[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tthe0:AAS80636.1

[Show Plain Result]


## Summary of Sequence Search
    1::443
   23::414     4e-55  37%  423 aa  EPSD1_RALSO RecName: Full=NDP-N-acetyl-D-galactosaminuronic acid
   23::414     5e-55  36%  423 aa  EPSD2_RALSO RecName: Full=NDP-N-acetyl-D-galactosaminuronic acid
   26::408     9e-55  37%  424 aa  CAPL_STAAU RecName: Full=Protein capL;
   23::380     3e-54  38%  427 aa  WECC_METM7 RecName: Full=UDP-N-acetyl-D-mannosamine dehydrogenase; 
   23::380     8e-54  37%  427 aa  WECC_METM5 RecName: Full=UDP-N-acetyl-D-mannosamine dehydrogenase; 
   23::380     2e-52  36%  427 aa  WECC_METMP RecName: Full=UDP-N-acetyl-D-mannosamine dehydrogenase; 
   20::391     4e-52  34%  425 aa  VIPA_SALTI RecName: Full=Vi polysaccharide biosynthesis protein
   24::412     9e-50  37%  427 aa  WECC_METJA RecName: Full=UDP-N-acetyl-D-mannosamine dehydrogenase; 
   23::380     2e-49  35%  427 aa  WECC_METVS RecName: Full=UDP-N-acetyl-D-mannosamine dehydrogenase; 
   17::420     2e-49  35%  420 aa  WECC_SHIFL RecName: Full=UDP-N-acetyl-D-mannosamine dehydrogenase; 
   17::420     2e-49  35%  420 aa  WECC_ECOLI RecName: Full=UDP-N-acetyl-D-mannosamine dehydrogenase; 
   17::420     2e-49  35%  420 aa  WECC_ECO57 RecName: Full=UDP-N-acetyl-D-mannosamine dehydrogenase; 
   25::414     8e-49  35%  438 aa  WECC_META3 RecName: Full=UDP-N-acetyl-D-mannosamine dehydrogenase; 
   17::420     2e-48  34%  420 aa  WECC_YERPE RecName: Full=UDP-N-acetyl-D-mannosamine dehydrogenase; 
   17::351     2e-47  38%  420 aa  WECC_SALTI RecName: Full=UDP-N-acetyl-D-mannosamine dehydrogenase; 
   17::351     3e-47  37%  420 aa  WECC_SALTY RecName: Full=UDP-N-acetyl-D-mannosamine dehydrogenase; 
   21::351     4e-30  30%  461 aa  TUAD_BACSU RecName: Full=UDP-glucose 6-dehydrogenase tuaD;       
   20::394     5e-29  31%  437 aa  UDG_RHIME RecName: Full=UDP-glucose 6-dehydrogenase;       
   73::416     3e-28  30%  428 aa  YTCA_BACSU RecName: Full=Putative UDP-glucose 6-dehydrogenase ytcA;
   23::356     7e-28  31%  438 aa  ALGD_PSEPK RecName: Full=GDP-mannose 6-dehydrogenase;       
   23::356     1e-26  31%  438 aa  ALGD_PSESY RecName: Full=GDP-mannose 6-dehydrogenase;       
   23::356     1e-26  31%  438 aa  ALGD_PSESH RecName: Full=GDP-mannose 6-dehydrogenase;       
   23::356     5e-26  31%  438 aa  ALGD_PSESM RecName: Full=GDP-mannose 6-dehydrogenase;       
   23::356     7e-26  30%  436 aa  ALGD_AZOVI RecName: Full=GDP-mannose 6-dehydrogenase;       
   23::356     3e-25  30%  436 aa  ALGD_PSEAE RecName: Full=GDP-mannose 6-dehydrogenase;       
   53::391     5e-24  28%  434 aa  UDG_RICTY RecName: Full=UDP-glucose 6-dehydrogenase;       
   72::391     8e-24  27%  434 aa  UDG_RICBR RecName: Full=UDP-glucose 6-dehydrogenase;       
   17::385     1e-23  25%  440 aa  YWQF_BACSU RecName: Full=UDP-glucose 6-dehydrogenase ywqF;       
   53::391     2e-23  27%  434 aa  UDG_RICPR RecName: Full=UDP-glucose 6-dehydrogenase;       
   53::389     2e-22  27%  432 aa  UDG_RICCN RecName: Full=UDP-glucose 6-dehydrogenase;       
   53::391     3e-22  26%  448 aa  UDG_RICFE RecName: Full=UDP-glucose 6-dehydrogenase;       
   54::432     1e-19  27%  453 aa  UDG_PSEAE RecName: Full=UDP-glucose 6-dehydrogenase;       
   31::404     3e-19  29%  494 aa  UGDH_PONAB RecName: Full=UDP-glucose 6-dehydrogenase;       
   31::404     3e-19  29%  494 aa  UGDH_HUMAN RecName: Full=UDP-glucose 6-dehydrogenase;       
   31::373     4e-19  29%  493 aa  UGDH_RAT RecName: Full=UDP-glucose 6-dehydrogenase;       
   31::373     5e-19  29%  494 aa  UGDH_BOVIN RecName: Full=UDP-glucose 6-dehydrogenase;       
   31::373     1e-18  29%  493 aa  UGDH_MOUSE RecName: Full=UDP-glucose 6-dehydrogenase;       
   57::373     1e-18  29%  494 aa  UGDH_CHICK RecName: Full=UDP-glucose 6-dehydrogenase;       
   57::367     9e-18  30%  480 aa  UGDH_SOYBN RecName: Full=UDP-glucose 6-dehydrogenase;       
   55::390     2e-17  28%  476 aa  UGDH_DROME RecName: Full=UDP-glucose 6-dehydrogenase;       
   56::367     3e-17  31%  480 aa  UGDH1_ARATH RecName: Full=Probable UDP-glucose 6-dehydrogenase 1;  
   56::367     4e-17  31%  480 aa  UGDH2_ARATH RecName: Full=Probable UDP-glucose 6-dehydrogenase 2;  
   25::337     8e-17  26%  388 aa  UDG8_ECOLX RecName: Full=UDP-glucose 6-dehydrogenase;       
   25::337     1e-16  29%  388 aa  UDG_ECO11 RecName: Full=UDP-glucose 6-dehydrogenase;       
   25::337     4e-16  27%  388 aa  UDG_SALTY RecName: Full=UDP-glucose 6-dehydrogenase;       
   29::297     1e-15  27%  392 aa  UDG5_ECOLX RecName: Full=UDP-glucose 6-dehydrogenase;       
   84::453     3e-15  29%  481 aa  UGDH_CAEEL RecName: Full=UDP-glucose 6-dehydrogenase;       
   25::337     1e-13  25%  388 aa  UDG_ECO57 RecName: Full=UDP-glucose 6-dehydrogenase;       
   25::337     4e-13  25%  388 aa  UDG_ECOL6 RecName: Full=UDP-glucose 6-dehydrogenase;       
   25::337     5e-13  25%  388 aa  UDG_ECOLI RecName: Full=UDP-glucose 6-dehydrogenase;       
