[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tthe0:AAS80664.1

[Show Plain Result]


## Summary of Sequence Search
    1::64
    5::66      1e-04  36%  324 aa  THIG_MAGSA RecName: Full=Thiazole biosynthesis protein thiG;
    1::64

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxLNGEPRPLEGKTLKEVLEEMGVELKGVAVLLNEEAFLGLEVPDRPLRDGDVVEVVALMQGG
THIG_MAGSA      ---INGEERNFSASTVEALLGELGVDSRKVAVERNLEIVPKSSYAQVAVNDGDKLEIVAFIGGG