[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tthe0:AAS80708.1

[Show Plain Result]


## Summary of Sequence Search
    1::421
    1::421       0.0 100%  421 aa  SYH_THET8 RecName: Full=Histidyl-tRNA synthetase;       
    1::421       0.0 100%  421 aa  SYH_THET2 RecName: Full=Histidyl-tRNA synthetase;       
    1::414     e-116  54%  427 aa  SYH_DEIRA RecName: Full=Histidyl-tRNA synthetase;       
   35::427     e-113  52%  448 aa  SYH_DEIDV RecName: Full=Histidyl-tRNA synthetase;       
   35::418     e-112  55%  431 aa  SYH_DEIGD RecName: Full=Histidyl-tRNA synthetase;       
    1::406     e-101  45%  419 aa  SYH_HALOH RecName: Full=Histidyl-tRNA synthetase;       
    5::410     2e-95  47%  429 aa  SYH_CYAP4 RecName: Full=Histidyl-tRNA synthetase;       
    3::414     2e-94  46%  426 aa  SYH_SYNP2 RecName: Full=Histidyl-tRNA synthetase;       
    1::415     7e-94  44%  420 aa  SYH_THESQ RecName: Full=Histidyl-tRNA synthetase;       
    1::415     1e-93  44%  420 aa  SYH_THEMA RecName: Full=Histidyl-tRNA synthetase;       
    5::416     2e-93  43%  419 aa  SYH_SYNJA RecName: Full=Histidyl-tRNA synthetase;       
    1::409     3e-93  45%  428 aa  SYH_THEEB RecName: Full=Histidyl-tRNA synthetase;       
    3::409     5e-93  45%  414 aa  SYH_SOLUE RecName: Full=Histidyl-tRNA synthetase;       
    1::422     6e-93  43%  423 aa  SYH_GEOSW RecName: Full=Histidyl-tRNA synthetase;       
    1::412     8e-93  47%  424 aa  SYH_RUBXD RecName: Full=Histidyl-tRNA synthetase;       
    1::410     1e-92  46%  424 aa  SYH_DESHY RecName: Full=Histidyl-tRNA synthetase;       
    1::410     1e-92  46%  424 aa  SYH_DESHD RecName: Full=Histidyl-tRNA synthetase;       
    1::410     1e-92  45%  423 aa  SYH_ANOFW RecName: Full=Histidyl-tRNA synthetase;       
    1::423     2e-92  43%  426 aa  SYH_GEOKA RecName: Full=Histidyl-tRNA synthetase;       
    7::411     4e-92  44%  419 aa  SYH_DESRM RecName: Full=Histidyl-tRNA synthetase;       
    7::419     3e-91  44%  425 aa  SYH_PELTS RecName: Full=Histidyl-tRNA synthetase;       
    5::410     6e-91  45%  426 aa  SYH_MICAN RecName: Full=Histidyl-tRNA synthetase;       
    1::422     6e-91  44%  426 aa  SYH1_BACSK RecName: Full=Histidyl-tRNA synthetase 1;       
    1::414     2e-90  43%  425 aa  SYH_LISIN RecName: Full=Histidyl-tRNA synthetase;       
    7::418     2e-90  45%  424 aa  SYH_BACA2 RecName: Full=Histidyl-tRNA synthetase;       
    5::410     2e-90  45%  435 aa  SYH_SYNE7 RecName: Full=Histidyl-tRNA synthetase;       
    7::413     3e-90  44%  424 aa  SYH_BACSU RecName: Full=Histidyl-tRNA synthetase;       
    1::422     3e-90  44%  423 aa  SYH_BACCN RecName: Full=Histidyl-tRNA synthetase;       
    1::423     1e-89  42%  425 aa  SYH_LISMF RecName: Full=Histidyl-tRNA synthetase;       
    1::414     3e-89  42%  425 aa  SYH_LISMO RecName: Full=Histidyl-tRNA synthetase;       
    5::395     4e-89  44%  430 aa  SYH_CYAP7 RecName: Full=Histidyl-tRNA synthetase;       
    3::423     4e-89  45%  441 aa  SYH_ACIBL RecName: Full=Histidyl-tRNA synthetase;       
    5::416     9e-89  43%  447 aa  SYH_SYNY3 RecName: Full=Histidyl-tRNA synthetase;       