   16::265     7e-12  28%  895 aa  Y1054_METJA RecName: Full=Uncharacterized protein MJ1054;       
   25::288     1e-11  27%  372 aa  UDG_SHIFL RecName: Full=Putative UDP-glucose 6-dehydrogenase;      
   32::329     3e-09  27%  402 aa  UDG_STRP3 RecName: Full=UDP-glucose 6-dehydrogenase;       
   32::329     3e-09  26%  402 aa  UDG_STRPY RecName: Full=UDP-glucose 6-dehydrogenase;       
   36::345     3e-09  28%  394 aa  UDG_STRPN RecName: Full=UDP-glucose 6-dehydrogenase;       
   32::329     3e-09  26%  402 aa  UDG_STRP8 RecName: Full=UDP-glucose 6-dehydrogenase;       
   32::329     3e-09  26%  402 aa  UDG_STRP6 RecName: Full=UDP-glucose 6-dehydrogenase;       
   32::329     3e-09  26%  402 aa  UDG_STRP1 RecName: Full=UDP-glucose 6-dehydrogenase;       
   39::263     6e-04  26%  336 aa  3HIDH_BOVIN RecName: Full=3-hydroxyisobutyrate dehydrogenase,
    1::443

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPFAVEKAKVGFRVIGVEQNPRRAELVNRGESYIADVPT
EPSD1_RALSO     --------------------------------PTATVLASRQREVIGVDINQHAVDTINQGRIHIVEPDL
EPSD2_RALSO     --------------------------------PTATVLASRQRELIGVDINQHAVDTINQARIHIVEPDL
CAPL_STAAU      -------------------------------------------KVIGFDINESRIKELKNNYDRTNEVTE
WECC_METM7      --------------------------------PTASMLANHGYEVVGVDVNEKRVNHIKNGELKIEEPGL
WECC_METM5      --------------------------------PTASMLANHGYEVVGVDVNEKRVNQIKNGELKIEEPGL
WECC_METMP      --------------------------------PTASMLANHGYDVVGVDVNEKRVNQIKNGELKIEEPGL
VIPA_SALTI      --------------------------------PLAVEFGK-SRQVVGFDVNKKRILELKNG----VDVXX
WECC_METJA      --------------------------------PTASMLAIQGFDVIGVDINEKRVKEIKEFKTTEKDLMT
WECC_METVS      --------------------------------PTASMLANHGYEVIGVDISEKRVNEIKNGDFKIEEPGL
WECC_SHIFL      --------------------------------PTAAAFASRQKQVIGVDINQHAVDTINRGEIHIVEPDA
WECC_ECOLI      --------------------------------PTAAAFASRQKQVIGVDINQHAVDTINRGEIHIVEPDA
WECC_ECO57      --------------------------------PTAAAFASRQKQVIGVDINQHAVDTINRGEIHIVEPDA
WECC_META3      --------------------------------PTASMLAIQGYKVIGVDIDEERVKTIRDGKLIINEQGL
WECC_YERPE      --------------------------------PTAAAFASRKKKVIGVDVNAHAVETINRGAIHIVEPDL
WECC_SALTI      --------------------------------PTAAAFASRQKQVIGVDINQHAVDTINRGEIHIVEPAL
WECC_SALTY      --------------------------------PTAAAFASRQKQVIGVDINQHAVDIINRGEIHIVEPAL
TUAD_BACSU      --------------------------------------AEIGNKVVCCDIDESKIRSLKNGEPGLADL--
UDG_RHIME       --------------------------------------ADFGHDVVCVDKDEGKISALKKGQIPIFEPGL
YTCA_BACSU      ----------------------------------------------------------------------
ALGD_PSEPK      -----------------------------------------GHEVIGVDVSSTKIDLINQGKSPIVEPGL
ALGD_PSESY      -----------------------------------------GHEVVGVDISSTKIDLINNGKSPIVEPGL
ALGD_PSESH      -----------------------------------------GHDVVGVDISSTKIDLINNGKSPIVEPGL
ALGD_PSESM      -----------------------------------------GHDVVGVDISSTKIDLINNGKSPIVEPGL
ALGD_AZOVI      -----------------------------------------GHEVVGVDISAAKIDMINQGKSPIVEPGL
ALGD_PSEAE      -----------------------------------------GHEVIGVDVSSTKIDLINQGKSPIVEPGL
UDG_RICTY       ----------------------------------------------------------------------
UDG_RICBR       ----------------------------------------------------------------------
YWQF_BACSU      -----------------------------------VSLSEIGHHVTCIDIDAHKIDEMRKGISPIFEPGL
UDG_RICPR       ----------------------------------------------------------------------
UDG_RICCN       ----------------------------------------------------------------------
UDG_RICFE       ----------------------------------------------------------------------
UDG_PSEAE       ----------------------------------------------------------------------
UGDH_PONAB      -------------------------------------------RVTVVDVNESR---INAWNSPTLPIYE
UGDH_HUMAN      -------------------------------------------RVTVVDVNESR---INAWNSPTLPIYE
UGDH_RAT        -------------------------------------------RVTVVDVNEAR---INAWNSPTLPIYE
UGDH_BOVIN      -------------------------------------------RVTVVDINESR---INAWNSPTLPIYE
UGDH_MOUSE      -------------------------------------------RVTVVDVNEAR---INAWNSPTLPIYE
UGDH_CHICK      ----------------------------------------------------------------------
UGDH_SOYBN      ----------------------------------------------------------------------
UGDH_DROME      ----------------------------------------------------------------------
UGDH1_ARATH     ----------------------------------------------------------------------
UGDH2_ARATH     ----------------------------------------------------------------------
UDG8_ECOLX      --------------------------------------------VVALDIVQAKVDMLNKKQSPIVDKEI
UDG_ECO11       --------------------------------------------VVALDIVPTKVEMLNQKKSPIVD--K
UDG_SALTY       --------------------------------------------VVALDIVPSRVELLNDRISPIVDKEI
UDG5_ECOLX      --------------------------------------------VVAFDTHQKKVDLLNDKLSPIEDKEI
