[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tthe0:AAS80689.1

[Show Plain Result]


## Summary of Sequence Search
    1::257
   12::128     2e-09  37%  274 aa  YTXM_BACSU RecName: Full=Putative esterase ytxM;       
   28::133     3e-09  30%  341 aa  Y2734_MYCBO RecName: Full=Uncharacterized protein Mb2734;
   28::133     3e-09  30%  341 aa  Y2715_MYCTU RecName: Full=Uncharacterized protein Rv2715/MT2788;
  249::363     3e-08  34%  555 aa  HYES_PIG RecName: Full=Epoxide hydrolase 2;       
   24::169     3e-08  24%  267 aa  ELH2_ACIAD RecName: Full=3-oxoadipate enol-lactonase 2;       
  249::365     1e-07  34%  555 aa  HYES_HUMAN RecName: Full=Epoxide hydrolase 2;       
   18::132     2e-07  32%  294 aa  DEH1_MORSB RecName: Full=Haloacetate dehalogenase H-1;       
    5::109     7e-07  34%  254 aa  BIOH_PHOPR RecName: Full=Carboxylesterase bioH;       
    9::107     7e-07  37%  254 aa  BIOH_METCA RecName: Full=Carboxylesterase bioH;       
   16::105     2e-06  33%  286 aa  HYES_CORS2 RecName: Full=Soluble epoxide hydrolase;       
    5::109     3e-06  30%  261 aa  BIOH_ALISL RecName: Full=Carboxylesterase bioH;       
    5::111     5e-06  32%  258 aa  BIOH_PSEA6 RecName: Full=Carboxylesterase bioH;       
  247::361     6e-06  31%  554 aa  HYES_MOUSE RecName: Full=Epoxide hydrolase 2;       
   50::168     8e-06  31%  291 aa  BPHL_HUMAN RecName: Full=Valacyclovir hydrolase;       
  247::361     1e-05  31%  554 aa  HYES_RAT RecName: Full=Epoxide hydrolase 2;       
   25::130     3e-05  30%  311 aa  SERHL_MOUSE RecName: Full=Serine hydrolase-like protein;       
   22::127     3e-05  30%  276 aa  PRXC_SYNY3 RecName: Full=Putative non-heme chloroperoxidase;       
   10::109     3e-05  35%  257 aa  BIOH_KLEP3 RecName: Full=Carboxylesterase bioH;       
   16::115     3e-05  32%  258 aa  BIOH_EDWI9 RecName: Full=Carboxylesterase bioH;       
   30::131     5e-05  29%  273 aa  YUGF_BACSU RecName: Full=Uncharacterized hydrolase yugF;       
    9::109     5e-05  31%  254 aa  BIOH_AERS4 RecName: Full=Carboxylesterase bioH;       
   13::120     7e-05  25%  271 aa  YRAK_BACSU RecName: Full=Uncharacterized hydrolase yraK;       
   31::137     9e-05  30%  203 aa  SERHL_HUMAN RecName: Full=Serine hydrolase-like protein;       
   31::137     9e-05  30%  314 aa  SEHL2_HUMAN RecName: Full=Serine hydrolase-like protein 2;       
   28::73      9e-05  44%  592 aa  EPHD_MYCTU RecName: Full=Probable oxidoreductase ephD;       
   28::73      9e-05  44%  592 aa  EPHD_MYCBO RecName: Full=Probable oxidoreductase ephD;       
   30::127     1e-04  29%  283 aa  PHAB_PSEOL RecName: Full=Poly(3-hydroxyalkanoate) depolymerase;    
    5::113     1e-04  29%  257 aa  BIOH_VIBFM RecName: Full=Carboxylesterase bioH;       
   64::186     1e-04  29%  317 aa  ABHDB_DANRE RecName: Full=Abhydrolase domain-containing protein 11;
   16::130     1e-04  31%  278 aa  PRXC_STRAU RecName: Full=Non-heme chloroperoxidase;       
   32::164     1e-04  28%  302 aa  DHMA_CAUSK RecName: Full=Haloalkane dehalogenase;       
