[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tthe0:AAS80675.1

[Show Plain Result]


## Summary of Sequence Search
    1::369
  155::292     3e-22  51%  292 aa  Y1215_PYRHO RecName: Full=Probable ABC transporter permease protein
  158::261     5e-17  38%  292 aa  AMYD_THETU RecName: Full=Probable starch degradation products
  160::241     7e-16  45%  291 aa  Y1038_PYRHO RecName: Full=Probable ABC transporter permease protein
    3::105     2e-13  37%  140 aa  YOR1_CALSR RecName: Full=Putative ABC transporter permease protein
  161::264     3e-12  37%  298 aa  LACF_RHIRD RecName: Full=Lactose transport system permease protein
  204::279     6e-12  36%  336 aa  AGLF_RHIME RecName: Full=Alpha-glucoside transport system permease
  158::260     8e-12  32%  289 aa  Y2990_BRUA2 RecName: Full=Probable ABC transporter permease protein
  158::260     8e-12  32%  289 aa  Y2783_BRUAB RecName: Full=Probable ABC transporter permease protein
   16::125     3e-11  37%  290 aa  MSMF_STRMU RecName: Full=Multiple sugar-binding transport system
  143::271     4e-11  34%  309 aa  YESP_BACSU RecName: Full=Probable ABC transporter permease protein
   96::149     4e-11  33%  289 aa  Y3749_BRUSU RecName: Full=Probable ABC transporter permease protein
  125::260     7e-11  32%  294 aa  UGPA_YERPS RecName: Full=sn-glycerol-3-phosphate transport system
  125::260     7e-11  32%  295 aa  UGPA_YERPN RecName: Full=sn-glycerol-3-phosphate transport system
  125::260     7e-11  32%  295 aa  UGPA_YERPE RecName: Full=sn-glycerol-3-phosphate transport system
  125::260     7e-11  32%  295 aa  UGPA_YERPA RecName: Full=sn-glycerol-3-phosphate transport system
  120::264     9e-11  33%  293 aa  YCJO_SHIFL RecName: Full=Inner membrane ABC transporter permease
  120::264     9e-11  33%  293 aa  YCJO_ECOLI RecName: Full=Inner membrane ABC transporter permease
  125::239     1e-10  31%  295 aa  UGPA_YERE8 RecName: Full=sn-glycerol-3-phosphate transport system
  125::221     3e-10  33%  295 aa  UGPA_ERWCT RecName: Full=sn-glycerol-3-phosphate transport system
   27::150     2e-09  32%  292 aa  YURN_BACSU RecName: Full=Probable ABC transporter permease protein
  126::221     8e-09  30%  295 aa  UGPA_SHIFL RecName: Full=sn-glycerol-3-phosphate transport system
  126::221     8e-09  30%  295 aa  UGPA_SHIF8 RecName: Full=sn-glycerol-3-phosphate transport system
  126::221     8e-09  31%  295 aa  UGPA_SALTY RecName: Full=sn-glycerol-3-phosphate transport system
  126::221     8e-09  31%  295 aa  UGPA_SALTI RecName: Full=sn-glycerol-3-phosphate transport system
  126::221     8e-09  31%  295 aa  UGPA_SALPA RecName: Full=sn-glycerol-3-phosphate transport system
  126::221     8e-09  31%  295 aa  UGPA_SALCH RecName: Full=sn-glycerol-3-phosphate transport system
  126::221     8e-09  30%  295 aa  UGPA_ECOUT RecName: Full=sn-glycerol-3-phosphate transport system
  126::221     8e-09  30%  295 aa  UGPA_ECOLI RecName: Full=sn-glycerol-3-phosphate transport system
  126::221     8e-09  30%  295 aa  UGPA_ECOL6 RecName: Full=sn-glycerol-3-phosphate transport system
  126::221     8e-09  30%  295 aa  UGPA_ECOL5 RecName: Full=sn-glycerol-3-phosphate transport system
  126::221     8e-09  30%  295 aa  UGPA_ECOK1 RecName: Full=sn-glycerol-3-phosphate transport system
  126::221     8e-09  30%  295 aa  UGPA_ECO57 RecName: Full=sn-glycerol-3-phosphate transport system
  168::271     2e-08  33%  309 aa  Y4OQ_RHISN RecName: Full=Probable ABC transporter permease protein
  179::239     2e-08  34%  313 aa  ARAP_BACSU RecName: Full=L-arabinose transport system permease
  126::221     2e-08  29%  295 aa  UGPA_SHIDS RecName: Full=sn-glycerol-3-phosphate transport system
    8::133     7e-08  25%  293 aa  UGPA_AGRT5 RecName: Full=sn-glycerol-3-phosphate transport system
  181::260     1e-07  35%  316 aa  ARAP_BACHD RecName: Full=L-arabinose transport system permease
  113::205     2e-07  33%  293 aa  UGPA_RHIME RecName: Full=sn-glycerol-3-phosphate transport system
  292::353     2e-07  35%  435 aa  MALC_STRR6 RecName: Full=Maltodextrin transport system permease
  292::353     2e-07  35%  435 aa  MALC_STRPN RecName: Full=Maltodextrin transport system permease
  113::237     3e-07  27%  293 aa  UGPA_BRUSU RecName: Full=sn-glycerol-3-phosphate transport system
  114::238     3e-07  27%  291 aa  UGPA_BRUME RecName: Full=sn-glycerol-3-phosphate transport system
  113::237     3e-07  27%  293 aa  UGPA_BRUAB RecName: Full=sn-glycerol-3-phosphate transport system
  113::237     3e-07  27%  293 aa  UGPA_BRUA2 RecName: Full=sn-glycerol-3-phosphate transport system
  148::230     2e-06  38%  296 aa  MALG_VIBPA RecName: Full=Maltose transport system permease protein
  370::483     2e-06  31%  518 aa  MALF_PHOLL RecName: Full=Maltose transport system permease protein
  161::225     3e-06  42%  296 aa  MALG_SHIFL RecName: Full=Maltose transport system permease protein
  161::225     3e-06  42%  296 aa  MALG_SALTY RecName: Full=Maltose transport system permease protein
  161::225     3e-06  42%  296 aa  MALG_SALTI RecName: Full=Maltose transport system permease protein
  161::225     3e-06  42%  296 aa  MALG_ECOLI RecName: Full=Maltose transport system permease protein
  161::225     3e-06  42%  296 aa  MALG_ECOL6 RecName: Full=Maltose transport system permease protein
  161::225     3e-06  42%  296 aa  MALG_ECO57 RecName: Full=Maltose transport system permease protein
  388::483     3e-06  32%  530 aa  MALF_YERPE RecName: Full=Maltose transport system permease protein
  293::366     4e-06  31%  435 aa  MDXF_BACSU RecName: Full=Maltodextrin transport system permease
  168::232     4e-06  42%  303 aa  MALG_YERPE RecName: Full=Maltose transport system permease protein
  251::302     4e-06  42%  380 aa  AGLG_RHIME RecName: Full=Alpha-glucoside transport system permease
  161::225     5e-06  42%  296 aa  MALG_ENTAE RecName: Full=Maltose transport system permease protein
  161::226     7e-06  39%  296 aa  MALG_PHOLL RecName: Full=Maltose transport system permease protein
  139::246     1e-05  37%  275 aa  YOR2_CALSR RecName: Full=Putative ABC transporter permease protein
  148::226     1e-05  35%  296 aa  MALG_VIBVY RecName: Full=Maltose transport system permease protein
  148::226     1e-05  35%  296 aa  MALG_VIBVU RecName: Full=Maltose transport system permease protein
  148::226     1e-05  35%  296 aa  MALG_VIBCH RecName: Full=Maltose transport system permease protein
  164::201     1e-05  42%  276 aa  YJ16_PYRHO RecName: Full=Probable ABC transporter permease protein
  166::204     1e-05  41%  279 aa  ARAQ_BACHD RecName: Full=L-arabinose transport system permease
  140::202     2e-05  32%  277 aa  MSMG_STRMU RecName: Full=Multiple sugar-binding transport system
  381::487     2e-05  33%  523 aa  MALF_VIBVY RecName: Full=Maltose transport system permease protein
  381::487     2e-05  33%  523 aa  MALF_VIBVU RecName: Full=Maltose transport system permease protein
  182::277     2e-05  24%  318 aa  LPLB_BACSU RecName: Full=Protein lplB;
  186::288     3e-05  25%  321 aa  YTEP_BACSU RecName: Full=Uncharacterized multiple-sugar transport
   99::189     4e-05  34%  275 aa  Y1216_PYRHO RecName: Full=Probable ABC transporter permease protein
  100::207     4e-05  32%  241 aa  NOCM_AGRT5 RecName: Full=Nopaline transport system permease protein
  121::191     7e-05  32%  257 aa  POTC_HAEIN RecName: Full=Spermidine/putrescine transport system
  176::220     9e-05  40%  296 aa  YESQ_BACSU RecName: Full=Probable ABC transporter permease protein
  168::206     2e-04  41%  281 aa  ARAQ_BACSU RecName: Full=L-arabinose transport system permease
  131::214     2e-04  35%  289 aa  PHNU_SALTI RecName: Full=Putative 2-aminoethylphosphonate transport
  125::236     2e-04  26%  286 aa  NIFC_CLOPA RecName: Full=Probable transport system permease protein
   98::162     2e-04  31%  235 aa  HISM_SALTY RecName: Full=Histidine transport system permease
   98::162     2e-04  31%  235 aa  HISM_SALTI RecName: Full=Histidine transport system permease
  169::209     3e-04  44%  281 aa  UGPE_SALTY RecName: Full=sn-glycerol-3-phosphate transport system
  169::209     3e-04  44%  281 aa  UGPE_SALTI RecName: Full=sn-glycerol-3-phosphate transport system
  169::209     3e-04  44%  281 aa  UGPE_SALPA RecName: Full=sn-glycerol-3-phosphate transport system
  169::209     3e-04  44%  281 aa  UGPE_SALCH RecName: Full=sn-glycerol-3-phosphate transport system
  131::213     3e-04  35%  289 aa  PHNU_SALPA RecName: Full=Putative 2-aminoethylphosphonate transport
   98::162     3e-04  31%  238 aa  HISM_SHIFL RecName: Full=Histidine transport system permease
   98::162     3e-04  31%  238 aa  HISM_ECOLI RecName: Full=Histidine transport system permease
   98::162     3e-04  31%  238 aa  HISM_ECOL6 RecName: Full=Histidine transport system permease
   98::162     3e-04  31%  238 aa  HISM_ECO57 RecName: Full=Histidine transport system permease
  149::201     4e-04  26%  273 aa  LACG_RHIRD RecName: Full=Lactose transport system permease protein
  169::209     5e-04  44%  281 aa  UGPE_SHIFL RecName: Full=sn-glycerol-3-phosphate transport system
  169::209     5e-04  44%  281 aa  UGPE_SHIF8 RecName: Full=sn-glycerol-3-phosphate transport system
  169::209     5e-04  44%  281 aa  UGPE_SHIDS RecName: Full=sn-glycerol-3-phosphate transport system