UGDH_CAEEL      ----------------------------------------------------------------------
UDG_ECO57       --------------------------------------------VVALDILPSRVAMLNDRISPIVD---
UDG_ECOL6       --------------------------------------------VVALDILPSRVAMLNDRISPIVD---
UDG_ECOLI       --------------------------------------------VVALDILPSRVAMLNDRISPIVD---
Y1054_METJA     ----------------------------------AVGLAEFGFDVVGIDIDESKVKALNRXXXXXXXXXX
UDG_SHIFL       --------------------------------------------VVALDILPSRVAMLNDRISPIVD---
UDG_STRP3       ---------------------------------------------------PSKVDKINNGLSPIQDEYI
UDG_STRPY       ---------------------------------------------------PSKVDKINNGLSPIQDEYI
UDG_STRPN       -------------------------------------------------------ESINNRKSPIKDEAI
UDG_STRP8       ---------------------------------------------------PSKVDKINNGLSPIQDEYI
UDG_STRP6       ---------------------------------------------------PSKVDKINNGLSPIQDEYI
UDG_STRP1       ---------------------------------------------------PSKVDKINNGLSPIQDEYI
3HIDH_BOVIN     -------------------------------------KTPVGFIGVGNMGNPMAKNLMKHGYPLIIDVFP


                         .         .         *         .         .         .         .:140
query           EVLKEVVDKGLLRAETGFDRVAEMDVIVIAVPTPLTRNLTPDLQYVERVTREIAPRLRPGQLISLESTTY
EPSD1_RALSO     DMLRAAVSQGYLRATT---EPEPADAFLIAVPTPFLDNKQPDLSYIEAAARAIAPVLKRGDLVVLESTSP
EPSD2_RALSO     DMLRAAVSQGYLRATT---EPEPADAFLIAVPTPFLEDKQPDLTYIEAAAKAIAPVLKRGDLVVLESTSP
CAPL_STAAU      NKLKNTNIEYTSNAED----LKKADFIIIAVPTPIDKHNKPDLLPLLKASETVGKVITPDTIVVYESTVY
WECC_METM7      LTLKGAINSKNLNVQTSAE---EADAFIICVPTPALENEDGDLTYVMSAVQAIIPFLKDGNLIVVESTIP
WECC_METM5      LTLKGAINSKNLNVQTS---ATEADAFIICVPTPALENEDGDLTYVMGAVQNIIPFLKEGNLIVIESTIP
WECC_METMP      LTLKGAINSKNLNVRTS---ATEADAFIICVPTPALASKKCDLSYVMSAVEAILPFVKDGNLIVIESTIP
VIPA_SALTI      XXXXXXXXXXYLKFTSEIEKIKECNFYIITVPTPINTYKQPDLTPLIKASETVGTVLNRGDIVVYESTVY
WECC_METJA      -LVKGAINSGNLKVQT---KPEKADVFIICVPTPCIEEKKCDLTYLNKAIESIKPYLENGNLIIIESTIP
WECC_METVS      TLLKGAINSKNLNVKT---KAEKADAFIICVPTPAIGSKKCDLSYVLDAVNSILPYIDEGNLIVIESTIP
WECC_SHIFL      SVVKTAVEGGFLRAST---TPVEADAWLIAVPTPFKGDHEPDMTYVESAARSIAPVLKKGALVILESTSP
WECC_ECOLI      SVVKTAVEGGFLRAST---TPVEADAWLIAVPTPFKGDHEPDMTYVESAARSIAPVLKKGALVILESTSP
WECC_ECO57      SVVKTAVEGGFLRAST---TPVEADAWLIAVPTPFKGDHEPDMTYVESAARSIAPVLKKGALVILESTSP
WECC_META3      TLLTGAITSGNLVVKT---EPEEADVYIICVPTPATADKNGDLICVLSAVNNIKPYLKDGDLIIIESTIP
WECC_YERPE      DVVKIAVEGGYLQAVT---KPQAADAFLIAVPTPFKGDHEPDMIFVESAAKSIAPVLKKGDLVILESTSP
WECC_SALTI      NVVKMAVEGGFLRATT---TPVEADAYLIAVPTPFKGDHDPDMAYVEAAAKSIAPVLKKGALVILESTSP
WECC_SALTY      NVVKMAVEGGFLRATT---TPVEADAYLIAVPTPFKGDHDPDMAYVEAAAKSIAPVLKKGALVILESTSP
TUAD_BACSU      -VEKNVLDQRLTFTNDIPSAIRASDIIYIAVGTPMSKTGEADLTYVKAAAKTIGEHLNGYKVIVNKSTVP
UDG_RHIME       DVASNVASGRLNFTDDLKTAVAASDVVFIAVGTPSRRDGHADLSYVYAAAREIAANLQGFTVVVTKSTVP
YTCA_BACSU      ----------------------ECPVIFIAVGTPPRSDGSADTKALQSVIGDLSEAIRSYKTIITKSTVP
ALGD_PSEPK      ELLQQGIANGRLRGTTDFEAIRASDVSMICVGTPSKKNGDLGLEYIESVCREIGYVLRDTHTIVVRSTVL
ALGD_PSESY      ELLQKGISTGKLRGTTDFEAIRATDLSMICVGTPSKKNGDLELDYIESVCREIGYVLRDKHTIVVRSTVL
ALGD_PSESH      ELLQKGISTGKLRGTTDFEAIRATDLSMICVGTPSKKNGDLELDYIESVCREIGYVLRDKHTIVVRSTVL
ALGD_PSESM      ELLQKGLATGKLRGTTDFEAIRATDLSMICVGTPSKKNGDLELDYIESVCREIGYVLRDKNTIVVRSTVL
ALGD_AZOVI      ELLAEGVKTGRLRGTTNVEAVLATELSMLCVGTPSKLNGDLELDYIEEVCRQMGSALRDKHTVVVRSTVL
ALGD_PSEAE      ELLQQGRQTGRLSGTTDFKKVLDSDVSFICVGTPSKKNGDLDLGYIETVCREIGFAIRERHTVVVRSTVL
UDG_RICTY       EYLKQALESDRLKFTNIYSNFRNVDAVFITVGTPSKELGEADLKYVYDAVDKVSKHINKDCLIVIKSTVP
UDG_RICBR       ------------------EELKNTEAVFITVGTPSKASGEADLSYVYEAIDKISLHINKDCLIVIKSTVP
YWQF_BACSU      EELKNTAD-GRLNFETSYEKLAQADIIFIAVGTPQKSDGHANLEQITDAAKRIAKHVKRDTVVVTKSTVP
UDG_RICPR       EYLKHALESDRLKFTNIYNEFRNFDAIFITVGTPSKELGEADLKYVYDAVDKVSKHINKDCLIVIKSTVP
UDG_RICCN       EYLKQALESDRLKFTNIYNNLQNADAIFITVGTPSKGLGEADLKYVYDAIDKVFEHINKDCLIVIKSTVP
UDG_RICFE       EYLKQALEANRLKFTNIYNNLQNAEAIFITVGTPSKESGEADLKYVYDAIDKVSEHINKDCLIVIKSTVP
UDG_PSEAE       -ILRDQLDAARLTFTASLEGLADAEVVFIAVGTPCGEDGSADLSHVLAVAEQLGAQLRQACIVVNKSTVP
UGDH_PONAB      PGLKEVVEKNLFFSTNIDDAIKEADLVFISVNTPMGKGRAADLKYIEACARRIVQNSN-GYKIVTEKSTV
UGDH_HUMAN      PGLKEVVEKNLFFSTNIDDAIKEADLVFISVNTPMGKGRAADLKYIEACARRIVQNSN-GYKIVTEKSTV
UGDH_RAT        PGLKEVVEKNLFFSTNIDDAIREADLVFISVNTPMGKGRAADLKYIEACARRIVQNSN-GYKIVTEKSTV
UGDH_BOVIN      PGLKEVVEKNLFFSTNIDDAIKEADLVFISVNTPMGKGRAADLKYIEACARRIVQNSH-GYKIVTEKSTV
UGDH_MOUSE      PGLKEVVEKNLFFSTNIDDAIREADLVFISVNTPMGKGRAADLKYIEACARRIVQNSN-GYKIVTEKSTV
UGDH_CHICK      --LKEVVERNLFFSTSIDDAIREADLVFISVNTPMGKGRAADLKYIEACARRIVQNSN-GYKIVTEKSTV
UGDH_SOYBN      -VVKQCRGKNLFFSTDVEKHVFEADIVFVSVNTPLGAGKAADLTYWESAARMIADVSKSDKIV-VEKSTV
UGDH_DROME      EVVKKCRNVNLFFSTDIETAIKEADLIFISVNTPTKKGRAADLKYVESAARMIAEIAQSNKIV-VEKSTV
UGDH1_ARATH     DVVKQCRGKNLFFSTDVEKHVREADIVFVSVNTPTTRGLAADLTYWESAARMIAD-VSVSDKIVVEKSTV
UGDH2_ARATH     DIVKQCRGKNLFFSTDVEKHVREADIVFVSVNTPLGAGKAADLTYWESAARMIAD-VSVSDKIVVEKSTV