   16::130     1e-04  31%  278 aa  BPOA2_STRAU RecName: Full=Non-haem bromoperoxidase BPO-A2;       
   10::109     3e-04  33%  259 aa  BIOH_HAMD5 RecName: Full=Carboxylesterase bioH;       
   25::127     3e-04  33%  276 aa  TODF_PSEP1 RecName: Full=2-hydroxy-6-oxo-2,4-heptadienoate
   11::51      3e-04  41%  253 aa  MENH_ERWCT RecName:
    1::110     3e-04  29%  261 aa  BIOH_PROMH RecName: Full=Carboxylesterase bioH;       
    9::109     4e-04  30%  261 aa  BIOH_TOLAT RecName: Full=Carboxylesterase bioH;       
   11::117     6e-04  29%  256 aa  BIOH_SHEWM RecName: Full=Carboxylesterase bioH;       
   36::135     7e-04  27%  272 aa  TPES_PSEPU RecName: Full=Tropinesterase;       
    5::109     7e-04  29%  255 aa  BIOH_VIBPA RecName: Full=Carboxylesterase bioH;       
  125::252     7e-04  26%  374 aa  ACOC_RALEH RecName: Full=Dihydrolipoyllysine-residue
   12::117     0.001  32%  263 aa  BIOH_NITMU RecName: Full=Carboxylesterase bioH;       
    9::118     0.001  41%  254 aa  BIOH_CHRVO RecName: Full=Carboxylesterase bioH;       
    1::257

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MARLRYRLEGEGPPVVLLNGIFQRLESWDPVLPHLTGFTLLRYDMRGQGESEAPEGPYPPRXXXXXXXXX
YTXM_BACSU      ---VRYAVADEGPAVVCLHGFTGSKQSWTFLDEMLPDSRLIKIDCLGHGETDAPLNGYSTTRQVSDLAEI
Y2734_MYCBO     --RRAFRIAGSGPAILLIHGIGDNSTTWNGVHAKLARFTVIAPDLLGHGQSDKPRADYSVAAYANGMRDL
Y2715_MYCTU     --RRAFRIAGSGPAILLIHGIGDNSTTWNGVHAKLARFTVIAPDLLGHGQSDKPRADYSVAAYANGMRDL
HYES_PIG        --RLHFVEMGSGPAVCLCHGFPESWFSWRYQIPALAGFRVLAVDMKGYGESSAPPEEYSLEVLCKDMVTF
ELH2_ACIAD      --------QADRPALIFSNSLGTNLSMWQQQIAYFQDYFVICYDTRGHGASSTPVGPYRIDQLGTDVIAL
HYES_HUMAN      --RLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAGYRVLAMDMKGYGESSAPPEEYCMEVLCKEMVTF
DEH1_MORSB      ---IAYTVSGEGPPVLMLHGFPQNRAMWARVAPQLAHHTVVCADLRGYGDSDKPKSNYSFRTFAHDQLCV
BIOH_PHOPR      ---LCWQTEGQGSDLVLIHGWGMNGAVWQQLLPLLTPFYRVHWDMPGYGHSHDISADSIEEMAQLLLDKS
BIOH_METCA      ---------GRGPEVVLIHGWGMHGGIWSGFVPWLTDFRVTRIDLPGHGHSPMLAD------WSLETVAG
HYES_CORS2      --RMHYVTAGSGYPLVLLHGWPQSWYEWRNVIPALAQFTVIAPDLRGLGDSEKPMTGFDKRTMATDVREL
BIOH_ALISL      ---LYWQTEGEGSDLVLIHGWGMNGAVWQPIVEKLSSYRVHTVDLSGYGYSELGSADFDEMVAQVLAQAP
BIOH_PSEA6      ---LKTRTVGSGPNFVLLHGWGVNSGVWQPIAKQLEQFSVTYVDLPGFGENQIMPKPYDLKNLAECVANV
HYES_MOUSE      --RLHFVEMGSGPALCLCHGFPESWFSWRYQIPALAGFRVLAIDMKGYGDSSSPPEIEEYAMELLCKEMV
BPHL_HUMAN      --QLHYQQTGEGDAVLLLPGMLGSGETFGPQLKNLNKFTVVAWDPRGYGHSRPPDRDFPAERDAKDAVDL
HYES_RAT        --RLHFVEMGSGPAICLCHGFPESWFSWRYQIPALAGFRVLAIDMKGYGDSSSPPEIEEYAMELLCEEMV
SERHL_MOUSE     ----------KNPPVLCLHGWLDNANSFDRLIPLLPDFCYMAMDFGGHGLSSHPGLPYYQQNFVSEVRRV
PRXC_SYNY3      ---------GAGQPIVLIHGFPLNGDSWEKQVLVLAGYRVITYDRRGFGASSQPSSGYDYDTFAADLHTL
BIOH_KLEP3      ---------GEGDHLVLLHGWGLNAQVWDCITPQLASFTLHLVDLPGYGRS----GGYGAMSLEAMAQRV
BIOH_EDWI9      --------------LVLLHGWGLNAEVWRSIVPQLSAFRLHLVDLPGYGRSGG-DTPYSLAEMTQRVLAQ
YUGF_BACSU      --------------LVCVHGFLSSAFSFRKVIPLLRDYDIIALDLPPFGQSEKSRTIYTYQNLAKLVIGI
BIOH_AERS4      ---------GQGPDLVLLHGWGMNGAVWHGIAQQLAAYRLHLVDLPGFGNSPLREGSDYSLPWLAEQIAI
YRAK_BACSU      -ANIHYQVRGSGPIILLVHGGGGDADKFHHVANHLANYTVVTYDRRGHSRSNLANQIEGYRVETHSDDAH