  169::209     5e-04  44%  281 aa  UGPE_ECOUT RecName: Full=sn-glycerol-3-phosphate transport system
  169::209     5e-04  44%  281 aa  UGPE_ECOLI RecName: Full=sn-glycerol-3-phosphate transport system
  169::209     5e-04  44%  281 aa  UGPE_ECOL6 RecName: Full=sn-glycerol-3-phosphate transport system
  169::209     5e-04  44%  281 aa  UGPE_ECOL5 RecName: Full=sn-glycerol-3-phosphate transport system
  169::209     5e-04  44%  281 aa  UGPE_ECOK1 RecName: Full=sn-glycerol-3-phosphate transport system
  169::209     5e-04  44%  281 aa  UGPE_ECO57 RecName: Full=sn-glycerol-3-phosphate transport system
  150::213     5e-04  34%  286 aa  PHNU_SALTY RecName: Full=Putative 2-aminoethylphosphonate transport
  150::213     5e-04  34%  286 aa  PHNU_SALCH RecName: Full=Putative 2-aminoethylphosphonate transport
  377::488     5e-04  29%  524 aa  MALF_VIBCH RecName: Full=Maltose transport system permease protein
  123::191     6e-04  25%  264 aa  POTC_SHIFL RecName: Full=Spermidine/putrescine transport system
  123::191     6e-04  25%  264 aa  POTC_ECOLI RecName: Full=Spermidine/putrescine transport system
  123::191     6e-04  25%  264 aa  POTC_ECOL6 RecName: Full=Spermidine/putrescine transport system
  123::191     6e-04  25%  264 aa  POTC_ECO57 RecName: Full=Spermidine/putrescine transport system
  149::195     6e-04  38%  278 aa  MDXG_BACSU RecName: Full=Maltodextrin transport system permease
   96::151     8e-04  43%  229 aa  MODB_ECOLI RecName: Full=Molybdenum transport system permease
   96::151     8e-04  43%  229 aa  MODB_ECO57 RecName: Full=Molybdenum transport system permease
  124::192     8e-04  41%  255 aa  CYST_PROWI RecName: Full=Probable sulfate transport system permease
  126::203     8e-04  37%  266 aa  CYST_CHLVU RecName: Full=Probable sulfate transport system permease
   17::154     8e-07  23%  309 aa  YESP_BACSU RecName: Full=Probable ABC transporter permease protein(query 2->148)
   13::148     7e-05  26%  294 aa  UGPA_YERPS RecName: Full=sn-glycerol-3-phosphate transport system(query 6->155)
   13::148     3e-04  26%  295 aa  UGPA_YERPN RecName: Full=sn-glycerol-3-phosphate transport system(query 6->155)
   13::148     3e-04  26%  295 aa  UGPA_YERPE RecName: Full=sn-glycerol-3-phosphate transport system(query 6->155)
   13::148     3e-04  26%  295 aa  UGPA_YERPA RecName: Full=sn-glycerol-3-phosphate transport system(query 6->155)
   13::136     5e-04  26%  295 aa  UGPA_YERE8 RecName: Full=sn-glycerol-3-phosphate transport system(query 6->139)
    9::148     1e-06  27%  295 aa  UGPA_ERWCT RecName: Full=sn-glycerol-3-phosphate transport system(query 2->155)
    9::136     6e-04  27%  295 aa  UGPA_SALTY RecName: Full=sn-glycerol-3-phosphate transport system(query 2->139)
    9::136     6e-04  27%  295 aa  UGPA_SALTI RecName: Full=sn-glycerol-3-phosphate transport system(query 2->139)
    9::136     6e-04  27%  295 aa  UGPA_SALPA RecName: Full=sn-glycerol-3-phosphate transport system(query 2->139)
    9::136     6e-04  27%  295 aa  UGPA_SALCH RecName: Full=sn-glycerol-3-phosphate transport system(query 2->139)
    9::136     2e-04  27%  295 aa  UGPA_ECO57 RecName: Full=sn-glycerol-3-phosphate transport system(query 2->139)
   37::185     7e-06  29%  309 aa  Y4OQ_RHISN RecName: Full=Probable ABC transporter permease protein(query 15->172)
  113::195     2e-07  38%  293 aa  UGPA_AGRT5 RecName: Full=sn-glycerol-3-phosphate transport system(query 200->273)
    8::133     7e-06  34%  293 aa  UGPA_RHIME RecName: Full=sn-glycerol-3-phosphate transport system(query 3->138)
    8::133     1e-05  35%  293 aa  UGPA_BRUSU RecName: Full=sn-glycerol-3-phosphate transport system(query 3->138)
    8::134     2e-05  35%  291 aa  UGPA_BRUME RecName: Full=sn-glycerol-3-phosphate transport system(query 3->138)
    8::133     1e-05  35%  293 aa  UGPA_BRUAB RecName: Full=sn-glycerol-3-phosphate transport system(query 3->138)
    8::133     1e-05  35%  293 aa  UGPA_BRUA2 RecName: Full=sn-glycerol-3-phosphate transport system(query 3->138)
    1::369

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xRDRILAFLVLLPSVLAVGVFVYGFIGQNLWVSLTDWGKDPAQALALRPELRFVGLENYRELFTGFVDVR
Y1215_PYRHO     ----------------------------------------------------------------------
AMYD_THETU      ----------------------------------------------------------------------
Y1038_PYRHO     ----------------------------------------------------------------------
YOR1_CALSR      ----------------------------------------------------------------------
LACF_RHIRD      ----------------------------------------------------------------------
AGLF_RHIME      ----------------------------------------------------------------------
Y2990_BRUA2     ----------------------------------------------------------------------
Y2783_BRUAB     ----------------------------------------------------------------------
MSMF_STRMU      ---------LIVPLILQV-VFFYFPMFQGAFYSFTNW-------TGLTYNFDFVGINNYKILMT---DGK
YESP_BACSU      ----------------------------------------------------------------------
Y3749_BRUSU     ----------------------------------------------------------------------
UGPA_YERPS      ----------------------------------------------------------------------
UGPA_YERPN      ----------------------------------------------------------------------
UGPA_YERPE      ----------------------------------------------------------------------
UGPA_YERPA      ----------------------------------------------------------------------
YCJO_SHIFL      ----------------------------------------------------------------------
YCJO_ECOLI      ----------------------------------------------------------------------
UGPA_YERE8      ----------------------------------------------------------------------
UGPA_ERWCT      ----------------------------------------------------------------------
YURN_BACSU      -------------------------IFENVFLSLFQWS-------SFSPEKTFIGLKNYVELFH---DPV
UGPA_SHIFL      ----------------------------------------------------------------------
UGPA_SHIF8      ----------------------------------------------------------------------
UGPA_SALTY      ----------------------------------------------------------------------
UGPA_SALTI      ----------------------------------------------------------------------
UGPA_SALPA      ----------------------------------------------------------------------
UGPA_SALCH      ----------------------------------------------------------------------
UGPA_ECOUT      ----------------------------------------------------------------------
UGPA_ECOLI      ----------------------------------------------------------------------
UGPA_ECOL6      ----------------------------------------------------------------------
UGPA_ECOL5      ----------------------------------------------------------------------
UGPA_ECOK1      ----------------------------------------------------------------------
UGPA_ECO57      ----------------------------------------------------------------------
Y4OQ_RHISN      ----------------------------------------------------------------------
ARAP_BACSU      ----------------------------------------------------------------------
UGPA_SHIDS      ----------------------------------------------------------------------
UGPA_AGRT5      --NKILPYLLVAPQIILTVIFFFWPASQALYQSTM---REDAFGLSSN----FVGLANFSAVLS---DES
ARAP_BACHD      ----------------------------------------------------------------------
UGPA_RHIME      ----------------------------------------------------------------------
MALC_STRR6      ----------------------------------------------------------------------
MALC_STRPN      ----------------------------------------------------------------------
UGPA_BRUSU      ----------------------------------------------------------------------
UGPA_BRUME      ----------------------------------------------------------------------
UGPA_BRUAB      ----------------------------------------------------------------------
UGPA_BRUA2      ----------------------------------------------------------------------
MALG_VIBPA      ----------------------------------------------------------------------
MALF_PHOLL      ----------------------------------------------------------------------
MALG_SHIFL      ----------------------------------------------------------------------
MALG_SALTY      ----------------------------------------------------------------------
MALG_SALTI      ----------------------------------------------------------------------
MALG_ECOLI      ----------------------------------------------------------------------
MALG_ECOL6      ----------------------------------------------------------------------
MALG_ECO57      ----------------------------------------------------------------------
MALF_YERPE      ----------------------------------------------------------------------
MDXF_BACSU      ----------------------------------------------------------------------
MALG_YERPE      ----------------------------------------------------------------------
AGLG_RHIME      ----------------------------------------------------------------------
MALG_ENTAE      ----------------------------------------------------------------------
MALG_PHOLL      ----------------------------------------------------------------------
YOR2_CALSR      ----------------------------------------------------------------------