UDG8_ECOLX      EEYLATKDLNFRATTDKYDAYKNADYVIIATPT----DYDPKTNYVEAVIRDVT-EINPNAVMVIKSTIP
UDG_ECO11       EIEEYLATKQLFRATTDYDAYRDGTYVIIATPT----DYDPKTNYVESVIRDVVD-INPNAVMVIKSTIP
UDG_SALTY       QFLKE--DNIRFRATLDFDAYQNADYVIIATPT----DYDPKTNYVESVMQDVIS-INPAAVMIIKSTVP
UDG5_ECOLX      ENYLSTKILNFRATTNKYEAYKNANYVIIATPT----NYDPGSNYVEAVIRDVT-EINPNAIMVVKSTVP
UGDH_CAEEL      --------------------IAEADLIFISVNTPTKKGMAPDLKYVESVSRTIA-QYAGGPKIVVEKSTV
UDG_ECO57       KEIQQFLQSDKIHFNATLDKYRDADYVIIATPT----DYDPKTNYVESVIKDVV-EINPYAVMVIKSTVP
UDG_ECOL6       KEIQQFLQSDKIHFNATLDKYRDADYVIIATPT----DYDPKTNYVESVIKDVV-EINPYAVMVIKSTVP
UDG_ECOLI       KEIQQFLQSDKIHFNATLDKYRDADYVIIATPT----DYDPKTNYVESVIKDVV-EINPYAVMVIKSTVP
Y1054_METJA     XXXKKHVNKNLTFT-TSYKPIKDSDVIFLCVGTPQDKDGNADLRFLFSAVEKIKETIEDYKVIVIKSTVP
UDG_SHIFL       KEIQQFLQSDKIHFNATLDKYRDADYVIIATPT----DYDPKTNYVESVIKDVV-EINPYAVMVIKSTVP
UDG_STRP3       EYYKQLSIKATLDSKAAYK---EAELVIIATPTNYNSRINYDTQHVETVIKEVLSVNSHATLI-IKST--
UDG_STRPY       EYYKQLSIKATLDSKAAYK---EAELVIIATPTNYNSRINYDTQHVETVIKEVLSVNSHATLI-IKST--
UDG_STRPN       E--KYLVEKEL-NLEASLDPAKDVEYAIIATPT----NYDVDLNQFDTSSVEAAIKTNDTCTIVIKSTIP
UDG_STRP8       EYYKQLSIKATLDSKAAYK---EAELVIIATPTNYNSRINYDTQHVETVIKEVLSVNSHATLI-IKST--
UDG_STRP6       EYYKQLSIKATLDSKAAYK---EAELVIIATPTNYNSRINYDTQHVETVIKEVLSVNSHATLI-IKST--
UDG_STRP1       EYYKQLSIKATLDSKAAYK---EAELVIIATPTNYNSRINYDTQHVETVIKEVLSVNSHATLI-IKST--
3HIDH_BOVIN     DACKEFLDAGEQVVSSPADVAEKADRIITMLPT--------SINAIEAYSNGILKKVKKGSLLIDSSTID


                         +         .         .         .         .         *         .:210
query           PGTTEEVMLPILEQSGLKVEEDFFLVHSPERVDPGNKRYTTRNTTKVVGGVGPRSLEAGVFFYSQTIEKV
EPSD1_RALSO     VGATEQLSLSFPHQQG--EESDIRVAHCPERVLPGHVLRELVENDRIIGGMTPKCSEAAQRLYELFVRGR
EPSD2_RALSO     VGATEQLSAWLSEQRSLGEESDIRVAHCPERVLPGHVLRELVENDRIIGGMTPRCSQAAQRLYELFVRGR
CAPL_STAAU      PGATEEECVPVLEKSGLVCGKDFFVGYSPERINPGDKVHTFETITKVVSGQTLEVLEIVADVYSSVVTAG
WECC_METM7      PETTKKIYETI--------NKKIYVAHCPERVLPGKILKELVENDRIIGGINKKSAEMAKEIYKSFVEGK
WECC_METM5      PEITKKIYETI--------DKKIYVAHCPERVLPGKILKELVENDRIIGGINKKSAEMAKEIYKSFVEGK
WECC_METMP      PETTKKIYETL--------NKKIYVAHCPERVLPGKILKELVENDRIIGGINKKSAEMAKEIYKSFVEGQ
VIPA_SALTI      PGCTEEECVPILARSGMTFNQDFYVGYSPERINPGDKKHRLTNIKKITSGSTAQIAELIDEVYQQIISAT
WECC_METJA      PGTTDDIY------KKLSKDKKIYVAHCPERVLPGSILKELVENDRVIGGVDEKSAEMAKEIYETFVTGK
WECC_METVS      PETTQKIYDII--------DKKVYVAHCPERVLPGKILKELVENDRIIGGINKKSAEMAKEIYKSFVEGK
WECC_SHIFL      VGSTEKMMRPDLQQVG--EQADVNIAYCPERVLPGQVMVELIKNDRVIGGMTPVCSARASELYKIFLEGE
WECC_ECOLI      VGSTEKMMRPDLQQVG--EQADVNIAYCPERVLPGQVMVELIKNDRVIGGMTPVCSARASELYKIFLEGE
WECC_ECO57      VGSTEKMMRPDLQQVG--EQADVNIAYCPERVLPGQVMVELIKNDRVIGGMTPVCSARASELYKIFLEGE
WECC_META3      PKTTEKIYDDISKNTG----KNIYMAYCPERVLPGNILKELVENDRTIGGINKKSAQLAKEIYASFIEGN
WECC_YERPE      VGATEQMALSFPQQAGEAA--DINIAYCPERVLPGQVMVELIQNDRVIGGMTPKCSARASALYKIFLEGE
WECC_SALTI      VGATEQMMRPDLQQAG--EQADVNIAYCPERVLPGQVMVELIKNDRVIGGMTPVCSARASALYKIFLEGE
WECC_SALTY      VGATEQMALTFPQQAG--EQADVNIAYCPERVLPGQVMVELIKNDRVIGGMTPVCSARASALYKIFLEGE
TUAD_BACSU      VGTGK--LVQSIVQKASKGRYSFDVVSNPEFLREGSAIHDTMNMERAVIGSTSHKAAAIIEELHQPFHAP
UDG_RHIME       VGTGDEVERIIRETNPAA---DVTVVSNPEFLREGAAIEDFKRPDRIVIGVDGRAREVMTEVYRPLYLNQ
YTCA_BACSU      PGTNENIAKQLIA-SGVS-KNLFNIVSNPEFLREGNALYDMLHPDKTVIGVQEEDHVSAAIVKSKHIDTP
ALGD_PSEPK      PGTVKNVVIPILEDSGKKAGVDFGVAVNPERESTAIKDYDQPPMT-VIGELDSASGDILQALYEELDAPI
ALGD_PSESY      PGTVANVVIPILEDSGKKAGVDFGVAVNPERESTAIKDYDLPPMT-VIGEFDKASGDVLQSLYEELDAPI
ALGD_PSESH      PGTVANVVIPILEDSGKKAGVDFGVAVNPERESTAIKDYDLPPMT-VIGEFDKASGDVLQSLYEELDAPI
ALGD_PSESM      PGTVANVVIPILEDSGKKAGVDFGVAVNPERESTAIKDYDLPPMT-VIGEFDKASGDVLQSLYEELDAPI
ALGD_AZOVI      PGTVHNVVIPILEESGKKAGVDFGVAVNPERESTAIKDYNFPPMT-VIGELDKASGRRLASIYAELDAPI
ALGD_PSEAE      PGTVNNVVIPLIEDSGKKAGVDFGVGTNPERESTAIKDYDFPPMT-VIGELDKQTGDLLEEIYRE-LDAP
UDG_RICTY       PGSCNNI-IAYLKAKGFS----FNVASNPEFLREGSAVEDFLYPDRIVVGVNNQESEALLTIYAPLIEQG
UDG_RICBR       PNSCNNI-INYLKEKGFS----FNVASNPEFLREGNAVEDFLYPDRIVIGVNNKESERKIYMPLTDNGAE
YWQF_BACSU      VGTNDLINGLITEHLAEPVS--ISVASNPEFLREGSAIYDTFHGDRIVIGTADEKTANTLEELFRPFQIP
UDG_RICPR       PGSCNNI-IAYLKAKGFS----FNVASNPEFLREGSAVEDFLYPDRIVVGVNNKESEALLRIYAPLIEQG
UDG_RICCN       PGSCSNI-IAYLKSRGFS----FNVASNPEFLREGSAVEDFLYPDRIVIGVNNKESEAKIYAPLQGVKFV
UDG_RICFE       PDSCSNI-IAYLKSKGFS----FNVASNPEFLREGSAVEDFLYPDRIVVGVNNKESEEILRIYAPLIEQG
UDG_PSEAE       VGTAERVEEIIXXXXXXXXXXXXXXXXSPEFLKEGSAVDDFRRPDRVI--IGSAETQAGETLFLRNHERV
UGDH_PONAB      PVRAAESIRRIFD-ANTKPNLNLQVLSNPEFLAEGTAIKDLKNPDRVIGGEGQRAVQALCAVYEHWVEKI
UGDH_HUMAN      PVRAAESIRRIFD-ANTKPNLNLQVLSNPEFLAEGTAIKDLKNPDRVIGGEGQRAVQALCAVYEHWVEKI
UGDH_RAT        PVRAAESIRRIFD-ANTKPNLNLQVLSNPEFLAEGTAIKDLKNPDRVIGGEGQRAVQALCAVYEHWVPKE
UGDH_BOVIN      PVRAAESIRRIFD-ANTKPNLNLQVLSNPEFLAEGTAIKDLKNPDRVIGGEGQRAVQALCAVYEHWVEKI
UGDH_MOUSE      PVRAAESIRRIFD-ANTKPNLNLQVLSNPEFLAEGTAIKDLKNPDRVIGGEGQKAVRALCAVYEHWVPKE
UGDH_CHICK      PVRAAESIRRIFD-ANTKPNLDLQVLSNPEFLAEGTAIKDLKNPDRVIGGEGQKAVRALCAVYEHWVPKE
UGDH_SOYBN      PVKTAEAIEKILTHNSKGIK--FQILSNPEFLAEGTAIKDLFNPDRVIGGEGQKAIQTLKDVYAQWVEER