    7::418     9e-89  42%  424 aa  SYH_BACLD RecName: Full=Histidyl-tRNA synthetase;       
    5::409     2e-88  44%  421 aa  SYH_FERNB RecName: Full=Histidyl-tRNA synthetase;       
    5::410     3e-88  45%  435 aa  SYH_SYNP6 RecName: Full=Histidyl-tRNA synthetase;       
    8::410     4e-88  44%  430 aa  SYH_ACAM1 RecName: Full=Histidyl-tRNA synthetase;       
    3::410     5e-88  41%  418 aa  SYH_THEAB RecName: Full=Histidyl-tRNA synthetase;       
    1::411     8e-88  41%  418 aa  SYH_THEP3 RecName: Full=Histidyl-tRNA synthetase;       
    7::417     8e-88  41%  420 aa  SYH_MACCJ RecName: Full=Histidyl-tRNA synthetase;       
    3::410     1e-87  41%  419 aa  SYH_THEM4 RecName: Full=Histidyl-tRNA synthetase;       
    3::410     1e-87  42%  433 aa  SYH_CYAA5 RecName: Full=Histidyl-tRNA synthetase;       
    1::422     1e-87  43%  423 aa  SYH2_BACC1 RecName: Full=Histidyl-tRNA synthetase 2;       
    1::411     2e-87  41%  418 aa  SYH_THEPX RecName: Full=Histidyl-tRNA synthetase;       
    1::422     2e-87  43%  423 aa  SYH2_BACHK RecName: Full=Histidyl-tRNA synthetase 2;       
    1::422     2e-87  43%  423 aa  SYH2_BACCZ RecName: Full=Histidyl-tRNA synthetase 2;       
    1::422     2e-87  43%  423 aa  SYH2_BACCR RecName: Full=Histidyl-tRNA synthetase 2;       
    1::422     2e-87  43%  423 aa  SYH2_BACAN RecName: Full=Histidyl-tRNA synthetase 2;       
    6::423     2e-87  43%  424 aa  SYH_ERWCT RecName: Full=Histidyl-tRNA synthetase;       
   12::416     3e-87  43%  426 aa  SYH_CORK4 RecName: Full=Histidyl-tRNA synthetase;       
    6::417     4e-87  41%  424 aa  SYH_STAES RecName: Full=Histidyl-tRNA synthetase;       
    6::417     4e-87  41%  424 aa  SYH_STAEQ RecName: Full=Histidyl-tRNA synthetase;       
    6::423     4e-87  43%  424 aa  SYH_PECCP RecName: Full=Histidyl-tRNA synthetase;       
    3::410     4e-87  42%  429 aa  SYH_CYAP8 RecName: Full=Histidyl-tRNA synthetase;       
    1::407     5e-87  44%  421 aa  SYH_NATTJ RecName: Full=Histidyl-tRNA synthetase;       
    1::410     5e-87  44%  423 aa  SYH_CARHZ RecName: Full=Histidyl-tRNA synthetase;       
    1::411     5e-87  40%  421 aa  SYH_ALKOO RecName: Full=Histidyl-tRNA synthetase;       
    1::407     9e-87  43%  433 aa  SYH_ENTFA RecName: Full=Histidyl-tRNA synthetase;       
    5::413     1e-86  45%  417 aa  SYH_DESDG RecName: Full=Histidyl-tRNA synthetase;       
    4::424     2e-86  44%  424 aa  SYH_THISH RecName: Full=Histidyl-tRNA synthetase;       
    6::417     2e-86  42%  420 aa  SYH_STAS1 RecName: Full=Histidyl-tRNA synthetase;       
    7::416     2e-86  42%  426 aa  SYH_LACPL RecName: Full=Histidyl-tRNA synthetase;       
    6::422     3e-86  42%  426 aa  SYH_SHEB8 RecName: Full=Histidyl-tRNA synthetase;       
    6::422     3e-86  42%  426 aa  SYH_SHEB5 RecName: Full=Histidyl-tRNA synthetase;       
    6::422     3e-86  42%  426 aa  SYH_SHEB2 RecName: Full=Histidyl-tRNA synthetase;       
    6::422     3e-86  43%  429 aa  SYH_PSEPF RecName: Full=Histidyl-tRNA synthetase;       
   33::418     3e-86  42%  424 aa  SYH_PARUW RecName: Full=Histidyl-tRNA synthetase;       