MALG_VIBVY      ----------------------------------------------------------------------
MALG_VIBVU      ----------------------------------------------------------------------
MALG_VIBCH      ----------------------------------------------------------------------
YJ16_PYRHO      ----------------------------------------------------------------------
ARAQ_BACHD      ----------------------------------------------------------------------
MSMG_STRMU      ----------------------------------------------------------------------
MALF_VIBVY      ----------------------------------------------------------------------
MALF_VIBVU      ----------------------------------------------------------------------
LPLB_BACSU      ----------------------------------------------------------------------
YTEP_BACSU      ----------------------------------------------------------------------
Y1216_PYRHO     ----------------------------------------------------------------------
NOCM_AGRT5      ----------------------------------------------------------------------
POTC_HAEIN      ----------------------------------------------------------------------
YESQ_BACSU      ----------------------------------------------------------------------
ARAQ_BACSU      ----------------------------------------------------------------------
PHNU_SALTI      ----------------------------------------------------------------------
NIFC_CLOPA      ----------------------------------------------------------------------
HISM_SALTY      ----------------------------------------------------------------------
HISM_SALTI      ----------------------------------------------------------------------
UGPE_SALTY      ----------------------------------------------------------------------
UGPE_SALTI      ----------------------------------------------------------------------
UGPE_SALPA      ----------------------------------------------------------------------
UGPE_SALCH      ----------------------------------------------------------------------
PHNU_SALPA      ----------------------------------------------------------------------
HISM_SHIFL      ----------------------------------------------------------------------
HISM_ECOLI      ----------------------------------------------------------------------
HISM_ECOL6      ----------------------------------------------------------------------
HISM_ECO57      ----------------------------------------------------------------------
LACG_RHIRD      ----------------------------------------------------------------------
UGPE_SHIFL      ----------------------------------------------------------------------
UGPE_SHIF8      ----------------------------------------------------------------------
UGPE_SHIDS      ----------------------------------------------------------------------
UGPE_ECOUT      ----------------------------------------------------------------------
UGPE_ECOLI      ----------------------------------------------------------------------
UGPE_ECOL6      ----------------------------------------------------------------------
UGPE_ECOL5      ----------------------------------------------------------------------
UGPE_ECOK1      ----------------------------------------------------------------------
UGPE_ECO57      ----------------------------------------------------------------------
PHNU_SALTY      ----------------------------------------------------------------------
PHNU_SALCH      ----------------------------------------------------------------------
MALF_VIBCH      ----------------------------------------------------------------------
POTC_SHIFL      ----------------------------------------------------------------------
POTC_ECOLI      ----------------------------------------------------------------------
POTC_ECOL6      ----------------------------------------------------------------------
POTC_ECO57      ----------------------------------------------------------------------
MDXG_BACSU      ----------------------------------------------------------------------
MODB_ECOLI      ----------------------------------------------------------------------
MODB_ECO57      ----------------------------------------------------------------------
CYST_PROWI      ----------------------------------------------------------------------
CYST_CHLVU      ----------------------------------------------------------------------
YESP_BACSU      -KDNLAGYAFISPFIIGFLCFTVIPMGASLFLSFTSYDLFTAP--------KWIGLDNFKEMFTG--DEK
UGPA_YERPS      -----LPYLLVLPQLAITAIFFLWPAGEALWYSVQT--LDP---FGLSSE--FVGLSNFIQLFQ---DEY
UGPA_YERPN      -----LPYLLVLPQLAITAIFFLWPAGEALWYSVQT--LDP---FGLSSE--FVGLSNFIQLFQ---DEY
UGPA_YERPE      -----LPYLLVLPQLAITAIFFLWPAGEALWYSVQT--LDP---FGLSSE--FVGLSNFIQLFQ---DEY
UGPA_YERPA      -----LPYLLVLPQLAITAIFFLWPAGEALWYSVQT--LDP---FGLSSE--FVGLSNFIQLFQ---DEY
UGPA_YERE8      -----LPYLLVLPQLAITAVFFLWPAGEALWYSV-----QMLDPFGLSSE--FVGLSNFIALFH---DEY
UGPA_ERWCT      -RSSWLPYVLVLPQLLITVIFFIWPAGQALWYSVQN--LDP---FGLSSE--FVGMENFRQLFN---NPY
UGPA_SALTY      -RSRWLPYLLVAPQLVITVIFFIWPAGEALWYSLQS--VDPFGFSS-----QFVGLENFVALFH---DSY
UGPA_SALTI      -RSRWLPYLLVAPQLVITVIFFIWPAGEALWYSLQS--VDPFGFSS-----QFVGLENFVALFH---DSY
UGPA_SALPA      -RSRWLPYLLVAPQLVITVIFFIWPAGEALWYSLQS--VDPFGFSS-----QFVGLENFVALFH---DSY
UGPA_SALCH      -RSRWLPYLLVAPQLVITVIFFIWPAGEALWYSLQS--VDPFGFSS-----QFVGLENFVALFH---DSY
UGPA_ECO57      -RSRWLPYLLVAPQLIITVIFFIWPAGEALWYSLQS--VDPFGFSS-----RFVGLDNFVALFH---DSY
Y4OQ_RHISN      --------------LLVLGVLVYSF-----YYSLTGWS-----LVVPGSDQDFIGLLNYTDVLRSS---E
UGPA_AGRT5      ----------------------------------------------------------------------
UGPA_RHIME      --NKILPYLLVAPQIVLTIVFFFWPASQALYQSVIR--EDPFGLKS-----GFVGFANFSAVLS---EAN
UGPA_BRUSU      --NKILPYFLLAPQIVLTVVFFFWPASQAIYQSFM---REDAFGL----KSTFVELANFTAVLS---DPN
UGPA_BRUME      --NKILPYFLLAPQIVLTVVFFFWPASQAIYQSFMM--REDAFGL----KSTFVELANFTAVLS---DPN
UGPA_BRUAB      --NKILPYFLLAPQIVLTVVFFFWPASQAIYQSFM---REDAFGL----KSTFVELANFTAVLS---DPN
UGPA_BRUA2      --NKILPYFLLAPQIVLTVVFFFWPASQAIYQSFM---REDAFGL----KSTFVELANFTAVLS---DPN


                         .         .         *         .         .         .         .:140
query           FRQSVVNLIFFTLFFMXXXXXXXXXXXXXVDKAPRGEGFFRTVFLFPMALSFVVTGTIWRWLLQPQGGVN
Y1215_PYRHO     ----------------------------------------------------------------------
AMYD_THETU      ----------------------------------------------------------------------
Y1038_PYRHO     ----------------------------------------------------------------------
YOR1_CALSR      ----------------------------------------------------------------------
LACF_RHIRD      ----------------------------------------------------------------------
AGLF_RHIME      ----------------------------------------------------------------------
Y2990_BRUA2     ----------------------------------------------------------------------
Y2783_BRUAB     ----------------------------------------------------------------------
MSMF_STRMU      FMKAIGFTLVLTLXXXXXXXXXXXXXXRALNAKIKGKTFFRAWFFFPAVLSGLTVSLIFK----------
YESP_BACSU      ----------------------------------------------------------------------
Y3749_BRUSU     -----------------------------------GRSVARVIIMLPWAVSLTMTAIVWRWALNGESGLN
UGPA_YERPS      ----------------------------------------------------------------------
UGPA_YERPN      ----------------------------------------------------------------------
UGPA_YERPE      ----------------------------------------------------------------------
UGPA_YERPA      ----------------------------------------------------------------------
YCJO_SHIFL      ----------------------------------------------------------------------
YCJO_ECOLI      ----------------------------------------------------------------------
UGPA_YERE8      ----------------------------------------------------------------------
UGPA_ERWCT      ----------------------------------------------------------------------
YURN_BACSU      FYQALTNNVLYAVISIVCQVFGGLILAAVLDKLVRKSPFFRTVFFLPVVISMTVIALLFDFIYNPETGLN
UGPA_SHIFL      ----------------------------------------------------------------------
UGPA_SHIF8      ----------------------------------------------------------------------
UGPA_SALTY      ----------------------------------------------------------------------
UGPA_SALTI      ----------------------------------------------------------------------
UGPA_SALPA      ----------------------------------------------------------------------
UGPA_SALCH      ----------------------------------------------------------------------
UGPA_ECOUT      ----------------------------------------------------------------------
UGPA_ECOLI      ----------------------------------------------------------------------
UGPA_ECOL6      ----------------------------------------------------------------------
UGPA_ECOL5      ----------------------------------------------------------------------
UGPA_ECOK1      ----------------------------------------------------------------------
UGPA_ECO57      ----------------------------------------------------------------------
Y4OQ_RHISN      ----------------------------------------------------------------------
ARAP_BACSU      ----------------------------------------------------------------------
UGPA_SHIDS      ----------------------------------------------------------------------
UGPA_AGRT5      YLNSLKVTVIFSVLTALVSMGLALLLATAADRVVRGKGFYRTMMIMPYAVAPAVAGMLWLFMFNPAMG--