UGDH_DROME      PVRAAESIMHIL-RANQKPGIHYDILSNPEFLAEGTAINDLLNADRVIGGEGHQAVEKLSWIYEHWIPKQ
UGDH1_ARATH     PVKTAEAIEKILTHNSKGIK--FQILSNPEFLAEGTAIKDLFNPDRVL--IGGRETPEG-FKAVQTLKNV
UGDH2_ARATH     PVKTAEAIEKILMHNSKGIK--FQILSNPEFLAEGTAIADLFNPDRVL--IGGRETPEG-FKAVQTLKEV
UDG8_ECOLX      VGFTKSIK----ERLGIDN-----LIFSPEFLREGKALYDNLHPSRIV--IGERSERAERFLQEGAIKQN
UDG_ECO11       VGFTN------LLKERLGIDNIFF---SPEFLREGRALYDNLHPSRIV--IGERSERAGRFLQEGAVKKD
UDG_SALTY       VGFTAAMRQKFATEN---------IIFSPEFLREGKALYDNLYPSRIVGEQSERAREFAALLQEGAIKQE
UDG5_ECOLX      VGFTKTIK----EHLGINN-----IIFSPEFLREGRALYDNLHPSRIIGECSERAERLAVLFQEGAIKQN
UGDH_CAEEL      PVKAAESIGCILREAQKNNENKFQVLSNPEFLAEGTAMKDLANPDRVLGESSPEGLQA-VAELVRIYENW
UDG_ECO57       VGFTEAMHKKYRTEN---------IIFSPEFLREGKALYDNLHPSRIV--IGERSERAERFLQEGAIKQN
UDG_ECOL6       VGFTAAMHKKYRTEN---------IIFSPEFLREGKALYDNLHPSRIV--IGERSERAERFLQEGAIKQN
UDG_ECOLI       VGFTAAMHKKYRTEN---------IIFSPEFLREGKALYDNLHPSRIV--IGERSERAERFLQEGAIKQN
Y1054_METJA     VGTNRRVK-ELLKDYNVDV------VSNPEFLREGIAVYDFFNPERVILGFNKKPIEIMEEVYKYFKDKN
UDG_SHIFL       VGFTAAMHKKYRTEN---------IIFSPEFLREGKALYDNLHPSRIV--IGERSERAERFLQEGAIKQN
UDG_STRP3       ------IPIGFITEMRQKFQTDR-IIFSPEFLRESKALYDNLYPSRIIVSCSPKKADAEKFXXXXXXXXX
UDG_STRPY       ------IPIGFITEMRQKFQTDR-IIFSPEFLRESKALYDNLYPSRIIVSCSPKKADAEKFXXXXXXXXX
UDG_STRPN       EGYTKEVRE--------KFNTDR-IIFSPEFLRESKALYDNLYPSRIVVGTDKRAWQFADLLKGGAIKEE
UDG_STRP8       ------IPIGFITEMRQKFQTDR-IIFSPEFLRESKALYDNLYPSRIIVSCSPKKADAEKFXXXXXXXXX
UDG_STRP6       ------IPIGFITEMRQKFQTDR-IIFSPEFLRESKALYDNLYPSRIIVSCSPKKADAEKFXXXXXXXXX
UDG_STRP1       ------IPIGFITEMRQKFQTDR-IIFSPEFLRESKALYDNLYPSRIIVSCSPKKADAEKFXXXXXXXXX
3HIDH_BOVIN     PMVSKEL---------AKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGV-EEEFAAAQELLGCMGSNV


                         .         .         .         +         .         .         .:280
query           VPVSSAKAAELVKVFENTFRAVNIALVNELAMLCDRMGLNVWEVLDAAFTKPFGIMPFYPGPGVGGHCIP
EPSD1_RALSO     CIVTDARTAEMCKLTENAFRDVNIAFANELSMICDEIGVNVWELISVANRHP-RVNILQPGPGVGGHCIA
EPSD2_RALSO     CIVTDARTAEMCKLTENAFRDVNIAFANELSMICDEIGVNVWELISVANRHP-RVNILQPGPGVGGHCIA
CAPL_STAAU      VKASSIKVAEAAKVIENTQRDVNIALMNELAIIFDKLDIDTNEVLKASGTK-WNFLNFKPGL-VGGHCIG
WECC_METM7      IYITDSNTAEMVKLMENTYRDINIALANEFAKICDEIGVNVWDAIKIANKHP-RVNILNPGPGVGGHCIS
WECC_METM5      IYITDSNTAEMVKLMENTYRDINIALANEFAKICDEIGVNVWDAIKIANKHP-RVNILNPGPGVGGHCIS
WECC_METMP      IYTTDSNTAEMVKLMENTYRDINIALANEFAKICDEIGVNVWDAIKIANKHP-RVNILNPGPGVGGHCIS
VIPA_SALTI      YKAESIKVAEAAKVIENTQRDLNIALVNELAIIFNRLNIDTEAVLRAAGSK-WNFLPFRPGL-VGGHCIG
WECC_METJA      IYLTDAKTAEMVKLMENTYRDVNIALANEFAKIAEEIGINVWEAIELANKHP-RVNILKPGPGVGGHCIS
WECC_METVS      IYITDSNTAEMVKLMENTYRDINIALANEFAKICDEIGVNVWDAIKIANKHP-RVNILNPGPGVGGHCIS
WECC_SHIFL      CVVTNSRTAEMCKLTENSFRDVNIAFANELSLICADQGINVWELIRLANRHP-RVNILQPGPGVGGHCIA
WECC_ECOLI      CVVTNSRTAEMCKLTENSFRDVNIAFANELSLICADQGINVWELIRLANRHP-RVNILQPGPGVGGHCIA
WECC_ECO57      CVVTNSRTAEMCKLTENSFRDVNIAFANELSLICADQGINVWELIRLANRHP-RVNILQPGPGVGGHCIA
WECC_META3      LYITDSTTAEMVKLMENTFRDVNIALANEFAKVSTELDINVWDAINLANKHP-RVNILNPGPGVGGHCIS
WECC_YERPE      CVVTNSRTAEMCKLTENSFRDVNIAFANELSLICDEQGINVWELIRLANRHP-RVNILQPGPGVGGHCIA
WECC_SALTI      CVVTNSRTAEMCKLTENSFRDVNIAFANELSLICAEQGINVWELIRLANRHP-RVNILQPGPGVGGHCIA
WECC_SALTY      CVVTNSRTAEMCKLTENSFRDVNIAFANELSLICAEQGINVWELIRLANRHP-RVNILQPGPGVGGHCIA
TUAD_BACSU      VIKTNLESAEMIKYAANAFLATKISFINDIANICERVGADVSKVADVGLDSRIGRKFLKAGIGFGGSCFP
UDG_RHIME       SPLTTRRTSELIKYAGNAFLAMKITFINEIADLCEKVGANVQDVLDGRIGSKF----LHAGPGYGGSCFP
YTCA_BACSU      FIVTSLAGAELIKYANNFFLAAKISFINEMARICEAYQSDISDISRAIGLDPIGKHFLQAGIGYGGSCFP
ALGD_PSEPK      IR-KPIEVAEMIKYTCNVWHATKVTFANEIGNIAKAVGVDGREVMDVVCQKVLNLSQYYMRPGFGGSCLP
ALGD_PSESY      IRKDIA-VAEMIKYTCNVWHATKVTFANEIGNIAKAVGVDGREVMDVVCQKALNLSQYYMRPGFGGSCLP
ALGD_PSESH      IRKDIA-VAEMIKYTCNVWHATKVTFANEIGNIAKAVGVDGREVMDVVCQKALNLSQYYMRPGFGGSCLP
ALGD_PSESM      IRKDIA-VAEMIKYTCNVWHATKVTFANEIGNIAKAVGVDGREVMDVVCQKALNLSQYYMRPGFGGSCLP
ALGD_AZOVI      VRKGIA-VAEMIKYTCNVWHATKVTFANEIGNIAKAAGVDGREVMEVVMDNKLNLSQYYMRPGLGGSCLP
ALGD_PSEAE      IIRKTVEVAEMIKYTCNVWHAAKVTFANEIGNIAKAVGVDGREVMDVCQDHKLNLSRYYPGFAFGGSCLP
UDG_RICTY       VKVTNLVTSELIKYASNSFLATKIAFINEMADLCEKIGANIKDLSQVGLDQRIGRNFLNAGPGFGGSCFP
UDG_RICBR       LVITDLVTAELIKYGSNSFLATKIAFINEMANLCEKIGADIKNLSKGGLDKRIGTAFLNAGPGFGGSCFP
YWQF_BACSU      IYQTDIRSAEMIKYASNAFLATKISFINEISNICEKVGADIEAVYGMGQDKRIGSQFLKAGIGYGGSCFP
UDG_RICPR       AKVTNLVTSELIKYVSNSFLATKIAFINEMADLCEKIGANIKDLSQVGLDQRIGRNFLNAGPGFGGSCFP
UDG_RICCN       V--TDLVTSELIKYASNSFLATKIAFINEMADLCEKIGGNIKDLKGVGLDQRIGQNFLNAGPGFGGSCFP
UDG_RICFE       AKVTDLVTSELIKYASNSFLATKIAFINEMADLCEKIGGNIEDLKGVGLDQRIGQNFLNAGPGFGGSCFP
UDG_PSEAE       L-LMGRREAEFSKYAANAFLATKISFMNEMAGLCALTGVDIEDVRRGMGSKRIGTHFIYAGCGYGGSCFP
UGDH_PONAB      L-TTNTWSSELSKLAANAFLAQRISSINSISALCEATGADVEEVATAGMDQRIGNKFLKASVGFGGSCFQ
UGDH_HUMAN      L-TTNTWSSELSKLAANAFLAQRISSINSISALCEATGADVEEVATAGMDQRIGNKFLKASVGFGGSCFQ
UGDH_RAT        ILTTNTWSSELSKLAANAFLAQRISSINSISALCESTGADVEEVATAGMDQRIGNKFLKASVGFGGGCFQ