    7::415     3e-86  45%  415 aa  SYH_RHORT RecName: Full=Histidyl-tRNA synthetase;       
    6::422     4e-86  42%  426 aa  SYH_SHEB9 RecName: Full=Histidyl-tRNA synthetase;       
    6::426     7e-86  44%  429 aa  SYH_PSEPK RecName: Full=Histidyl-tRNA synthetase;       
    6::426     7e-86  44%  429 aa  SYH_PSEPG RecName: Full=Histidyl-tRNA synthetase;       
    6::426     7e-86  44%  429 aa  SYH_PSEP1 RecName: Full=Histidyl-tRNA synthetase;       
    6::424     1e-85  43%  424 aa  SYH_ECOLU RecName: Full=Histidyl-tRNA synthetase;       
    6::424     1e-85  43%  424 aa  SYH_SHIB3 RecName: Full=Histidyl-tRNA synthetase;       
    6::423     1e-85  42%  424 aa  SYH_SHEDO RecName: Full=Histidyl-tRNA synthetase;       
    6::424     2e-85  43%  424 aa  SYH_SERP5 RecName: Full=Histidyl-tRNA synthetase;       
    6::424     2e-85  43%  424 aa  SYH_SHISS RecName: Full=Histidyl-tRNA synthetase;       
    6::424     2e-85  43%  424 aa  SYH_SHIFL RecName: Full=Histidyl-tRNA synthetase;       
    6::424     2e-85  43%  424 aa  SYH_ECOUT RecName: Full=Histidyl-tRNA synthetase;       
    6::424     2e-85  43%  424 aa  SYH_ECOSM RecName: Full=Histidyl-tRNA synthetase;       
    6::424     2e-85  43%  424 aa  SYH_ECOLI RecName: Full=Histidyl-tRNA synthetase;       
    6::424     2e-85  43%  424 aa  SYH_ECOLC RecName: Full=Histidyl-tRNA synthetase;       
    6::424     2e-85  43%  424 aa  SYH_ECOL6 RecName: Full=Histidyl-tRNA synthetase;       
    6::424     2e-85  43%  424 aa  SYH_ECOL5 RecName: Full=Histidyl-tRNA synthetase;       
    6::424     2e-85  43%  424 aa  SYH_ECOK1 RecName: Full=Histidyl-tRNA synthetase;       
    6::424     2e-85  43%  424 aa  SYH_ECOHS RecName: Full=Histidyl-tRNA synthetase;       
    6::424     2e-85  43%  424 aa  SYH_ECODH RecName: Full=Histidyl-tRNA synthetase;       
    6::424     2e-85  43%  424 aa  SYH_ECOBW RecName: Full=Histidyl-tRNA synthetase;       
    6::424     2e-85  43%  424 aa  SYH_ECO8A RecName: Full=Histidyl-tRNA synthetase;       
    6::424     2e-85  43%  424 aa  SYH_ECO81 RecName: Full=Histidyl-tRNA synthetase;       
    6::424     2e-85  43%  424 aa  SYH_ECO7I RecName: Full=Histidyl-tRNA synthetase;       
    6::424     2e-85  43%  424 aa  SYH_ECO5E RecName: Full=Histidyl-tRNA synthetase;       
    6::424     2e-85  43%  424 aa  SYH_ECO57 RecName: Full=Histidyl-tRNA synthetase;       
    6::424     2e-85  43%  424 aa  SYH_ECO55 RecName: Full=Histidyl-tRNA synthetase;       
    6::424     2e-85  43%  424 aa  SYH_ECO45 RecName: Full=Histidyl-tRNA synthetase;       
    6::424     2e-85  43%  424 aa  SYH_ECO24 RecName: Full=Histidyl-tRNA synthetase;       
    6::424     4e-85  44%  424 aa  SYH_YERPY RecName: Full=Histidyl-tRNA synthetase;       
    6::424     4e-85  44%  424 aa  SYH_YERPS RecName: Full=Histidyl-tRNA synthetase;       
    6::424     4e-85  44%  424 aa  SYH_YERPP RecName: Full=Histidyl-tRNA synthetase;       
    6::424     4e-85  44%  424 aa  SYH_YERPN RecName: Full=Histidyl-tRNA synthetase;       
    6::424     4e-85  44%  424 aa  SYH_YERPG RecName: Full=Histidyl-tRNA synthetase;       