ARAP_BACHD      ----------------------------------------------------------------------
UGPA_RHIME      ----------------------------------------------------------------------
MALC_STRR6      ----------------------------------------------------------------------
MALC_STRPN      ----------------------------------------------------------------------
UGPA_BRUSU      ----------------------------------------------------------------------
UGPA_BRUME      ----------------------------------------------------------------------
UGPA_BRUAB      ----------------------------------------------------------------------
UGPA_BRUA2      ----------------------------------------------------------------------
MALG_VIBPA      ----------------------------------------------------------------------
MALF_PHOLL      ----------------------------------------------------------------------
MALG_SHIFL      ----------------------------------------------------------------------
MALG_SALTY      ----------------------------------------------------------------------
MALG_SALTI      ----------------------------------------------------------------------
MALG_ECOLI      ----------------------------------------------------------------------
MALG_ECOL6      ----------------------------------------------------------------------
MALG_ECO57      ----------------------------------------------------------------------
MALF_YERPE      ----------------------------------------------------------------------
MDXF_BACSU      ----------------------------------------------------------------------
MALG_YERPE      ----------------------------------------------------------------------
AGLG_RHIME      ----------------------------------------------------------------------
MALG_ENTAE      ----------------------------------------------------------------------
MALG_PHOLL      ----------------------------------------------------------------------
YOR2_CALSR      ----------------------------------------------------------------------
MALG_VIBVY      ----------------------------------------------------------------------
MALG_VIBVU      ----------------------------------------------------------------------
MALG_VIBCH      ----------------------------------------------------------------------
YJ16_PYRHO      ----------------------------------------------------------------------
ARAQ_BACHD      ----------------------------------------------------------------------
MSMG_STRMU      ----------------------------------------------------------------------
MALF_VIBVY      ----------------------------------------------------------------------
MALF_VIBVU      ----------------------------------------------------------------------
LPLB_BACSU      ----------------------------------------------------------------------
YTEP_BACSU      ----------------------------------------------------------------------
Y1216_PYRHO     ----------------------------------------------------------------------
NOCM_AGRT5      ----------------------------------------------------------------------
POTC_HAEIN      ----------------------------------------------------------------------
YESQ_BACSU      ----------------------------------------------------------------------
ARAQ_BACSU      ----------------------------------------------------------------------
PHNU_SALTI      ----------------------------------------------------------------------
NIFC_CLOPA      ----------------------------------------------------------------------
HISM_SALTY      ----------------------------------------------------------------------
HISM_SALTI      ----------------------------------------------------------------------
UGPE_SALTY      ----------------------------------------------------------------------
UGPE_SALTI      ----------------------------------------------------------------------
UGPE_SALPA      ----------------------------------------------------------------------
UGPE_SALCH      ----------------------------------------------------------------------
PHNU_SALPA      ----------------------------------------------------------------------
HISM_SHIFL      ----------------------------------------------------------------------
HISM_ECOLI      ----------------------------------------------------------------------
HISM_ECOL6      ----------------------------------------------------------------------
HISM_ECO57      ----------------------------------------------------------------------
LACG_RHIRD      ----------------------------------------------------------------------
UGPE_SHIFL      ----------------------------------------------------------------------
UGPE_SHIF8      ----------------------------------------------------------------------
UGPE_SHIDS      ----------------------------------------------------------------------
UGPE_ECOUT      ----------------------------------------------------------------------
UGPE_ECOLI      ----------------------------------------------------------------------
UGPE_ECOL6      ----------------------------------------------------------------------
UGPE_ECOL5      ----------------------------------------------------------------------
UGPE_ECOK1      ----------------------------------------------------------------------
UGPE_ECO57      ----------------------------------------------------------------------
PHNU_SALTY      ----------------------------------------------------------------------
PHNU_SALCH      ----------------------------------------------------------------------
MALF_VIBCH      ----------------------------------------------------------------------
POTC_SHIFL      ----------------------------------------------------------------------
POTC_ECOLI      ----------------------------------------------------------------------
POTC_ECOL6      ----------------------------------------------------------------------
POTC_ECO57      ----------------------------------------------------------------------
MDXG_BACSU      ----------------------------------------------------------------------
MODB_ECOLI      ----------------------------------------------------------------------
MODB_ECO57      ----------------------------------------------------------------------
CYST_PROWI      ----------------------------------------------------------------------
CYST_CHLVU      ----------------------------------------------------------------------
YESP_BACSU      YWQSLKVTFTYVLAGVPLRLGFALFIAVILNNAAKGTAIYRTLFYLPSIIGSVAVAIMWRNIFGNDGVIN
UGPA_YERPS      YLASFYTTLIFSALVAGIGLNVSLFLAAMVDYVLRGSRLYQTLLILPYXXXXXXXXXLWIFLFDPGLGL-
UGPA_YERPN      YLASFYTTLIFSALVAGIGLIVSLFLAAMVNYVLRGSRLYQTLLILPYXXXXXXXXXLWIFLFDPGLGL-
UGPA_YERPE      YLASFYTTLIFSALVAGIGLIVSLFLAAMVNYVLRGSRLYQTLLILPYXXXXXXXXXLWIFLFDPGLGL-
UGPA_YERPA      YLASFYTTLIFSALVAGIGLIVSLFLAAMVNYVLRGSRLYQTLLILPYXXXXXXXXXLWIFLFDPGLGL-
UGPA_YERE8      YLASFYTTLIFSSLVAGIGLVVSLFLAAMVDYVLRGSRIYQTLMILPYXXXXXXXXXLWIFLFNPGLGL-
UGPA_ERWCT      YLDSFYTTLIFSFLVAGFGMLISLFLAALVDYVIRASRLYQTLIILPYXXXXXXXXXLWMFLFNP--GLG
UGPA_SALTY      YLDAFWTTIKFSALVTFSGLLVSLFFAALVDYVVRGSRFYQTLMXXXXXXXXXXXXXXWIFLFNPGRGL-
UGPA_SALTI      YLDAFWTTIKFSALVTFSGLLVSLFFAALVDYVVRGSRFYQTLMXXXXXXXXXXXXXXWIFLFNPGRGL-
UGPA_SALPA      YLDAFWTTIKFSALVTFSGLLVSLFFAALVDYVVRGSRFYQTLMXXXXXXXXXXXXXXWIFLFNPGRGL-
UGPA_SALCH      YLDAFWTTIKFSALVTFSGLLVSLFFAALVDYVVRGSRFYQTLMXXXXXXXXXXXXXXWIFLFNPGRGL-
UGPA_ECO57      YIDSFWTTIKFSTFVTVSGLLVSLFFAALVEYIVRGSRFYQTLMXXXXXXXXXXXXXXWIFLFNPGRGL-
Y4OQ_RHISN      FWAAIRVTLIYAVVAVSLECALGILFAVLLNLEFFGRGLFRSLMLIPMVITPAVVGIFWKLLYEQDSGVN
UGPA_AGRT5      ----------------------------------------------------------------------
UGPA_RHIME      YLNSLKVTVIFSXXXXXXXXXXXXXXXXXXDRVVRGKTFYRTLLIWPYAVAPAVAGMLWLFMFNPAMG--
UGPA_BRUSU      YLHSVQVTVVFNXXXXXXXXXXXXXXXXXXDRVIRGQTFYRTLLIWPYAVAPAVAGMLWLFMFNPAMG--
UGPA_BRUME      YLHSVQVTVVFNXXXXXXXXXXXXXXXXXXDRVIRGQTFYRTLLIWPYAVAPAVAGMLWLFMFNPAMG--
UGPA_BRUAB      YLHSVQVTVVFNXXXXXXXXXXXXXXXXXXDRVIRGQTFYRTLLIWPYAVAPAVAGMLWLFIFNPAMG--
UGPA_BRUA2      YLHSVQVTVVFNXXXXXXXXXXXXXXXXXXDRVIRGQTFYRTLLIWPYAVAPAVAGMLWLFIFNPAMG--


                         +         .         .         .         .         *         .:210
query           VLPTLFGLPPLSFPWLATREQVLVFDWNRLPFxxxxxxxxxxxxxxxxxxxxGERRRALWGLASAGVLLL
Y1215_PYRHO     ----------------------------------------------------------------------
AMYD_THETU      ----------------------------------------------------------------------
Y1038_PYRHO     ----------------------------------------------------------------------
YOR1_CALSR      ----------------------------------------------------------------------
LACF_RHIRD      ----------------------------------------------------------------------
AGLF_RHIME      ----------------------------------------------------------------------
Y2990_BRUA2     ----------------------------------------------------------------------
Y2783_BRUAB     ----------------------------------------------------------------------
MSMF_STRMU      ----------------------------------------------------------------------
YESP_BACSU      -----------------------------------------------------------------GVINA
Y3749_BRUSU     SALHGLGLIDTNIQWLAS----------------------------------------------------
UGPA_YERPS      ---------------------------------------------------------------------L