SERHL_HUMAN     ----------QGPPVLCLHGWLDNASSFDRLIPLLQDFYYVAMDFGGHGLSSSPGVPYYLQTFVSEIRRV
SEHL2_HUMAN     ----------QGPPVLCLHGWLDNASSFDRLIPLLQDFYYVAMDFGGHGLSSSPGVPYYLQTFVSEIRRV
EPHD_MYCTU      ----------DGPTVVLVHGFPDSHVLWDGVVPLLARFRIVRYDNRGVGRSSVPK---------------
EPHD_MYCBO      ----------DGPTVVLVHGFPDSHVLWDGVVPLLARFRIVRYDNRGVGRSSVPK---------------
PHAB_PSEOL      -------------PLLIFNGIGANLELVFPFIEALDDLEVIAFDVPGVGGSSTPRHPYRFPGLAKLTARM
BIOH_VIBFM      ---LYWQTEGEGSDLVLIHGWGMNGAVWQTTSEKLSQYRVHTVDLSGYGHSELGSADFDEMVKQVLAQAP
ABHDB_DANRE     --------KGDSTPLVFLHGLFGSKSNFHSIAKSLTGRKVLTIDARNHGKS-----PHSPDTMTSDLTHL
PRXC_STRAU      ---LYYEDHGAGQPVVLIHGFPLSGHSWERQSAALAGYRVITYDRRGFGQSSQPTTGYDYDTFAADLNTV
DHMA_CAUSK      -ARLRLHYVDEGPPVLLMHGEPSWAYLYRKIIPALAGHRVIAPDLIGFGRSDKPRGDYTYERHVAWMSAW
BPOA2_STRAU     ---LYYEDHGTGQPVVLIHGFPLSGHSWERQSAALAGYRVITYDRRGFGQSSQPTTGYDYDTFAADLNTV
BIOH_HAMD5      ---------GEGKDFVMLHGWGMNSNAWRYIINRFSHFRLHLFDLPGYGFSQSEESFTLPEISETVL---
TODF_PSEP1      ---------GAGNPVVLVHGSGPGVTAWATVMPELSRHRVIAPDMVGFGFTQRPHGHYGVESWVAHLAGI
MENH_ERWCT      ------------PWLVCLHGLFGSGEDWSPVLPFFRDWPMLLVDLPGHGASRA-----------------
BIOH_PROMH      MNKLYWQTLGEGKTLVLLHGWGLNAQVWQSIITRLSSFTLHLVDLPGYGRSQG----FPVLTLKEMADIV
BIOH_TOLAT      ---------GQGPDLVLLHGWGLNGAVWQEIVPLLQPYYRLHLDLPGFGYSR---DVIMPDSRLATWSET
BIOH_SHEWM      ---------GQGQELVILHGWGVNSSVFTPLHASLSEYRVHYVDLPGFGHSDPIDGDLDD-------WVD
TPES_PSEPU      -----------GDPVLLLHGYTDTSRAFSSLAPFLSDKRYLALDLRGHGGTSIPKCCYYVSDFAEDVSDF
BIOH_VIBPA      ---LHWQSFGQGPDLVLLHGWGMNGAVWQQTVESLQAFCVHVVDLPGYGFSAEHHGEDLAQIAAMVLKDA
ACOC_RALEH      --RVRYARKGGGAETVLIHGFGGDLDNWLFNLPLADAYTVVALDLPGHGQSSPRLAGTTLAQMAGFVARF
BIOH_NITMU      ---------GEGPDLVLLHGWAMHSGMWGSTRRSLAQFRLHLVDLPGHGFSR---GALPYKRGEKNGVSE
BIOH_CHRVO      ---------GQGPDVVMLHGWGLHGGVFARVAEQLTRFCVHLVDLPGHGAS-----PALPRFXXXXXXXX


                         .         .         *         .         .         .         .:140
query           XXXXKLSRPALVGLSNGGIVAMEAALLAPERFSALVLCCTTPYLDAALRAKVESWLHALKTGGTVLRLRV
YTXM_BACSU      FDQLKLHKVKLIGYSMGGRLAYSFAMTYPERVSALVLESTTPGL--------------------------
Y2734_MYCBO     LSVLDIERVTIVGHSLGGGVAMQFAYQFPQLVDRLIL---------------------------------
Y2715_MYCTU     LSVLDIERVTIVGHSLGGGVAMQFAYQFPQLVDRLIL---------------------------------
HYES_PIG        LNKLGLSQAVFIGHDWGGVLVWNMALFYPERVRA-VASLNTPFM--------------------------
ELH2_ACIAD      LDHLQIPQATFCGISMGGLTGQWLAIHFPERFNQVIVANTAAKIGEAQAWQARAQL-VREQGLTPIAQTA
HYES_HUMAN      LDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRA-VASLNTPFIPA------------------------
DEH1_MORSB      MRHLGFERFHLVGHDRGGRTGHRMALDHPEAVLSLTVMDIVP----------------------------
BIOH_PHOPR      PISA-----TWLGWSLGGLVATQAALLAPERVTRLVTVASSP----------------------------
BIOH_METCA      AVLEAVPRPAWVGWSLGAMVALEAARMAPGAVASLTLLCGTP----------------------------
HYES_CORS2      VSHLGYDKVGVIGHDWGGSVA-------------------------------------------------
BIOH_ALISL      ------EKSAWLGWSLGGLIATQAALTAPDRVSQLITVASSP----------------------------
BIOH_PSEA6      LPENSV----LAGWSLGGLVAQHVALLEPTNVKQLILIATSP----------------------------
HYES_MOUSE      TFLDKLGIPVFIGHDWAGVMVWNMALFYPERVRA-VASLNTPFM--------------------------