UGDH_BOVIN      L-TTNTWSSELSKLTANAFLAQRISSINSISALCEATGADVEEVATAGMDQRIGNKFLKASVGFGGSCFQ
UGDH_MOUSE      ILTTNTWSSELSKLAANAFLAQRISSINSISALCEATGADVEEVATAGMDQRIGNKFLKASVGFGGSCFQ
UGDH_CHICK      ILTTNTWSSELSKLAANAFLAQRISSINSISALCEATGADVEEVARAIGTQRIGNKFLKASVGFGGSCFQ
UGDH_SOYBN      ILTTNLWSAELSKLAANAFLAQRISSVNAMSALCEATGANVQQVSYSVGTSRIGPKFLNASVGFGGSCFQ
UGDH_DROME      ILTTNTWSSELSKLAANAFLAQRISSINSLSAVCEATGADVSEVARAVLDSRIGSKFLQASVGFGGSCFQ
UGDH1_ARATH     IITTNLWSAELSKLAANAFLAQRISSVNAMSALCEATGADVTQVSYAVGTSRIGPKFLNSSVGFGGSCFQ
UGDH2_ARATH     IITTNLWSAELSKLAANAFLAQRISSVNAMSALCESTGADVTQVSYAVGTSRIGSKFLNASVGFGGSCFQ
UDG8_ECOLX      IPTTDSTEAEAIKLFANTYLAMRVAYFNELDSYAESLGLNTRQIIEGVCLDPIGNHYNNPSFGYGGYCLP
UDG_ECO11       IPTTDSTEAEAIKLFANTYLALRVAYFNELDSYAESLGLNSRQIIEGVCLDPIGNHYNNPSFGYGGYCLP
UDG_SALTY       IPTTDSTEAEAIKLFANTYLAMRVAYFNELDSYAETLGLNTRQIIEGVCLDPIGNHYNNPSFGYGGYCLP
UDG5_ECOLX      IPVTDSTEAEAIKLFSNTYLAMRVAFFNELDSYAESFGLNTRQIIDGVCLDP-RIGNYYNNPGYGGYCLP
UGDH_CAEEL      VPTTNTWSSELSKLVANAFLAQRISSINSISAVCEATGAEISEVAHAGYDTRIGSKFLQASVGFGGSCFQ
UDG_ECO57       IPTTDSTEAEAIKLFANTYLAMRVAYFNELDSYAESLGLNSRQIIEGVCLDPIGNHYNNPSFGYGGYCLP
UDG_ECOL6       IPTTDSTEAEAIKLFANTYLAMRVAYFNELDSYAESLGLNTRQIIEGVCLDPIGNHYNNPSFGYGGYCLP
UDG_ECOLI       IPMTDSTEAEAIKLFANTYLAMRVAYFNELDSYAESLGLNSRQIIEGVCLDPIGNHYNNPSFGYGGYCLP
Y1054_METJA     IPITNWETAELIKYASNAFLATKISFINELAKLSDKVKADIKTISYAMGLDPIGNKFLNAGIGYGGSCFH
UDG_SHIFL       IPTTDSTEAEAIKLFANTYLAMRVAYFNELDSYAESLGLNTRQIIEGVCLDPIGNHYNNPSFGYGGYCLP
UDG_STRP3       VLIMGASEAEAVKLFANTYLALRVAYFNELDTYAESRKLNSHMVIQGSYDDRIGMHYNNPSFGYGGYCLP
UDG_STRPY       VLIMGASEAEAVKLFANTYLALRVAYFNELDTYAESRKLNSHMIIQGSYDDRIGMHYNNPSFGYGGYCLP
UDG_STRPN       VPVVAFNEAEVAKLFSNTYLATRVRYFNEIDTYSEVKGLNPKTIIDIVCYDP-RIGSYYNNPGYGGYCLP
UDG_STRP8       VLIMGASEAEAVKLFANTYLALRVAYFNELDTYAESRKLNSHMIIQGSYDDRIGMHYNNPSFGYGGYCLP
UDG_STRP6       VLIMGASEAEAVKLFANTYLALRVAYFNELDTYAESRKLNSHMIIQGSYDDRIGMHYNNPSFGYGGYCLP
UDG_STRP1       VLIMGASEAEAVKLFANTYLALRVAYFNELDTYAESRKLNSHMIIQGSYDDRIGMHYNNPSFGYGGYCLP
3HIDH_BOVIN     VYCGAVGTGQAAKICNNLLLAISMIGTAEAMNLGIRLGLDLAKILNMSSGRCWSSDTYNPVPGV------


                         .         *         .         .         .         .         +:350
query           IDPHYLEWKAKEYNFNTHFIALAGEINRKMPEFTVEKALRVLAEAGVPVRGAKVLVLGVAYKRDIPDYRE
EPSD1_RALSO     VDPWFIVDAAPE---SARLIRTAREVNDAKPHYVLDRVKQAARRFKEPV----IACFGLSFKANIDDLRE
EPSD2_RALSO     VDPWFIVDAAPE---SARLIRTAREVNDAKPHYVLDRVKQAARRFKEPV----IACFGLSFKANIDDLRE
CAPL_STAAU      VDPYYLTHKAQEVGHHPEVILAGRRINDNMAKYIASNVIKELLKQGLEVQGATVNVLGLTFKENCPDLRN
WECC_METM7      IDP----WFIVEKTNNAKFIRAARELNDNMPAYVCKSVLSELNKLG--IEKPKISIFGATYKGNVEDTRE
WECC_METM5      IDP----WFIVEKTNNAKFIRAARELNDNMPAYVCKSVLSELKKHG--IKKPKISVFGATYKGNVEDTRE
WECC_METMP      IDP----WFIVEKTNNAKFIRAARELNDNMPAYVCNSVLSELKKLG--IEKPKISIFGATYKGNVEDTRE
VIPA_SALTI      VDPYYLTHKSQGIGYYPEIILAGRRLNDNMGNYVSEQLIKAMIKKGINVEGSSVLILGFTFKENCPDIRN
WECC_METJA      IDPWFIVEKSK----NAKLIRTARELNDSMPLFVVE-----XXXXXXXXXXXXVAIFGVTYKGNVDDTRE
WECC_METVS      IDP----WFIVEKTNNAKFIRSARELNDKMPYYVCNMIISEL--KNLNIEKPKVTVFGATYKGNVEDTRE
WECC_SHIFL      VDPWFIVAQNPQ---QARLIRTAREVNDHKPFWVIDQVKAAVADAATDKRASKIACFGLAFKPNIDDLRE
WECC_ECOLI      VDPWFIVAQNPQ---QARLIRTAREVNDHKPFWVIDQVKAAVADAATDKRASKIACFGLAFKPNIDDLRE
WECC_ECO57      VDPWFIVAQNPQ---QARLIRTAREVNDHKPFWVIDQVKAAVADAATDKRASKIACFGLAFKPNIDDLRE
WECC_META3      IDPWFIVGSSE----NAELIKKARNLNDDMPKYVASLIIKEFKEMG--ICNPKVGIFGITYKGDVEDTRE
WECC_YERPE      VDPWFIVSQNPQL---ARLIHTARLVNDGKPLWVVDRVKAAVADAASDKRASKIACFGLAFKPDIDDLRE
WECC_SALTI      VDPWFIVAQNPQ---QARLIRTAREVNDGKPHWVVDQVKAAVADAATDKRASKIACFGLAFKPNIDDLRE
WECC_SALTY      VDPWFIVAQNPQ---QARLIRTAREVNDGKPHWVVDQVKAALAATDKRASEVKIACFGLAFKPNIDDLRE
TUAD_BACSU      KDTTALLQIAKSAGYPFKLIEAVIETNEKQRVHIVDKLLTVMGS----VKGRTISVLGLAFKPNTNDVRS
UDG_RHIME       KDTLALVKTAQDHDTPVRLVETTVAVNDNRKRAMGRK---VIAAAGGDIRGSKIAVLGLTFKPNTDDMRD
YTCA_BACSU      KDLQALQFAAQEKNTETFLLRAVQHINDTQLGLYIKKIQSFFET----LQGKKAAVLGISFKPNTDDIRN
ALGD_PSEPK      KDVRALTYRAASLDVRAPLLDSLMRSN----ESQVQNAFELIEAHDK----RKVALLGLSFKAGTDDLRE
ALGD_PSESY      KDVRALTYRAGSLDVEAPLLNSLMRSNTSQ----VQNAFDMVASYDA----RKVALLGLSFKAGTDDLRE
ALGD_PSESH      KDVRALTYRASSLDVEAPLLNSLMRSNTSQ----VQNAFDMVASYDT----RKVALLGLSFKAGTDDLRE
ALGD_PSESM      KDVRALTYRAGSLDVDAPLLNSLMRSNTSQ----VQNAFDMVASYDT----RKVALLGLSFKAGTDDLRE
ALGD_AZOVI      KDVSALSYRAHLWDIEAPLISSLMRSNAAQ----VQKAYDMIDKHG----SRKVALLGLSFKAGTDDLRE
ALGD_PSEAE      KDVRALTYRASQLDVEHPMLGSLMRSNSNQ----VQKAFDLITSHDT----RKVGLLGLSFKAGTDDLRE
UDG_RICTY       KDILALNNLVENYKIDCKILKSVIKSNKLRPGNMVAKIATLL---DGDLKGRNIAILGLTYKAGTDDVRA
UDG_RICBR       KDILALNSIIKNNYIDSKILEAVIRSNKERPSLMVDKIATLLDE---DLKGKNIAVLGLTYKAGTDDVRA
YWQF_BACSU      KDTNALVQIAGNVEHDFELLKSVIKVNNNQQAMLVDKALNRLG----GVTGKTIALLGLSFKPNTDDMRE
UDG_RICPR       KDILALNNLVENHKIDCKILKSVIKSNKLRPSNMVAKIATLL---DGDLKGRNIAILGLTYKAGTDDVRA
UDG_RICCN       KDILALNNLVENHHIDCRILKAVIKSNKQRPSNMVDKIATLL---DGDLKGKNIAILGLTYKAGTDDVRA
UDG_RICFE       KDILALNNLVENHHIDCKILKAVIKSNKQRPSNMVDKIATLL---DGDLKGKNIAVLGLTYKAGTDDVRA