UGPA_YERPN      ---------------------------------------------------------------------L
UGPA_YERPE      ---------------------------------------------------------------------L
UGPA_YERPA      ---------------------------------------------------------------------L
YCJO_SHIFL      ---------------------------------------------------------------SISLVFA
YCJO_ECOLI      ---------------------------------------------------------------SISLVFA
UGPA_YERE8      ---------------------------------------------------------------------L
UGPA_ERWCT      ---------------------------------------------------------------------L
YURN_BACSU      QLLQAIGLDQLTRAWL------------------------------------------------------
UGPA_SHIFL      ----------------------------------------------------------------------
UGPA_SHIF8      ----------------------------------------------------------------------
UGPA_SALTY      ----------------------------------------------------------------------
UGPA_SALTI      ----------------------------------------------------------------------
UGPA_SALPA      ----------------------------------------------------------------------
UGPA_SALCH      ----------------------------------------------------------------------
UGPA_ECOUT      ----------------------------------------------------------------------
UGPA_ECOLI      ----------------------------------------------------------------------
UGPA_ECOL6      ----------------------------------------------------------------------
UGPA_ECOL5      ----------------------------------------------------------------------
UGPA_ECOK1      ----------------------------------------------------------------------
UGPA_ECO57      ----------------------------------------------------------------------
Y4OQ_RHISN      ----------------------------------------------------------------------
ARAP_BACSU      ----------------------------------------------------------------------
UGPA_SHIDS      ----------------------------------------------------------------------
UGPA_AGRT5      ----------------------------------------------------------------------
ARAP_BACHD      ----------------------------------------------------------------------
UGPA_RHIME      -----------------------------------------------------------YAVAPAVAGML
MALC_STRR6      ----------------------------------------------------------------------
MALC_STRPN      ----------------------------------------------------------------------
UGPA_BRUSU      -----------------------------------------------------------YAVAPAVAGML
UGPA_BRUME      -----------------------------------------------------------YAVAPAVAGML
UGPA_BRUAB      -----------------------------------------------------------YAVAPAVAGML
UGPA_BRUA2      -----------------------------------------------------------YAVAPAVAGML
MALG_VIBPA      ----------------------------------------------------------------------
MALF_PHOLL      ----------------------------------------------------------------------
MALG_SHIFL      ----------------------------------------------------------------------
MALG_SALTY      ----------------------------------------------------------------------
MALG_SALTI      ----------------------------------------------------------------------
MALG_ECOLI      ----------------------------------------------------------------------
MALG_ECOL6      ----------------------------------------------------------------------
MALG_ECO57      ----------------------------------------------------------------------
MALF_YERPE      ----------------------------------------------------------------------
MDXF_BACSU      ----------------------------------------------------------------------
MALG_YERPE      ----------------------------------------------------------------------
AGLG_RHIME      ----------------------------------------------------------------------
MALG_ENTAE      ----------------------------------------------------------------------
MALG_PHOLL      ----------------------------------------------------------------------
YOR2_CALSR      ----------------------------------------------------------------------
MALG_VIBVY      ----------------------------------------------------------------------
MALG_VIBVU      ----------------------------------------------------------------------
MALG_VIBCH      ----------------------------------------------------------------------
YJ16_PYRHO      ----------------------------------------------------------------------
ARAQ_BACHD      ----------------------------------------------------------------------
MSMG_STRMU      ----------------------------------------------------------------------
MALF_VIBVY      ----------------------------------------------------------------------
MALF_VIBVU      ----------------------------------------------------------------------
LPLB_BACSU      ----------------------------------------------------------------------
YTEP_BACSU      ----------------------------------------------------------------------
Y1216_PYRHO     ----------------------------------------------------GRVSRQLLALISFGIFLP
NOCM_AGRT5      ----------------------------------------------------------------------
POTC_HAEIN      ----------------------------------------------------------------------
YESQ_BACSU      ----------------------------------------------------------------------
ARAQ_BACSU      ----------------------------------------------------------------------
PHNU_SALTI      ------------------------------------------------------------GLLNGALMSL
NIFC_CLOPA      --------------------------------------------------------------AVAGIALL
HISM_SALTY      ----------------------------------------------------------------------
HISM_SALTI      ----------------------------------------------------------------------
UGPE_SALTY      ----------------------------------------------------------------------
UGPE_SALTI      ----------------------------------------------------------------------
UGPE_SALPA      ----------------------------------------------------------------------
UGPE_SALCH      ----------------------------------------------------------------------
PHNU_SALPA      ------------------------------------------------------------GLLNGALMSL
HISM_SHIFL      ----------------------------------------------------------------------
HISM_ECOLI      ----------------------------------------------------------------------
HISM_ECOL6      ----------------------------------------------------------------------
HISM_ECO57      ----------------------------------------------------------------------
LACG_RHIRD      ----------------------------------------------------------------------
UGPE_SHIFL      ----------------------------------------------------------------------
UGPE_SHIF8      ----------------------------------------------------------------------
UGPE_SHIDS      ----------------------------------------------------------------------
UGPE_ECOUT      ----------------------------------------------------------------------
UGPE_ECOLI      ----------------------------------------------------------------------
UGPE_ECOL6      ----------------------------------------------------------------------
UGPE_ECOL5      ----------------------------------------------------------------------
UGPE_ECOK1      ----------------------------------------------------------------------
UGPE_ECO57      ----------------------------------------------------------------------
PHNU_SALTY      ----------------------------------------------------------------------
PHNU_SALCH      ----------------------------------------------------------------------
MALF_VIBCH      ----------------------------------------------------------------------
POTC_SHIFL      ----------------------------------------------------------------------
POTC_ECOLI      ----------------------------------------------------------------------
POTC_ECOL6      ----------------------------------------------------------------------
POTC_ECO57      ----------------------------------------------------------------------
MDXG_BACSU      ----------------------------------------------------------------------
MODB_ECOLI      ----------------------------------------------------------------------
MODB_ECO57      ----------------------------------------------------------------------
CYST_PROWI      ----------------------------------------------------------------------
CYST_CHLVU      ----------------------------------------------------------------------
YESP_BACSU      ALLFFVGI--------------------------------------------------------------
UGPA_YERPS      ---ITHALAKLGYSW-------------------------------------------------------
UGPA_YERPN      ---ITHALAKLGYSW-------------------------------------------------------
UGPA_YERPE      ---ITHALAKLGYSW-------------------------------------------------------
UGPA_YERPA      ---ITHALAKLGYSW-------------------------------------------------------
UGPA_YERE8      ----------------------------------------------------------------------
UGPA_ERWCT      LITHFLGL--LGYTW-------------------------------------------------------
UGPA_SALTY      ----------------------------------------------------------------------
UGPA_SALTI      ----------------------------------------------------------------------
UGPA_SALPA      ----------------------------------------------------------------------