    6::424     4e-85  44%  424 aa  SYH_YERPE RecName: Full=Histidyl-tRNA synthetase;       
    6::424     4e-85  44%  424 aa  SYH_YERPB RecName: Full=Histidyl-tRNA synthetase;       
    6::424     4e-85  44%  424 aa  SYH_YERPA RecName: Full=Histidyl-tRNA synthetase;       
    1::413     5e-85  42%  429 aa  SYH_STRZT RecName: Full=Histidyl-tRNA synthetase;       
    1::413     5e-85  42%  429 aa  SYH_STRPN RecName: Full=Histidyl-tRNA synthetase;       
    1::420     5e-85  41%  426 aa  SYH_GEOTN RecName: Full=Histidyl-tRNA synthetase;       
    5::423     5e-85  43%  430 aa  SYH_CHLP8 RecName: Full=Histidyl-tRNA synthetase;       
    6::424     6e-85  43%  424 aa  SYH_KLEP3 RecName: Full=Histidyl-tRNA synthetase;       
    6::424     6e-85  43%  424 aa  SYH_ECO27 RecName: Full=Histidyl-tRNA synthetase;       
    6::424     8e-85  43%  424 aa  SYH_YERP3 RecName: Full=Histidyl-tRNA synthetase;       
    1::413     8e-85  42%  429 aa  SYH_STRPI RecName: Full=Histidyl-tRNA synthetase;       
    6::424     8e-85  43%  424 aa  SYH_SODGM RecName: Full=Histidyl-tRNA synthetase;       
    6::424     8e-85  43%  424 aa  SYH_SHIBS RecName: Full=Histidyl-tRNA synthetase;       
    4::414     1e-84  43%  422 aa  SYH_VIBFM RecName: Full=Histidyl-tRNA synthetase;       
    4::414     1e-84  43%  422 aa  SYH_VIBF1 RecName: Full=Histidyl-tRNA synthetase;       
    1::413     1e-84  42%  429 aa  SYH_STRPS RecName: Full=Histidyl-tRNA synthetase;       
    6::423     1e-84  41%  424 aa  SYH_SHEAM RecName: Full=Histidyl-tRNA synthetase;       
    1::412     1e-84  42%  427 aa  SYH_LACCB RecName: Full=Histidyl-tRNA synthetase;       
    1::412     1e-84  42%  427 aa  SYH_LACC3 RecName: Full=Histidyl-tRNA synthetase;       
    1::413     1e-84  42%  429 aa  SYH_STRR6 RecName: Full=Histidyl-tRNA synthetase;       
    1::413     1e-84  42%  429 aa  SYH_STRPJ RecName: Full=Histidyl-tRNA synthetase;       
    1::413     1e-84  43%  429 aa  SYH_STRP4 RecName: Full=Histidyl-tRNA synthetase;       
    1::413     1e-84  42%  429 aa  SYH_STRP2 RecName: Full=Histidyl-tRNA synthetase;       
    6::426     1e-84  43%  429 aa  SYH_PSEPW RecName: Full=Histidyl-tRNA synthetase;       
   14::437     1e-84  43%  446 aa  SYH_BURP8 RecName: Full=Histidyl-tRNA synthetase;       
    5::426     2e-84  43%  428 aa  SYH_SYNS3 RecName: Full=Histidyl-tRNA synthetase;       
    1::413     2e-84  42%  429 aa  SYH_STRZP RecName: Full=Histidyl-tRNA synthetase;       
    6::424     2e-84  43%  424 aa  SYH_SHIDS RecName: Full=Histidyl-tRNA synthetase;       
    6::424     2e-84  42%  424 aa  SYH_SALTI RecName: Full=Histidyl-tRNA synthetase;       
    6::424     2e-84  42%  424 aa  SYH_SALPK RecName: Full=Histidyl-tRNA synthetase;       
    6::424     2e-84  42%  424 aa  SYH_SALPA RecName: Full=Histidyl-tRNA synthetase;       
    6::424     2e-84  42%  424 aa  SYH_SALHS RecName: Full=Histidyl-tRNA synthetase;       
    6::424     2e-84  43%  424 aa  SYH_SALAR RecName: Full=Histidyl-tRNA synthetase;       
    6::424     2e-84  43%  424 aa  SYH_ECOSE RecName: Full=Histidyl-tRNA synthetase;       
    6::424     3e-84  42%  424 aa  SYH_SALCH RecName: Full=Histidyl-tRNA synthetase;       