BPHL_HUMAN      MKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYV--------------------------
HYES_RAT        TFLNKLGIPVFIGHDWAGVLVWNMALFHPERVRA-VASLNTPLM--------------------------
SERHL_MOUSE     ATAFKWNQFTLLGHSFGGCVGGTFACMFPEMVDKLILLDSTPF---------------------------
PRXC_SYNY3      MTKLDLQNTVLVGFSMGGEVTRYLGKYGSERVQKAVLMAPVP----------------------------
BIOH_KLEP3      LEQAP-PQAVWLGWSLGGLVASQVAMMHPERVQALVTVASSP----------------------------
BIOH_EDWI9      AP----ERALWLGWSLGGLVATQAALYHPQRVSGLITVASSPCFTAQM----------------------
YUGF_BACSU      LEHLQVKQAVLVGHSMGGQISLSAALQKPELFSKVVLLCSSGYL--------------------------
BIOH_AERS4      VLPQKCH---LLGWSLGGLVASQLALTQPERLHSLITVASSP----------------------------
YRAK_BACSU      RLLAKINKPAYVGSSSGAVIGLDLCIRHPEQVHVMI----------------------------------
SERHL_HUMAN     VAALKWNRFSILGHSFGGVVGGMFFCTFPEMVDKLILLDTPLFL--------------------------
SEHL2_HUMAN     VAALKWNRFSILGHSFGGVVGGMFFCTFPEMVDKLILLDTPLFL--------------------------
EPHD_MYCTU      ----------------------------------------------------------------------
EPHD_MYCBO      ----------------------------------------------------------------------
PHAB_PSEOL      LDYLDYGQVNVIGVSWGGALAQQFAHDYPERCKKLVLAAT------------------------------
BIOH_VIBFM      ------KKAAWLGWSLGGLIATKAALTSPERVSQLITVASSPCFSA------------------------
ABHDB_DANRE     LGQLHIGKCVLIGHSMGGKVAMTTALSQPNLVERLVVVDISPSLTSA-HTNFHAYIQAMK----------
PRXC_STRAU      LETLDLQDAVLVGFSMGGEVARYVSSYGTARIAKVALASLEPFL--------------------------
DHMA_CAUSK      LEGLDLRGLTLFCQDWGGLIGLRLVAAFPERFAGLVIANTGLPTGAGMTDGFKAWL--------------
BPOA2_STRAU     LETLDLQDAVLVGFSMGGEVARYVSSYGTARIAKVALASLEPFL--------------------------
BIOH_HAMD5      ----KKAPPQAIGWSMGGCIASEIALRYPERVLALITVCSSP----------------------------
TODF_PSEP1      LDALELDRVDLVGNSFGGALSLAFAIRFPHRVRRLVL---------------------------------
MENH_ERWCT      ----------------------------------------------------------------------
BIOH_PROMH      FSQAPEKKAIWLGWSLGGLVASRIALDNPNNVRALITVASSP----------------------------
BIOH_TOLAT      VLAELPARFDLLGWSMGGLIALRMALDHPSRINRLILTGSSP----------------------------
BIOH_SHEWM      AIINQLPNTAIIGWSLGGLVATKAALRYPEQVRGLVTIASSP---CFMAREDESW---------------
TPES_PSEPU      IDKMGLHNTTVIGHSMGSMTAGVLASIHPDKVSRLVLIST------------------------------
BIOH_VIBPA      P-----EKAVWLGWSLGGLVATHIALNAPQRVSKLITVASSP----------------------------
ACOC_RALEH      MDETGIEAAHVVGHSMGGGVAAQLAVDAPQRVLSVALVSPVGFGDAVNSGYTEGFVSA------------
BIOH_NITMU      DMVERVVEVVICGWSLGGQLAIELALREPARVEKIILTSTTP----------------------------
BIOH_CHRVO      XXXHFPLPAQVVGWSLGGLIAQHWAARHPDKVKSLALVATSPRF-----VRDETWPHA------------


                         +         .         .         .         .         *         .:210
query           ALPWVFGRGFLEAHPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YTXM_BACSU      ----------------------------------------------------------------------
Y2734_MYCBO     ----------------------------------------------------------------------
Y2715_MYCTU     ----------------------------------------------------------------------