UGPA_SALCH      ----------------------------------------------------------------------
UGPA_ECO57      ----------------------------------------------------------------------
Y4OQ_RHISN      YLLGTLGFEPV--PWLALASVIIVDVWQSTPF--------------------------------------
UGPA_AGRT5      -----------------------------------------------------------YAVAPAVAGML
UGPA_RHIME      ----------------------------------------------------------------------
UGPA_BRUSU      ----------------------------------------------------------------------
UGPA_BRUME      ----------------------------------------------------------------------
UGPA_BRUAB      ----------------------------------------------------------------------
UGPA_BRUA2      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           WAFAFGQGLRLLPYPEVHGFSLALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFR
Y1215_PYRHO     ---------------------IAMYCIIIALIWQFSGYTMIIYLAGIRSIPIEQYEGALIDGASTWQLYR
AMYD_THETU      -------------------------GLVIVTSWQMIGYVMVIYIAYIESIPTDLIEASKIDGANSWQQFR
Y1038_PYRHO     ----------------------ALFSVILGSIWIWTGFSMLMYSAGLASIPKDYYEAALIDGANKFQIFR
YOR1_CALSR      --------------------NVAFYSVVAVICWQYIPFYMIFFIAALSNIPQELYEAAKIDGATQGQYFW
LACF_RHIRD      ----------------------AKVLIIIAITWRWTGYNMIFYLAALQNIDRSIYEAAKIDGVPSWGRFA
AGLF_RHIME      --------------------------LMVILIWIQTGFAMVILSAALRGIPEETIEAAVIDGANGWQIFF
Y2990_BRUA2     ---------------------------ILVGILVTVPFTTTIFLGGLSSIPDDLYEASSLEGASLWQQFR
Y2783_BRUAB     ---------------------------ILVGILVTVPFTTTIFLGGLSSIPDDLYEASSLEGASLWQQFR
MSMF_STRMU      ----------------------AVIASIFVLLWQGVAMPIILFLSGLQSIPSEIVEAAAIDGADSKQTFW
YESP_BACSU      LLFFVGIDQKILWYQNP---TSALWTLILLSVWQF-GSSMLIFLAGLKNIPSSYLEAASVDGANRVQRFF
Y3749_BRUSU     ---------------------------ILVGILVTVPFTTTIFLGGLSSIPDDLYEASSLEGASLWQQFR
UGPA_YERPS      WIFLFDPGLGLITHALAKGYSWAMFLVVLASVWKQISYNFLFFLAALQSIPKSLVEAAAIDGAGPVRRFF
UGPA_YERPN      WIFLFDPGLGLITHALAKGYSWAMFLVVLASVWKQISYNFLFFLAALQSIPKSLVEAAAIDGAGPVRRFF
UGPA_YERPE      WIFLFDPGLGLITHALAKGYSWAMFLVVLASVWKQISYNFLFFLAALQSIPKSLVEAAAIDGAGPVRRFF
UGPA_YERPA      WIFLFDPGLGLITHALAKGYSWAMFLVVLASVWKQISYNFLFFLAALQSIPKSLVEAAAIDGAGPVRRFF
YCJO_SHIFL      WKYMFNNGYGIVNYLGVDLLHLSFVLVVLFAIWRYFPYAFISFLAILQTIDKSLYEAAEMDGANAWQRFR
YCJO_ECOLI      WKYMFNNGYGIVNYLGVDLLHLSFVLVVLFAIWRYFPYAFISFLAILQTIDKSLYEAAEMDGANAWQRFR
UGPA_YERE8      WIFLFNPGLGLITHNHAQNSGQAMFLVVLASVWKQISYNFLFFLAALQSIPRSLVEAAAIDGAGPVRRFF
UGPA_ERWCT      WMFLFNPGLGLITHNHAQDSGQAMFLVVLASVWKQISYNFLFFLAALQSIPRSLVEAGAIDGAGPVRRFF
YURN_BACSU      --------------------STAMLSVIFVSQWQSVGYIAMLYIVSIQKIPDELYEAARLDGAGKIQQFF
UGPA_SHIFL      WIFLFNPGRGLITHNHAQNSGQAMFLVVFASVWKQISYNFLFFYAALQSIPRSLIEAAAIDGAGPIRRFF
UGPA_SHIF8      WIFLFNPGRGLITHNHAQNSGQAMFLVVFASVWKQISYNFLFFYAALQSIPRSLIEAAAIDGAGPIRRFF
UGPA_SALTY      WIFLFNPGRGLITHNHAQNSGQAMFLVVFASVWKQISYNFLFFFAALQSIPRSLVEAAAIDGAGPIRRFF
UGPA_SALTI      WIFLFNPGRGLITHNHAQNSGQAMFLVVFASVWKQISYNFLFFFAALQSIPRSLVEAAAIDGAGPIRRFF
UGPA_SALPA      WIFLFNPGRGLITHNHAQNSGQAMFLVVFASVWKQISYNFLFFFAALQSIPRSLVEAAAIDGAGPIRRFF
UGPA_SALCH      WIFLFNPGRGLITHNHAQNSGQAMFLVVFASVWKQISYNFLFFFAALQSIPRSLVEAAAIDGAGPIRRFF
UGPA_ECOUT      WIFLFNPGRGLITHNHAQNSGQAMFLVVFASVWKQISYNFLFFYAALQSIPRSLIEAAAIDGAGPIRRFF
UGPA_ECOLI      WIFLFNPGRGLITHNHAQNSGQAMFLVVFASVWKQISYNFLFFYAALQSIPRSLIEAAAIDGAGPIRRFF
UGPA_ECOL6      WIFLFNPGRGLITHNHAQNSGQAMFLVVFASVWKQISYNFLFFYAALQSIPRSLIEAAAIDGAGPIRRFF
UGPA_ECOL5      WIFLFNPGRGLITHNHAQNSGQAMFLVVFASVWKQISYNFLFFYAALQSIPRSLIEAAAIDGAGPIRRFF
UGPA_ECOK1      WIFLFNPGRGLITHNHAQNSGQAMFLVVFASVWKQISYNFLFFYAALQSIPRSLIEAAAIDGAGPIRRFF
UGPA_ECO57      WIFLFNPGRGLITHNHAQNSGQAMFLVVFASVWKQISYNFLFFYAALQSIPRSLIEAAAIDGAGPIRRFF
Y4OQ_RHISN      --------------------TVALASVIIVDVWQSTPFFTLIILAGLQSLDRDTVSAAQADGANALQVFR
ARAP_BACSU      --------------------------MVLLASWRWMGINILYFLAGLQNVPKELYEAADIDGANTMKKFL
UGPA_SHIDS      WIFLFNPGRGLITHNHAQNSGQAMFLVVFASVWKQISYNFLFFYAALQSIPRSLIEAAAIDGVGPIRRFF
UGPA_AGRT5      ----------------------------------------------------------------------
ARAP_BACHD      --------------------------MVVLASWRWMGINILYFLAALQNVPKELYEAADIDGANVVQKFF
UGPA_RHIME      WLFMFNPAMGTFAYPLLNG-NHAMILIVVAAAWKQISYNFLFFVAGLQAIPKSLIEAAAIDGARGTRRFW
MALC_STRR6      ------------------------IALIMMQGWLGFPYIYVLTLGILQSIPNDLYEAAYIDGANAWQKFR
MALC_STRPN      ------------------------IALIMMQGWLGFPYIYVLTLGILQSIPNDLYEAAYIDGANAWQKFR
UGPA_BRUSU      WLFMFNPAMGTFAYPLLDG-NQAMGLVVVAAAWKQISYNFLFFVAGLQAIPKSLIEXXXXXXXXXXXXFW
UGPA_BRUME      WLFMFNPAMGTFAYPLLDG-NQAMGLVVVAAAWKQISYNFLFFVAGLQAIPKSLIEXXXXXXXXXXXXFW
UGPA_BRUAB      WLFIFNPAMGTFAYPLLDG-NQAMGLVVVAAAWKQISYNFLFFVAGLQAIPKSLIEXXXXXXXXXXXXFW
UGPA_BRUA2      WLFIFNPAMGTFAYPLLDG-NQAMGLVVVAAAWKQISYNFLFFVAGLQAIPKSLIEXXXXXXXXXXXXFW
MALG_VIBPA      -----GQYIPFLGLNTHGGLIFAYLGGIALHVWTIKGY--------FESIDSSLEEAAALDGATPWQAFR
MALF_PHOLL      --------------------TMARTMLIVVNAWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFF
MALG_SHIFL      ------------------GVIFAYLGGIALHVWTIKGY--------FETIDSSLEEAAALDGATPWQAFR
MALG_SALTY      ------------------GVIFAYLGGIALHVWTIKGY--------FETIDSSLEEAAALDGATPWQAFR
MALG_SALTI      ------------------GVIFAYLGGIALHVWTIKGY--------FETIDSSLEEAAALDGATPWQAFR
MALG_ECOLI      ------------------GVIFAYLGGIALHVWTIKGY--------FETIDSSLEEAAALDGATPWQAFR
MALG_ECOL6      ------------------GVIFAYLGGIALHVWTIKGY--------FETIDSSLEEAAALDGATPWQAFR
MALG_ECO57      ------------------GVIFAYLGGIALHVWTIKGY--------FETIDSSLEEAAALDGATPWQAFR
MALF_YERPE      --------------------------ILIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFF
MDXF_BACSU      --------------------------LIMIQTWLGFPYIYVMVTGVLQAIPGELYEAAKIDGATFIQRFR
MALG_YERPE      ------------------GVIFAYMGGIALHVWTIKGY--------FETIDNSLEEAAALDGATPWQAFR
AGLG_RHIME      ------------------------------------GLPLAIYLLRMAGLPREIMESARVDGASDFDIFV
MALG_ENTAE      ------------------GVIFAYMGGIALHVWTIKGY--------FETIDGSLEEAAALDGATPWQAFR
MALG_PHOLL      ------------------GVIFAYLGGIALHVWTIKGY--------FETIDGSLEEAAALDGATPWQAFR
YOR2_CALSR      ----------------------ALIGPYVALSLPMSIFILTEFM---REIPLELEEAAKIDGCSMFRLYS
MALG_VIBVY      -----GQYIPFLGLNTHGGLIFSYLGGIALHVWTIKGY--------FETIDNSLEEAAALDGATPWQAFR
MALG_VIBVU      -----GQYIPFLGLNTHGGLIFSYLGGIALHVWTIKGY--------FETIDNSLEEAAALDGATPWQAFR
MALG_VIBCH      -----GQYIPFLGLNTHGGLIFSYLGGIALHVWTIKGY--------FETIDRSLEEAAALDGATPWQAFR
YJ16_PYRHO      -------------------------------------------------LPTDVEEAAKIDGATDFQIFY
ARAQ_BACHD      ------------------------------------------------GLPKELMDAARIDGCTEYGIFF
MSMG_STRMU      -------------------------GLIILYLTYAIPQTLFLYVGYIKSVPDSLDEAAEIDGADKLTTYR
MALF_VIBVY      --------------------------VLIVNTWLGFPYMMILCMGLLKAIPEDLYEASAIDGANFVQNFT
MALF_VIBVU      --------------------------VLIVNTWLGFPYMMILCMGLLKAIPEDLYEASAIDGANFVQNFT
LPLB_BACSU      --------------------------IVMQSIWKETGWGTILFLAALATVDQEQYEAAIMDGAGRFRRMW
YTEP_BACSU      ---------------------------ILQVIWREAGWSTIIYLAAITAVDPQLYEAAKMDGAGRLRQMW
Y1216_PYRHO     YQSI------LIPLVKIIS-SLGLYNRILGLILTHTAYTTLLFTNYYYEIPDELVEAAKIDGADPWKIYT
NOCM_AGRT5      ---------------------------ILALALNTAAYTSEIIRGGIQSVSLGQIEAARAVGMSTFLQFR
POTC_HAEIN      ----------------VVGISLGFWSLLLAHVTFCLPYVTVTIFSRLNGFDSRMLEAAKDLGASEVTILR
YESQ_BACSU      -----------------------------------------LMIQFIRTIPEELDEAARIDGCGRFACFW
ARAQ_BACSU      ------------------------------------------------GLPRDLLDSARMDGCTEFGIFF
PHNU_SALTI      FAFEL---------PPVD-FLYSMQGVILAEITVFTPLVMRPLMAALRQIDKSQLEAASILGAHPLRVIG
NIFC_CLOPA      --LAFGKNGVVGNFLSNHGINVIFTSVIIAQFFVSSALYVRVLRDSVKSVPIELFEVSYVLGAGKIETII
HISM_SALTY      -------------------FRSGLNCTVLALTLNTCAYTTEIFAGAIRSVPHGEIEAARAYGFSSFKMYR
HISM_SALTI      -------------------FRSGLNCTVLALTLNTCAYTTEIFAGAIRSVPHGEIEAARAYGFSSFKMYR
UGPE_SALTY      -------------------------------------------------LPDELVEAARIDGASPMRFFR
UGPE_SALTI      -------------------------------------------------LPDELVEAARIDGASPMRFFR
UGPE_SALPA      -------------------------------------------------LPDELVEAARIDGASPMRFFR
UGPE_SALCH      -------------------------------------------------LPDELVEAARIDGASPMRFFR
PHNU_SALPA      FAFEL---------PPVD-FLYSMQGVILAEITVFTPLVMRPLMAALRQIDKSQLEAASILGAHPLRVIG
HISM_SHIFL      -------------------FRSGLNCTVLALTLNTCAYTTEIFAGAIRSVPHGEIEAARAYGFSTFKMYR
HISM_ECOLI      -------------------FRSGLNCTVLALTLNTCAYTTEIFAGAIRSVPHGEIEAARAYGFSTFKMYR
HISM_ECOL6      -------------------FRSGLNCTVLALTLNTCAYTTEIFAGAIRSVPHGEIEAARAYGFSTFKMYR
HISM_ECO57      -------------------FRSGLNCTVLALTLNTCAYTTEIFAGAIRSVPHGEIEAARAYGFSTFKMYR
LACG_RHIRD      -----------------------------------SAFIIFYFRQASKAFPTELRDAAKVDGLKEWQIFF
UGPE_SHIFL      -------------------------------------------------LPDELVEAARIDGASPMRFFC
UGPE_SHIF8      -------------------------------------------------LPDELVEAARIDGASPMRFFC
UGPE_SHIDS      -------------------------------------------------LPDELVEAARIDGASPMRFFC
UGPE_ECOUT      -------------------------------------------------LPDELVEAARIDGASPMRFFC
UGPE_ECOLI      -------------------------------------------------LPDELVEAARIDGASPMRFFC
UGPE_ECOL6      -------------------------------------------------LPDELVEAARIDGASPMRFFC
UGPE_ECOL5      -------------------------------------------------LPDELVEAARIDGASPMRFFC
UGPE_ECOK1      -------------------------------------------------LPDELVEAARIDGASPMRFFC