    1::413     4e-84  42%  429 aa  SYH_STRZJ RecName: Full=Histidyl-tRNA synthetase;       
    1::413     4e-84  42%  429 aa  SYH_STRP7 RecName: Full=Histidyl-tRNA synthetase;       
    6::424     4e-84  43%  424 aa  SYH_SALTY RecName: Full=Histidyl-tRNA synthetase;       
    6::424     4e-84  43%  424 aa  SYH_SALPC RecName: Full=Histidyl-tRNA synthetase;       
    6::424     4e-84  43%  424 aa  SYH_SALPB RecName: Full=Histidyl-tRNA synthetase;       
    6::424     4e-84  43%  424 aa  SYH_SALNS RecName: Full=Histidyl-tRNA synthetase;       
    6::424     4e-84  43%  424 aa  SYH_SALEP RecName: Full=Histidyl-tRNA synthetase;       
    6::424     4e-84  43%  424 aa  SYH_SALDC RecName: Full=Histidyl-tRNA synthetase;       
    1::407     4e-84  39%  417 aa  SYH_CLOTH RecName: Full=Histidyl-tRNA synthetase;       
    1::411     5e-84  40%  417 aa  SYH_THETN RecName: Full=Histidyl-tRNA synthetase;       
    6::424     5e-84  43%  424 aa  SYH_SALSV RecName: Full=Histidyl-tRNA synthetase;       
    6::424     5e-84  43%  424 aa  SYH_SALA4 RecName: Full=Histidyl-tRNA synthetase;       
    1::416     5e-84  42%  425 aa  SYH_HELMI RecName: Full=Histidyl-tRNA synthetase;       
    1::403     5e-84  43%  403 aa  SYH_AQUAE RecName: Full=Histidyl-tRNA synthetase;       
    4::414     7e-84  43%  422 aa  SYH_VIBCM RecName: Full=Histidyl-tRNA synthetase;       
    4::414     7e-84  43%  422 aa  SYH_VIBCH RecName: Full=Histidyl-tRNA synthetase;       
    4::414     7e-84  43%  422 aa  SYH_VIBC3 RecName: Full=Histidyl-tRNA synthetase;       
    1::415     7e-84  40%  420 aa  SYH_THEP1 RecName: Full=Histidyl-tRNA synthetase;       
    6::424     7e-84  42%  424 aa  SYH_SHEWM RecName: Full=Histidyl-tRNA synthetase;       
    6::424     7e-84  43%  424 aa  SYH_SALG2 RecName: Full=Histidyl-tRNA synthetase;       
    6::427     9e-84  43%  427 aa  SYH_PROMH RecName: Full=Histidyl-tRNA synthetase;       
    4::419     9e-84  43%  423 aa  SYH_HAEI8 RecName: Full=Histidyl-tRNA synthetase;       
    6::424     1e-83  43%  425 aa  SYH_PHOLL RecName: Full=Histidyl-tRNA synthetase;       
    7::413     1e-83  44%  422 aa  SYH_ALCBS RecName: Full=Histidyl-tRNA synthetase;       
    6::402     1e-83  44%  425 aa  SYH_AERHH RecName: Full=Histidyl-tRNA synthetase;       
    6::424     2e-83  44%  424 aa  SYH_YERE8 RecName: Full=Histidyl-tRNA synthetase;       
    4::421     2e-83  44%  427 aa  SYH_MANSM RecName: Full=Histidyl-tRNA synthetase;       
    4::419     2e-83  43%  423 aa  SYH_HAEIN RecName: Full=Histidyl-tRNA synthetase;       
    6::422     2e-83  43%  429 aa  SYH_PSEF5 RecName: Full=Histidyl-tRNA synthetase;       
    6::402     2e-83  44%  425 aa  SYH_AERS4 RecName: Full=Histidyl-tRNA synthetase;       
    4::423     3e-83  43%  425 aa  SYH_HAES2 RecName: Full=Histidyl-tRNA synthetase;       
    1::413     3e-83  41%  426 aa  SYH_STRSV RecName: Full=Histidyl-tRNA synthetase;       
    6::422     3e-83  41%  422 aa  SYH_PHOPR RecName: Full=Histidyl-tRNA synthetase;       
    6::423     4e-83  42%  423 aa  SYH_SHELP RecName: Full=Histidyl-tRNA synthetase;       
