDSA     RVQISGERNDKNDQWHRVERSSGKFMRRFRLPENAKMDQVKAAMENGVLTV---------------
HSP22_IPONI     VLVVSGERTEREKKYLRMERRVGKFMRKFVLPENANVEAINAVYQDGVLQ----------------
HSP11_HELAN     VLQISGEREEKDDTWHRVERSSGKFIRRFRLPENAKMDEVKAMMENGVL-----------------
COTM_BACSU      TVTLSGCE------FILTVKSSGTFEKQMMLPFYFNDKNIQVECENQILTVAVNK-----------
14KD_MYCTU      QLTIKAERTEQKDFDGRSEFAYGSFVRTVSLPVGADEDDIKATYDKGILTV---------------
14KD_MYCBO      QLTIKAERTEQKDFDGRSEFAYGSFVRTVSLPVGADEDDIKATYDKGILTV---------------
HSP11_CHERU     VLRISGQREEKNDTWHRVERSSGQFMRKFRLPENAKVDQVKAGMENGVLTVTVPKNEA--------
HSP11_ARATH     ILQISGEREEKSDTWHRVERSSGKFMRRFRLPENAKVEEVKASMENGVLSVTVPK-----------
IBPB_SALTY      RLTVKGTPEQPENKWLHQGLVMQPFSLSFTLAENME--VSGATFTNGLLHIDLRNEPETIAPQRIA
IBPB_SALSV      RLTVKGTPEQPENKWLHQGLVMQPFSLSFTLAENME--VSGATFTNGLLHIDLRNEPETIAPQRIA
IBPB_SALPK      RLTVKGTPEQPENKWLHQGLVMQPFSLSFTLAENME--VSGATFTNGLLHIDLRNEPETIAPQRIA
IBPB_SALPB      RLTVKGTPEQPENKWLHQGLVMQPFSLSFTLAENME--VSGATFTNGLLHIDLRNEPETIAPQRIA
IBPB_SALPA      RLTVKGTPEQPENKWLHQGLVMQPFSLSFTLAENME--VSGATFTNGLLHIDLRNEPETIAPQRIA
IBPB_SALNS      RLTVKGTPEQPENKWLHQGLVMQPFSLSFTLAENME--VSGATFTNGLLHIDLRNEPETIAPQRIA
IBPB_SALHS      RLTVKGTPEQPENKWLHQGLVMQPFSLSFTLAENME--VSGATFTNGLLHIDLRNEPETIAPQRIA
IBPB_SALDC      RLTVKGTPEQPENKWLHQGLVMQPFSLSFTLAENME--VSGATFTNGLLHIDLRNEPETIAPQRIA
IBPB_SALCH      RLTVKGTPEQPENKWLHQGLVMQPFSLSFTLAENME--VSGATFTNGLLHIDLRNEPETIAPQRIA
IBPB_SALA4      RLTVKGTPEQPENKWLHQGLVMQPFSLSFTLAENME--VSGATFTNGLLHIDLRNEPETIAPQRIA
IBPB_CITK8      RLTVKGT--PAQPEKEIKWLHQGLVTQPFSLSFTLAENVSGATFTNGLLHIDLRNEPETIAPQRIA
HSP12_MEDSA     RVQISGEREDKNDQWHRLERSSGKFMRRFRLPENAKMDQVKAAMENGVL-----------------
HS21C_ARATH     VLVIKGEQKKEXXXXXXXXXXXXXYGTRLQLPDNCEKDKIKAELKNGVLFITIPK-----------
18K2_MYCIT      VVTVRAERPDVDPSMLATERARGVFSRQLVLGDNLDTEHIDACYDAGVLRLR--------------
IBPB_ERWCT      RLTVKG--SPAPSEKAVEYLHQGLVFKPFTLSFTLAEHVSDAHFENGLLHI---------------