UGPE_ECO57      -------------------------------------------------LPDELVEAARIDGASPMRFFC
PHNU_SALTY      -------------------FLYSMQGVILAEITVFTPLVMRPLMAALRQIDKSQLEAASILGAHPLRVIG
PHNU_SALCH      -------------------FLYSMQGVILAEITVFTPLVMRPLMAALRQIDKSQLEAASILGAHPLRVIG
MALF_VIBCH      ---------------------LAKTMVLIVNTWLGFPYMMIFCMGLLKAIPDDLYEASAIDGANFIHNFT
POTC_SHIFL      ------------------GIQLGFWSLLFSHITFCLPFVVVTVYSRLKGFDVRMLEAAKDLGASEFTILR
POTC_ECOLI      ------------------GIQLGFWSLLFSHITFCLPFVVVTVYSRLKGFDVRMLEAAKDLGASEFTILR
POTC_ECOL6      ------------------GIQLGFWSLLFSHITFCLPFVVVTVYSRLKGFDVRMLEAAKDLGASEFTILR
POTC_ECO57      ------------------GIQLGFWSLLFSHITFCLPFVVVTVYSRLKGFDVRMLEAAKDLGASEFTILR
MDXG_BACSU      -------------------------GGIPMNTWLMKGY--------FDTVPREIDEAARIDGAGHLRIFA
MODB_ECOLI      --------------------------VLAAAVMSFPLMVRAIRLA-LEGVDVKLEQAARTLGAGRW----
MODB_ECO57      --------------------------VLAAAVMSFPLMVRAIRLA-LEGVDVKLEQAARTLGAGRW----
CYST_PROWI      -------------------------GVLLAMIFVSFPFVIRSLQPVLQGLDHGLEEAAWCLGASSFQTFL
CYST_CHLVU      ------------------GFQIVFIGVLLAMIFVSFPFVIRTLQPVLQEMEKSLEEAAWSLGASSWETFR
YESP_BACSU      ----------------------------------------------------------------------
UGPA_YERPS      ----------------------------------------------------------------------
UGPA_YERPN      ----------------------------------------------------------------------
UGPA_YERPE      ----------------------------------------------------------------------
UGPA_YERPA      ----------------------------------------------------------------------
UGPA_YERE8      ----------------------------------------------------------------------
UGPA_ERWCT      ----------------------------------------------------------------------
UGPA_SALTY      ----------------------------------------------------------------------
UGPA_SALTI      ----------------------------------------------------------------------
UGPA_SALPA      ----------------------------------------------------------------------
UGPA_SALCH      ----------------------------------------------------------------------
UGPA_ECO57      ----------------------------------------------------------------------
Y4OQ_RHISN      ----------------------------------------------------------------------
UGPA_AGRT5      WLFMFNPAMGTLSYPLLDG-NQAMLLVVAAAAWKQISYNFLFFVAGLQAIPKSLLEAASIDGA-------
UGPA_RHIME      ----------------------------------------------------------------------
UGPA_BRUSU      ----------------------------------------------------------------------
UGPA_BRUME      ----------------------------------------------------------------------
UGPA_BRUAB      ----------------------------------------------------------------------
UGPA_BRUA2      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RVIFPMLAPITLSAMIVLGHIALKIFDLVFAMAGLDYAPTDVPAIYMYLLAFRGNQFAKXXXXXXXXXXX
Y1215_PYRHO     YIVIPQLTKPTLSAFVVLMVFSLKAFDFIWVLTGGPGTSTFILAIEMYKETFAKTNFAYGXXXXXXXXXX
AMYD_THETU      NVVFPLIAPFTVSLFITLSN-SFKLFDQNLSLAGAPGNTTQMITLNIYQTAFSAQEMA------------
Y1038_PYRHO     FVIWPLLRPITVVIVAMTLLWDLKIFDIVYVATG------------------------------------
YOR1_CALSR      RIELPLLTPSIKTACILSLIGSLKYFDLIYVMTGGPSNATELMATYMYKNAF------------------
LACF_RHIRD      FLTIPMLKPVILFTTITSTIGTLQLFDEVYNFTEGTGGPTLTLSLYIYNLTFR-----------------
AGLF_RHIME      KIMVPQIWGTIAVVWTTITILVLKVFDIVLAM--------------------------------------
Y2990_BRUA2     EITFPLLKPFVNIAIVLNTIYVFNSFPIIWVMTGRPANSTDILVTHLYKLAFRLGKFGE-----------
Y2783_BRUAB     EITFPLLKPFVNIAIVLNTIYVFNSFPIIWVMTGRPANSTDILVTHLYKLAFRLGKFGE-----------
MSMF_STRMU      SVELPYLLPSISMVFIMALKAGLTAFDQIFALGGGPNNSTTSLGLLVYNYAFKSNQY-------------
YESP_BACSU      KITLPILTPIIFFNLVMQTISAFMTFTPAYIISKGEGGPLDGTLLYLYLFQRAFNYF-------------
Y3749_BRUSU     EITFPLLKPFVNIAIVLNTIYVFNSFPIIWVMTGGPANSTDILVTHLYKLAFR-----------------
UGPA_YERPS      NLVLPLISPVSFFLLVVLVYAFFDTFPVIDAATGGGPVQATTTLIYIYREGFAG----------------
UGPA_YERPN      NLVLPLISPVSFFLLVVLVYAFFDTFPVIDAATGGGPVQATTTLIYIYREGFAG----------------
UGPA_YERPE      NLVLPLISPVSFFLLVVLVYAFFDTFPVIDAATGGGPVQATTTLIYIYREGFAG----------------
UGPA_YERPA      NLVLPLISPVSFFLLVVLVYAFFDTFPVIDAATGGGPVQATTTLIYIYREGFAG----------------
YCJO_SHIFL      IVTLPAIMPV-LATVVTLRTIWM---FYMFADVYLLTTKVDILGVYLYKTAFAFNDLGK-----------
YCJO_ECOLI      IVTLPAIMPV-LATVVTLRTIWM---FYMFADVYLLTTKVDILGVYLYKTAFAFNDLGK-----------
UGPA_YERE8      NLVLPLISPVSFFLLVVLVYAFFDTFPVIDAATG------------------------------------
UGPA_ERWCT      NLVLPMISPVSFFLLVV-----------------------------------------------------
YURN_BACSU      HITVPQTKEMSFVAVVMTLTGAFTVFNEPYILTGGGPGASEVLSTFLYKSAF------------------
UGPA_SHIFL      KIALPLIAPVSFFLLVV-----------------------------------------------------
UGPA_SHIF8      KIALPLIAPVSFFLLVV-----------------------------------------------------
UGPA_SALTY      RLSLPLIAPVSFFLLVV-----------------------------------------------------
UGPA_SALTI      RLSLPLIAPVSFFLLVV-----------------------------------------------------
UGPA_SALPA      RLSLPLIAPVSFFLLVV-----------------------------------------------------
UGPA_SALCH      RLSLPLIAPVSFFLLVV-----------------------------------------------------
UGPA_ECOUT      KIALPLIAPVSFFLLVV-----------------------------------------------------
UGPA_ECOLI      KIALPLIAPVSFFLLVV-----------------------------------------------------
UGPA_ECOL6      KIALPLIAPVSFFLLVV-----------------------------------------------------
UGPA_ECOL5      KIALPLIAPVSFFLLVV-----------------------------------------------------
UGPA_ECOK1      KIALPLIAPVSFFLLVV-----------------------------------------------------
UGPA_ECO57      KIALPLIAPVSFFLLVV-----------------------------------------------------
Y4OQ_RHISN      YLTLPHLVPYIMAAFRIIGVMA--DFDKIFLLTGGPGNVTTTLSVYAYNTGFK-----------------
ARAP_BACSU      HITLPFLKPVTVYVLTI-----------------------------------------------------
UGPA_SHIDS      KIALPLIAPVSFFLLVV-----------------------------------------------------
UGPA_AGRT5      ----------------------------------------------------------------------
ARAP_BACHD      YVTLPFLKPVTITTISVIGGFRMFEESFVFWEAG------------------------------------
UGPA_RHIME      TII-------------------------------------------------------------------
MALC_STRR6      NITFPMILAVAAPTLI------------------------------------------------------
MALC_STRPN      NITFPMILAVAAPTLI------------------------------------------------------
UGPA_BRUSU      TIVFPLLAPTSFFLLVVTVYAFFDTFGIIHAVTG------------------------------------
UGPA_BRUME      TIVFPLLAPTSFFLLVVTVYAFFDTFGIIHAVTG------------------------------------
UGPA_BRUAB      TIVFPLLAPTSFFLLVVTVYAFFDTFGIIHAVTG------------------------------------
UGPA_BRUA2      TIVFPLLAPTSFFLLVVTVYAFFDTFGIIHAVTG------------------------------------
MALG_VIBPA      LVLLPLSVPIILSFIMVIGEV-------------------------------------------------
MALF_PHOLL      KITFPLLIKPLTPLMIASFAFNFNNFVLILTLGGPDRIGTTTPASYTYRIAFDGS---------------
MALG_SHIFL      LVLLPLSVPI-LAVVFILSFIA------------------------------------------------
MALG_SALTY      LVLLPLSVPI-LAVVFILSFIA------------------------------------------------
MALG_SALTI      LVLLPLSVPI-LAVVFILSFIA------------------------------------------------
MALG_ECOLI      LVLLPLSVPI-LAVVFILSFIA------------------------------------------------
MALG_ECOL6      LVLLPLSVPI-LAVVFILSFIA------------------------------------------------
MALG_ECO57      LVLLPLSVPI-LAVVFILSFIA------------------------------------------------
MALF_YERPE      RITFPLLIKPLTPLMIASFAFNFNNFVLILTNGGPDMIGTSTPAGYTDLL--------------------
MDXF_BACSU      HITFPMILFATAPVMITQYTFNFNNFSIIY----------------------------------------
MALG_YERPE      LVLLPLSVPI-LAVVFILSFIA------------------------------------------------
AGLG_RHIME      KIILPLSFPALASFAI------------------------------------------------------
MALG_ENTAE      LVLVPLSVPI-LAVVFILSFIA------------------------------------------------
MALG_PHOLL      MVLLPLSVPI-LAVVFILSFIGV-----------------------------------------------
YOR2_CALSR      DILLPLSAPALITVGIYNGTYLWNEF--VFALV-LTSSPTDIPAIMAFL---------------------
MALG_VIBVY      LVLLPLSVPI-LAVVFILSFIGV-----------------------------------------------
MALG_VIBVU      LVLLPLSVPI-LAVVFILSFIGV-----------------------------------------------
MALG_VIBCH      LVLLPLSVPI-LAVVFILSFIGV-----------------------------------------------
YJ16_PYRHO      KIVLPMALPGLISASIL-----------------------------------------------------
ARAQ_BACHD      KIMLPLMGP-SLAAMAIL----------------------------------------------------
MSMG_STRMU      KIIFPMLKPMHATTLII-----------------------------------------------------
MALF_VIBVY      RVTLPMIKPLT---PLLIASFAFNFNNFVMIQLLTQGGPTDLLVSYTYRIAFEG----------------
MALF_VIBVU      RVTLPMIKPLT---PLLIASFAFNFNNFVMIQLLTQGGPTDLLVSYTYRIAFEG----------------
LPLB_BACSU      HITLPAIRSTIIVLLILIGSFLNLGFEQVYLMTSLNRSVADIFDTYVYMM--------------------
YTEP_BACSU      HITLPAIKSVIVVLLILIGDTLELGFEHVYLL--LNATNREVAEIYVYTAGLKQGQFS------------
Y1216_PYRHO     KVILPL----------------------------------------------------------------
NOCM_AGRT5      RIVFPIAIRQALPAMLIIKSTSLASTITIVEVTGLTYSPVEVGAIYLFI---------------------
POTC_HAEIN      KIILPLALPAVVSGWLL-----------------------------------------------------
YESQ_BACSU      RIILPLIAPALATSAI------------------------------------------------------
ARAQ_BACSU      RIMAPLMKP-AFGAMIIL----------------------------------------------------