HYES_PIG        ----------------------------------------------------------------------
ELH2_ACIAD      ATRW-FTPGFIEDSP-------------------------------------------------------
HYES_HUMAN      ----------------------------------------------------------------------
DEH1_MORSB      ----------------------------------------------------------------------
BIOH_PHOPR      ----------------------------------------------------------------------
BIOH_METCA      ----------------------------------------------------------------------
HYES_CORS2      ----------------------------------------------------------------------
BIOH_ALISL      ----------------------------------------------------------------------
BIOH_PSEA6      ----------------------------------------------------------------------
HYES_MOUSE      ----------------------------------------------------------------------
BPHL_HUMAN      ----------------------------------------------------------------------
HYES_RAT        ----------------------------------------------------------------------
SERHL_MOUSE     ----------------------------------------------------------------------
PRXC_SYNY3      ----------------------------------------------------------------------
BIOH_KLEP3      ----------------------------------------------------------------------
BIOH_EDWI9      ----------------------------------------------------------------------
YUGF_BACSU      ----------------------------------------------------------------------
BIOH_AERS4      ----------------------------------------------------------------------
YRAK_BACSU      ----------------------------------------------------------------------
SERHL_HUMAN     ----------------------------------------------------------------------
SEHL2_HUMAN     ----------------------------------------------------------------------
EPHD_MYCTU      ----------------------------------------------------------------------
EPHD_MYCBO      ----------------------------------------------------------------------
PHAB_PSEOL      ----------------------------------------------------------------------
BIOH_VIBFM      ----------------------------------------------------------------------
ABHDB_DANRE     ----------------------------------------------------------------------
PRXC_STRAU      ----------------------------------------------------------------------
DHMA_CAUSK      ----------------------------------------------------------------------
BPOA2_STRAU     ----------------------------------------------------------------------
BIOH_HAMD5      ----------------------------------------------------------------------
TODF_PSEP1      ----------------------------------------------------------------------
MENH_ERWCT      ----------------------------------------------------------------------
BIOH_PROMH      ----------------------------------------------------------------------
BIOH_TOLAT      ----------------------------------------------------------------------
BIOH_SHEWM      ----------------------------------------------------------------------
TPES_PSEPU      ----------------------------------------------------------------------