UDG_PSEAE       KDVRALIRSAEQQGYDSQILRAVEARNARQKELLFETLGELFQGRW---QGRTVALWGLAFKPGTDDLRE
UGDH_PONAB      KDVLNLVYLCEALNLPE--VARYWQQVIDMNDYQRRRASRIIDSLFNTVTDKKIAILGFAFKKDTGDTRE
UGDH_HUMAN      KDVLNLVYLCEALNLPE--VARYWQQVIDMNDYQRRRASRIIDSLFNTVTDKKIAILGFAFKKDTGDTRE
UGDH_RAT        KDVLNLVYLCEALNLPE--VARYWQQVIDMNDYQRRRASRIIDSLFNTVTDKKIAILGFAFKKDTGDTRE
UGDH_BOVIN      KDVLNLVYLCEALNLPE--VARYWQQVIDMNDYQRRRASRIIDSLFNTVTDKKIAILGFAFKKDTGDTRE
UGDH_MOUSE      KDVLNLVYLCEALNLPE--VARYWQQVIDMNDYQRRRASRIIDSLFNTVTDKKIAILGFAFKKDTGDTRE
UGDH_CHICK      KDVLNLVYLCEALNLPE--VARYWQQVIDMNDYQRRRASRIIDSLFNTVTDKKIAILGFAFKKDTGDTRE
UGDH_SOYBN      KDILNLVYIC-ECN-GLPEVAEYWKQVIKINDYQKSRFVRVVASMFNTVSNKKIAILGFAFKKDTGDTRE
UGDH_DROME      KDILNLIYICE--NLNLPEVAAYWQQVIDMNEYQKRRSQKIIESLFNTVSDKRIAILGFAFKKNTGDTRE
UGDH1_ARATH     KDILNLVYIC-ECN-GLPEVAEYWKQVIKINDYQKSRFVRVVSSMFNSVSNKKIAVLGFAFKKDTGDTRE
UGDH2_ARATH     KDPEVAEYWKQVIKINDY------QKNRFVN--------RIVSSMFNTVSNKKVAILGFAFKKDTGDTRE
UDG8_ECOLX      KDTKQL--LANYQSVPNNLISAIVDANRTRKDF--------IADAILSRKPQVVGIYRLIMKSGSDNFRA
UDG_ECO11       KDTKQL--LANYASVPNNIIGAIVDANRTRKDFIADSIL---------ARKPKVVVYRLIMKSGSDNFRA
UDG_SALTY       KDTKQL--LANYQSVPNNIISAIVEANRTRKDF--------IADAILARKPKVVGIYRLIMKSGSDNFRA
UDG5_ECOLX      KDTKQL--LANYQSVPNKLISAIVDANRTRKDFITNVILK------------------------------
UGDH_CAEEL      KDVLSLVYLCESLNLPQVADYWQGVININNWQ-RRRFADKIIAELFNTVTDXXXXXXXXXXXXNTGDTRE
UDG_ECO57       KDTKQL--LANYQSVPNNLISAIVDANRTRKDF--------IADAILSRKPQVVGIYRLIMKSGSDNFRA
UDG_ECOL6       KDTKQL--LANYQSVPNNLISAIVDANRTRKDF--------IADAILSRKPQVVGIYRLIMKSGSDNFRA
UDG_ECOLI       KDTKQL--LANYQSVPNNLISAIVDANRTRKDF--------IADAILSRKPQVVGIYRLIMKSGSDNFRA
Y1054_METJA     PD--------------------------------------------------------------------
UDG_SHIFL       KDTKQL--LANYQSVPNNLISAIVDANRKWWVFIV-----------------------------------
UDG_STRP3       KDTKQL--LANYNNIPQTLIEAIVSSNNVRKSYIAKQIINVLEEQESPVK--VVGVYRLIMKSNSDNFRE
UDG_STRPY       KDTKQL--LANYNNIPQTLIEAIVSSNNVRKSYIAKQIINVLKEQESPVK--VVGVYRLIMKSNSDNFRE
UDG_STRPN       KDTKQL--KASFRDVPENLITAVVQSNKTRKDY--------IAGAILAKQPSVVGIYRLIMKSDSDNFRS
UDG_STRP8       KDTKQL--LANYNNIPQTLIEAIVSSNNVRKSYIAKQIINVLKEQESPVK--VVGVYRLIMKSNSDNFRE
UDG_STRP6       KDTKQL--LANYNNIPQTLIEAIVSSNNVRKSYIAKQIINVLKEQESPVK--VVGVYRLIMKSNSDNFRE
UDG_STRP1       KDTKQL--LANYNNIPQTLIEAIVSSNNVRKSYIAKQIINVLEERESPVK--VVGVYRLIMKSNSDNFRE
3HIDH_BOVIN     ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           SPAIEVIRGLRRLGAEVEYHDPHVPRFAEGGLAMESVPLSEERVREKDLVLIATDHSAFDYKAIVAQARR
EPSD1_RALSO     SPAIEIVQTMQQLGT-VLVVEPHIKVLP---AALQGVELAEAALSRADIVVLLVDHQQFKLDTDRLQSRV
EPSD2_RALSO     SPAIEIVRTMQQLGTVVEPHIKVLPASLEGVELLNAEP----ALSRADIVVLLVDHQKFKLDTDRLQSRV
CAPL_STAAU      TKVIHIIEELKEYGLNVTVNDVEADKEAKKFFGLDLIDTKE--LKMVDVVLFAVPHKDYDYINLVKDCGI
WECC_METM7      SPSKNVIKMLLENGATVSTFDPHADCF--------EYPLSDECISGSDCIVVLTDHDAF-----------
WECC_METM5      SPSKNVIEMLLKNGVTVSTFDPHATCF--------EYPLSDECISGSDCIVVLTDHDAF-----------
WECC_METMP      SPSKNVIKMLLENGATVSTYDPHASYF--------EYPLSDECISGSDCIVVLTDHDVF-----------
VIPA_SALTI      TRIIDVVKELGKYSCKVDIFDPWVDA-EEVRREYGIIPVSEVKSSHYDAIIVAVGHQQF-----------
WECC_METJA      SPAEKVVSKLIDEGFEVKCYDKYARDFI--------YPLNDEAVEGADIIVILAEHDEYDIKNIASKVKN
WECC_METVS      SPSKKVIDALAEKNIPVSTYDPHANSFE---YELHSL---EDSIVNSDCIVVLTDHNEF-----------
WECC_SHIFL      SPAMEIAELIAQWSGETLVVEPNIHQLPKKLTGLCTLAQLDEALATADVLVMLVDHSQFKINGDNVHQQY
WECC_ECOLI      SPAMEIAELIAQWSGETLVVEPNIHQLPKKLTGLCTLAQLDEALATADVLVMLVDHSQFKINGDNVHQQY
WECC_ECO57      SPAMEIAELIAQWSGETLVVEPNIHQLPKKLTGLCTLAQLDEALATADVLVMLVDHSQFKINGDNVHQQY
WECC_META3      TPARAIIDYLLQNDFEVSIYDPYAKDF--------EYPLNEESIKNSDALIFLTDHSEFDIKEIMMKNKI
WECC_YERPE      SPAVGVARLIAEWHGETLVVEPNVEQLPKSLMGLVTLKDTATALQQADVLVMLVDHKQF--KAIKPEQQW
WECC_SALTI      SPAMGIAQSIAR----------------------------------------------------------
WECC_SALTY      SPAMGIAQSIAR----------------------------------------------------------
TUAD_BACSU      APALDIIPMLQQLGAHVKAYDP------------------------------------------------
UDG_RHIME       SPAIAVVQALQDAGARVTGYDPNARKLIEG---LDCARDPYEAAAEADALVIITEWNEF-----------
YTCA_BACSU      SQAVRLMERLAELGCDVHAYDPELPEHLRQHVTQHSQAF--DAIEESDFLFLATEWSAFDWKADIMKGRL
ALGD_PSEPK      SPLVELAERLIGKGYQLDIYDENV----------------------------------------------
ALGD_PSESY      SPLVELAEMLIGKGFDLSIFDSNV----------------------------------------------
ALGD_PSESH      SPLVELAEMLIGKGFDLSIFDSNV----------------------------------------------
ALGD_PSESM      SPLVELAEMLIGKGFDLSIFDSNV----------------------------------------------
ALGD_AZOVI      SPQLELAEMLIGKGFKLSIFDSNV----------------------------------------------
ALGD_PSEAE      SPLVELAEMLIGKGYELRIFDRNV----------------------------------------------
UDG_RICTY       SPAIEIITILLNKDVYVKAFDPIGLENAKKNLEHKNLASAVEACESVDIIVIATEWSEF-----------
UDG_RICBR       SPAIEIIKNLLDKGTYVKAFDPMGLENSQKTFQNENLLYLDSAIKSSDAIIITTEWSEF-----------
YWQF_BACSU      APSIVXXXXXXXXXXXXXXYDPIAVSHAKHVLAVEYKETIEEAVKGSDAVMILTD---------------
UDG_RICPR       SPAIEIITILLNKDVYVKAFDPIGLENAKKNLEHKNLASAVEACKSVDIIVIATEWSEF-----------