    6::424     4e-83  42%  424 aa  SYH_SHEHH RecName: Full=Histidyl-tRNA synthetase;       
    6::424     6e-83  42%  424 aa  SYH_SHESH RecName: Full=Histidyl-tRNA synthetase;       
    6::416     6e-83  42%  424 aa  SYH_SHEFN RecName: Full=Histidyl-tRNA synthetase;       
    6::422     6e-83  42%  429 aa  SYH_PSE14 RecName: Full=Histidyl-tRNA synthetase;       
    1::420     6e-83  41%  422 aa  SYH_LYSSC RecName: Full=Histidyl-tRNA synthetase;       
    1::399     6e-83  43%  419 aa  SYH_GEOLS RecName: Full=Histidyl-tRNA synthetase;       
    6::422     8e-83  42%  429 aa  SYH_PSESM RecName: Full=Histidyl-tRNA synthetase;       
    4::423     8e-83  43%  425 aa  SYH_HAES1 RecName: Full=Histidyl-tRNA synthetase;       
   14::437     8e-83  42%  446 aa  SYH_BURPP RecName: Full=Histidyl-tRNA synthetase;       
    6::424     1e-82  42%  424 aa  SYH_SHEPA RecName: Full=Histidyl-tRNA synthetase;       
    1::413     1e-82  41%  430 aa  SYH_LACLA RecName: Full=Histidyl-tRNA synthetase;       
    1::411     1e-82  41%  427 aa  SYH_STRSY RecName: Full=Histidyl-tRNA synthetase;       
    1::411     1e-82  41%  427 aa  SYH_STRS2 RecName: Full=Histidyl-tRNA synthetase;       
    5::400     2e-82  42%  413 aa  SYH_FUSNN RecName: Full=Histidyl-tRNA synthetase;       
    7::409     2e-82  44%  412 aa  SYH_DESAD RecName: Full=Histidyl-tRNA synthetase;       
    7::408     2e-82  41%  426 aa  SYH_PROMT RecName: Full=Histidyl-tRNA synthetase;       
    1::422     2e-82  41%  429 aa  SYH_OCEIH RecName: Full=Histidyl-tRNA synthetase;       
    6::422     3e-82  42%  429 aa  SYH_PSEU2 RecName: Full=Histidyl-tRNA synthetase;       
    1::413     4e-82  41%  430 aa  SYH_LACLM RecName: Full=Histidyl-tRNA synthetase;       
    3::407     4e-82  44%  427 aa  SYH_EXISA RecName: Full=Histidyl-tRNA synthetase;       
    6::429     4e-82  43%  429 aa  SYH_ESCF3 RecName: Full=Histidyl-tRNA synthetase;       
   14::437     4e-82  42%  446 aa  SYH_BURXL RecName: Full=Histidyl-tRNA synthetase;       
    4::419     5e-82  42%  423 aa  SYH_HAEIG RecName: Full=Histidyl-tRNA synthetase;       
    5::415     6e-82  43%  429 aa  SYH_PELPB RecName: Full=Histidyl-tRNA synthetase;       
    4::422     8e-82  42%  422 aa  SYH_VIBVY RecName: Full=Histidyl-tRNA synthetase;       
    4::422     8e-82  42%  422 aa  SYH_VIBVU RecName: Full=Histidyl-tRNA synthetase;       
    6::422     8e-82  41%  425 aa  SYH_SHESW RecName: Full=Histidyl-tRNA synthetase;       
    6::422     8e-82  41%  425 aa  SYH_SHEPC RecName: Full=Histidyl-tRNA synthetase;       
    6::422     8e-82  42%  429 aa  SYH_PSEFS RecName: Full=Histidyl-tRNA synthetase;       
    5::415     8e-82  42%  430 aa  SYH_PELLD RecName: Full=Histidyl-tRNA synthetase;       
    6::406     8e-82  43%  425 aa  SYH_ERWT9 RecName: Full=Histidyl-tRNA synthetase;       
    6::403     8e-82  45%  428 aa  SYH_CHRSD RecName: Full=Histidyl-tRNA synthetase;       
   14::409     8e-82  43%  446 aa  SYH_BURVG RecName: Full=Histidyl-tRNA synthetase;       
    5::408     1e-81  44%  413 aa  SYH_GEOSL RecName: Full=Histidyl-tRNA synthetase;       
   14::437     1e-81  42%  446 aa  SYH_BURP6 RecName: Full=Histidyl-tRNA synthetase;       