BIOH_VIBPA      ----------------------------------------------------------------------
ACOC_RALEH      ----------------------------------------------------------------------
BIOH_NITMU      ----------------------------------------------------------------------
BIOH_CHRVO      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YTXM_BACSU      -----------------------------------------------
Y2734_MYCBO     -----------------------------------------------
Y2715_MYCTU     -----------------------------------------------
HYES_PIG        -----------------------------------------------
ELH2_ACIAD      -----------------------------------------------
HYES_HUMAN      -----------------------------------------------
DEH1_MORSB      -----------------------------------------------
BIOH_PHOPR      -----------------------------------------------
BIOH_METCA      -----------------------------------------------
HYES_CORS2      -----------------------------------------------
BIOH_ALISL      -----------------------------------------------
BIOH_PSEA6      -----------------------------------------------
HYES_MOUSE      -----------------------------------------------
BPHL_HUMAN      -----------------------------------------------
HYES_RAT        -----------------------------------------------
SERHL_MOUSE     -----------------------------------------------
PRXC_SYNY3      -----------------------------------------------
BIOH_KLEP3      -----------------------------------------------
BIOH_EDWI9      -----------------------------------------------
YUGF_BACSU      -----------------------------------------------
BIOH_AERS4      -----------------------------------------------
YRAK_BACSU      -----------------------------------------------
SERHL_HUMAN     -----------------------------------------------
SEHL2_HUMAN     -----------------------------------------------
EPHD_MYCTU      -----------------------------------------------
EPHD_MYCBO      -----------------------------------------------
PHAB_PSEOL      -----------------------------------------------
BIOH_VIBFM      -----------------------------------------------
ABHDB_DANRE     -----------------------------------------------
PRXC_STRAU      -----------------------------------------------
DHMA_CAUSK      -----------------------------------------------
BPOA2_STRAU     -----------------------------------------------
BIOH_HAMD5      -----------------------------------------------
TODF_PSEP1      -----------------------------------------------
MENH_ERWCT      -----------------------------------------------
BIOH_PROMH      -----------------------------------------------
BIOH_TOLAT      -----------------------------------------------
BIOH_SHEWM      -----------------------------------------------
TPES_PSEPU      -----------------------------------------------
BIOH_VIBPA      -----------------------------------------------
ACOC_RALEH      -----------------------------------------------
BIOH_NITMU      -----------------------------------------------
BIOH_CHRVO      -----------------------------------------------