PHNU_SALTI      QVIFPAALPALMAS--------------------------------------------------------
NIFC_CLOPA      KIMIPMLKKSIVSGLILAWIRSLGEFGATLMFAG------------------------------------
HISM_SALTY      CIILPSALRIALPA--------------------------------------------------------
HISM_SALTI      CIILPSALRIALPA--------------------------------------------------------
UGPE_SALTY      DIVLP-LSKTNLAALFVITFI-------------------------------------------------
UGPE_SALTI      DIVLP-LSKTNLAALFVITFI-------------------------------------------------
UGPE_SALPA      DIVLP-LSKTNLAALFVITFI-------------------------------------------------
UGPE_SALCH      DIVLP-LSKTNLAALFVITFI-------------------------------------------------
PHNU_SALPA      QVIFPAALPALMA---------------------------------------------------------
HISM_SHIFL      CIILPSALRIALPA--------------------------------------------------------
HISM_ECOLI      CIILPSALRIALPA--------------------------------------------------------
HISM_ECOL6      CIILPSALRIALPA--------------------------------------------------------
HISM_ECO57      CIILPSALRIALPA--------------------------------------------------------
LACG_RHIRD      YIYVPVMRSTYAAAFVIV----------------------------------------------------
UGPE_SHIFL      DIVFP-LSKTNLAALFVITFI-------------------------------------------------
UGPE_SHIF8      DIVFP-LSKTNLAALFVITFI-------------------------------------------------
UGPE_SHIDS      DIVFP-LSKTNLAALFVITFI-------------------------------------------------
UGPE_ECOUT      DIVFP-LSKTNLAALFVITFI-------------------------------------------------
UGPE_ECOLI      DIVFP-LSKTNLAALFVITFI-------------------------------------------------
UGPE_ECOL6      DIVFP-LSKTNLAALFVITFI-------------------------------------------------
UGPE_ECOL5      DIVFP-LSKTNLAALFVITFI-------------------------------------------------
UGPE_ECOK1      DIVFP-LSKTNLAALFVITFI-------------------------------------------------
UGPE_ECO57      DIVFP-LSKTNLAALFVITFI-------------------------------------------------
PHNU_SALTY      QVIFPAALPALMA---------------------------------------------------------
PHNU_SALCH      QVIFPAALPALMA---------------------------------------------------------
MALF_VIBCH      KITLPMIKPLT---PLLIASFAFNFNNFVMIQLLTQGGPTDLLVSYTYRIAFEG----------------
POTC_SHIFL      KIILPLAMPAVAAGWVL-----------------------------------------------------
POTC_ECOLI      KIILPLAMPAVAAGWVL-----------------------------------------------------
POTC_ECOL6      KIILPLAMPAVAAGWVL-----------------------------------------------------
POTC_ECO57      KIILPLAMPAVAAGWVL-----------------------------------------------------
MDXG_BACSU      SIVLPLVKPM------------------------------------------------------------
MODB_ECOLI      RVFFTITLPLTLPGIIV-----------------------------------------------------
MODB_ECO57      RVFFTITLPLTLPGIIV-----------------------------------------------------
CYST_PROWI      RVIFPTLVPFTLSFSRALG---------------------------------------------------
CYST_CHLVU      KVILPTLWPFTLSFSRALG---------------------------------------------------
YESP_BACSU      ----------------------------------------------------------------------
UGPA_YERPS      ----------------------------------------------------------------------
UGPA_YERPN      ----------------------------------------------------------------------
UGPA_YERPE      ----------------------------------------------------------------------
UGPA_YERPA      ----------------------------------------------------------------------
UGPA_YERE8      ----------------------------------------------------------------------
UGPA_ERWCT      ----------------------------------------------------------------------
UGPA_SALTY      ----------------------------------------------------------------------
UGPA_SALTI      ----------------------------------------------------------------------
UGPA_SALPA      ----------------------------------------------------------------------
UGPA_SALCH      ----------------------------------------------------------------------
UGPA_ECO57      ----------------------------------------------------------------------
Y4OQ_RHISN      ----------------------------------------------------------------------
UGPA_AGRT5      ----------------------------------------------------------------------
UGPA_RHIME      ----------------------------------------------------------------------
UGPA_BRUSU      ----------------------------------------------------------------------
UGPA_BRUME      ----------------------------------------------------------------------
UGPA_BRUAB      ----------------------------------------------------------------------
UGPA_BRUA2      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           XXXXXXPYLATQLRKEVRx
Y1215_PYRHO     XXXXXXPYLYWSYKGEER-
AMYD_THETU      -------------------
Y1038_PYRHO     -------------------
YOR1_CALSR      -------------------
LACF_RHIRD      -------------------
AGLF_RHIME      -------------------
Y2990_BRUA2     -------------------
Y2783_BRUAB     -------------------
MSMF_STRMU      -------------------
YESP_BACSU      -------------------
Y3749_BRUSU     -------------------
UGPA_YERPS      -------------------
UGPA_YERPN      -------------------
UGPA_YERPE      -------------------
UGPA_YERPA      -------------------
YCJO_SHIFL      -------------------
YCJO_ECOLI      -------------------
UGPA_YERE8      -------------------
UGPA_ERWCT      -------------------
YURN_BACSU      -------------------
UGPA_SHIFL      -------------------
UGPA_SHIF8      -------------------
UGPA_SALTY      -------------------
UGPA_SALTI      -------------------
UGPA_SALPA      -------------------
UGPA_SALCH      -------------------
UGPA_ECOUT      -------------------
UGPA_ECOLI      -------------------
UGPA_ECOL6      -------------------
UGPA_ECOL5      -------------------
UGPA_ECOK1      -------------------
UGPA_ECO57      -------------------
Y4OQ_RHISN      -------------------
ARAP_BACSU      -------------------
UGPA_SHIDS      -------------------
UGPA_AGRT5      -------------------
ARAP_BACHD      -------------------
UGPA_RHIME      -------------------
MALC_STRR6      -------------------
MALC_STRPN      -------------------
UGPA_BRUSU      -------------------
UGPA_BRUME      -------------------
UGPA_BRUAB      -------------------
UGPA_BRUA2      -------------------
MALG_VIBPA      -------------------
MALF_PHOLL      -------------------
MALG_SHIFL      -------------------
MALG_SALTY      -------------------
MALG_SALTI      -------------------
MALG_ECOLI      -------------------
MALG_ECOL6      -------------------
MALG_ECO57      -------------------
MALF_YERPE      -------------------
MDXF_BACSU      -------------------
MALG_YERPE      -------------------
AGLG_RHIME      -------------------
MALG_ENTAE      -------------------
MALG_PHOLL      -------------------
YOR2_CALSR      -------------------
MALG_VIBVY      -------------------
MALG_VIBVU      -------------------
MALG_VIBCH      -------------------
YJ16_PYRHO      -------------------
ARAQ_BACHD      -------------------
MSMG_STRMU      -------------------
MALF_VIBVY      -------------------
MALF_VIBVU      -------------------
LPLB_BACSU      -------------------
YTEP_BACSU      -------------------
Y1216_PYRHO     -------------------
NOCM_AGRT5      -------------------
POTC_HAEIN      -------------------
YESQ_BACSU      -------------------
ARAQ_BACSU      -------------------
PHNU_SALTI      -------------------
NIFC_CLOPA      -------------------
HISM_SALTY      -------------------
HISM_SALTI      -------------------
UGPE_SALTY      -------------------
UGPE_SALTI      -------------------
UGPE_SALPA      -------------------
UGPE_SALCH      -------------------
PHNU_SALPA      -------------------
HISM_SHIFL      -------------------
HISM_ECOLI      -------------------
HISM_ECOL6      -------------------
HISM_ECO57      -------------------
LACG_RHIRD      -------------------
UGPE_SHIFL      -------------------
UGPE_SHIF8      -------------------
UGPE_SHIDS      -------------------
UGPE_ECOUT      -------------------
UGPE_ECOLI      -------------------
UGPE_ECOL6      -------------------
UGPE_ECOL5      -------------------
UGPE_ECOK1      -------------------
UGPE_ECO57      -------------------
PHNU_SALTY      -------------------
PHNU_SALCH      -------------------
MALF_VIBCH      -------------------
POTC_SHIFL      -------------------
POTC_ECOLI      -------------------
POTC_ECOL6      -------------------
POTC_ECO57      -------------------
MDXG_BACSU      -------------------
MODB_ECOLI      -------------------
MODB_ECO57      -------------------
CYST_PROWI      -------------------
CYST_CHLVU      -------------------
YESP_BACSU      -------------------
UGPA_YERPS      -------------------
UGPA_YERPN      -------------------
UGPA_YERPE      -------------------
UGPA_YERPA      -------------------
UGPA_YERE8      -------------------
UGPA_ERWCT      -------------------
UGPA_SALTY      -------------------
UGPA_SALTI      -------------------
UGPA_SALPA      -------------------
UGPA_SALCH      -------------------
UGPA_ECO57      -------------------
Y4OQ_RHISN      -------------------
UGPA_AGRT5      -------------------
UGPA_RHIME      -------------------
UGPA_BRUSU      -------------------
UGPA_BRUME      -------------------
UGPA_BRUAB      -------------------
UGPA_BRUA2      -------------------