UDG_RICCN       SPAIAIVKILLNKDVYVKAFDPIGLENAKKNLEHKNLLYLDSAVKSVDIIVIATEWSEF-----------
UDG_RICFE       SPAIEIVKILLNKDVYVKAFDPIGLENAKKNLEHKNLLYLDEACKSVDIIVIATEWLEF-----------
UDG_PSEAE       APSLVLLEALLRHGVRVRAHDP----VANAGVAAEAVACARAAVEGADALVLVTEWKQFDFQKIRGSMRT
UGDH_PONAB      SSSIYISKYLMDEGAHLHIYDPKVPR------EQIVVDLSHPGVSEDDQVSRLVTISKDPYEA-------
UGDH_HUMAN      SSSIYISKYLMDEGAHLHIYDPKVPR------EQIVVDLSHPGVSEDDQVSRLVTISKDPYEA-------
UGDH_RAT        SSSIYISKYLMDEGAHLHIYDPKVPR--------------------------------------------
UGDH_BOVIN      SSSIYISKYLMDEGAHLHIYDPKVPR--------------------------------------------
UGDH_MOUSE      SSSIYISKYLMDEGAHLHIYDPKVPR--------------------------------------------
UGDH_CHICK      SSSIYISKYLMDEGAKLHIYDPKVPK--------------------------------------------
UGDH_SOYBN      TPAIDVCQGLLGDKANLSIYDPQV----------------------------------------------
UGDH_DROME      TAAITVCQTLLEEGAALDIYDPKVPEQIIDDLTHPSVTESPEKVKK------------------------
UGDH1_ARATH     TPAIDVCKGLLEDKARLSIYDPQV----------------------------------------------
UGDH2_ARATH     TPAIDVCKGLLGDKAQISIYDPQV----------------------------------------------
UDG8_ECOLX      SSIQGIMKRIKAKGVEVIIYEP------------------------------------------------
UDG_ECO11       SSIQGIMKRIKAKGVPVIIYEP------------------------------------------------
UDG_SALTY       SSIQGIMKRIKAKGVEVIIYEP------------------------------------------------
UDG5_ECOLX      ----------------------------------------------------------------------
UGDH_CAEEL      SSAIHVIKHLMEEHAKLSVYDPKVQKSVERLITVESDPYAAARGAHAIVVLTEWDHNDMQHPAAIFDGRL
UDG_ECO57       SSIQGIMKRIKAKGVEVIIYEP------------------------------------------------
UDG_ECOL6       SSIQGIMKRIKAKGVEVIIYEP------------------------------------------------
UDG_ECOLI       SSIQGIMKRIKAKGVEVIIYEP------------------------------------------------
Y1054_METJA     ----------------------------------------------------------------------
UDG_SHIFL       ----------------------------------------------------------------------
UDG_STRP3       S---------------------------------------------------------------------
UDG_STRPY       S---------------------------------------------------------------------
UDG_STRPN       SAVKGVMERLDNYGKEIVIYEPTI----------------------------------------------
UDG_STRP8       S---------------------------------------------------------------------
UDG_STRP6       S---------------------------------------------------------------------
UDG_STRP1       S---------------------------------------------------------------------
3HIDH_BOVIN     ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           VLDARGATRHLPRELTExxxxxx
EPSD1_RALSO     VIDTRG-----------------
EPSD2_RALSO     VIDTRG-----------------
CAPL_STAAU      VFDIKG-----------------
WECC_METM7      -----------------------
WECC_METM5      -----------------------
WECC_METMP      -----------------------
VIPA_SALTI      -----------------------
WECC_METJA      ILDTKNI---LNRELWE------
WECC_METVS      -----------------------
WECC_SHIFL      VVDAKGVWR--------------
WECC_ECOLI      VVDAKGVWR--------------
WECC_ECO57      VVDAKGVWR--------------
WECC_META3      VMDMKNTLNH-------------
WECC_YERPE      IVDTKGVWR--------------
WECC_SALTI      -----------------------
WECC_SALTY      -----------------------
TUAD_BACSU      -----------------------
UDG_RHIME       -----------------------
YTCA_BACSU      VIDGRNV---LKKELIE------
ALGD_PSEPK      -----------------------
ALGD_PSESY      -----------------------
ALGD_PSESH      -----------------------
ALGD_PSESM      -----------------------
ALGD_AZOVI      -----------------------
ALGD_PSEAE      -----------------------
UDG_RICTY       -----------------------
UDG_RICBR       -----------------------
YWQF_BACSU      -----------------------
UDG_RICPR       -----------------------
UDG_RICCN       -----------------------
UDG_RICFE       -----------------------
UDG_PSEAE       PLLVDGRNLYAPARMAE------
UGDH_PONAB      -----------------------
UGDH_HUMAN      -----------------------
UGDH_RAT        -----------------------
UGDH_BOVIN      -----------------------
UGDH_MOUSE      -----------------------
UGDH_CHICK      -----------------------
UGDH_SOYBN      -----------------------
UGDH_DROME      -----------------------
UGDH1_ARATH     -----------------------
UGDH2_ARATH     -----------------------
UDG8_ECOLX      -----------------------
UDG_ECO11       -----------------------
UDG_SALTY       -----------------------
UDG5_ECOLX      -----------------------
UGDH_CAEEL      ILDQK------------------
UDG_ECO57       -----------------------
UDG_ECOL6       -----------------------
UDG_ECOLI       -----------------------
Y1054_METJA     -----------------------
UDG_SHIFL       -----------------------
UDG_STRP3       -----------------------
UDG_STRPY       -----------------------
UDG_STRPN       -----------------------
UDG_STRP8       -----------------------
UDG_STRP6       -----------------------
UDG_STRP1       -----------------------
3HIDH_BOVIN     -----------------------