   14::415     1e-81  43%  446 aa  SYH_BURCM RecName: Full=Histidyl-tRNA synthetase;       
   14::437     1e-81  42%  446 aa  SYH_BURCJ RecName: Full=Histidyl-tRNA synthetase;       
   14::437     1e-81  42%  446 aa  SYH_BURCC RecName: Full=Histidyl-tRNA synthetase;       
   14::415     1e-81  43%  446 aa  SYH_BURA4 RecName: Full=Histidyl-tRNA synthetase;       
    4::414     2e-81  43%  422 aa  SYH_VIBPA RecName: Full=Histidyl-tRNA synthetase;       
    6::422     2e-81  42%  426 aa  SYH_PSEA6 RecName: Full=Histidyl-tRNA synthetase;       
    4::404     2e-81  43%  423 aa  SYH_HAEIE RecName: Full=Histidyl-tRNA synthetase;       
   14::425     2e-81  42%  446 aa  SYH_BURS3 RecName: Full=Histidyl-tRNA synthetase;       
   14::425     2e-81  42%  446 aa  SYH_BURM1 RecName: Full=Histidyl-tRNA synthetase;       
    6::425     2e-81  43%  428 aa  SYH_PSEE4 RecName: Full=Histidyl-tRNA synthetase;       
    6::426     2e-81  43%  429 aa  SYH_PSEAE RecName: Full=Histidyl-tRNA synthetase;       
    6::426     2e-81  43%  429 aa  SYH_PSEAB RecName: Full=Histidyl-tRNA synthetase;       
    6::426     2e-81  43%  429 aa  SYH_PSEA8 RecName: Full=Histidyl-tRNA synthetase;       
    3::417     3e-81  40%  423 aa  SYH_STAHJ RecName: Full=Histidyl-tRNA synthetase;       
    7::411     3e-81  43%  421 aa  SYH_DESMR RecName: Full=Histidyl-tRNA synthetase;       
    5::415     3e-81  42%  430 aa  SYH_CHLTE RecName: Full=Histidyl-tRNA synthetase;       
   14::437     3e-81  42%  446 aa  SYH_BURCH RecName: Full=Histidyl-tRNA synthetase;       
   14::437     3e-81  42%  446 aa  SYH_BURCA RecName: Full=Histidyl-tRNA synthetase;       
    3::418     4e-81  41%  420 aa  SYH_SACEN RecName: Full=Histidyl-tRNA synthetase;       
    1::413     4e-81  40%  430 aa  SYH_LACLS RecName: Full=Histidyl-tRNA synthetase;       
   14::437     4e-81  42%  446 aa  SYH_BURPS RecName: Full=Histidyl-tRNA synthetase;       
   14::437     4e-81  42%  446 aa  SYH_BURP0 RecName: Full=Histidyl-tRNA synthetase;       
    1::408     4e-81  43%  414 aa  SYH_ANAD2 RecName: Full=Histidyl-tRNA synthetase;       
    6::414     5e-81  43%  422 aa  SYH_VIBHB RecName: Full=Histidyl-tRNA synthetase;       
   14::425     5e-81  42%  446 aa  SYH_BURTA RecName: Full=Histidyl-tRNA synthetase;       
    4::412     7e-81  42%  427 aa  SYH_ALTMD RecName: Full=Histidyl-tRNA synthetase;       
    1::401     9e-81  41%  433 aa  SYH_THELT RecName: Full=Histidyl-tRNA synthetase;       
    5::406     9e-81  43%  430 aa  SYH_SYNPX RecName: Full=Histidyl-tRNA synthetase;       
    6::426     9e-81  42%  429 aa  SYH_PSEA7 RecName: Full=Histidyl-tRNA synthetase;       
    7::409     9e-81  41%  434 aa  SYH_LACSS RecName: Full=Histidyl-tRNA synthetase;       
    1::408     9e-81  42%  414 aa  SYH_ANASK RecName: Full=Histidyl-tRNA synthetase;       
    5::395     1e-80  42%  421 aa  SYH_PROMA RecName: Full=Histidyl-tRNA synthetase;       
   14::437     1e-80  42%  446 aa  SYH_BURP1 RecName: Full=Histidyl-tRNA synthetase;       
   14::437     1e-80  42%  446 aa  SYH_BURMS RecName: Full=Histidyl-tRNA synthetase;       
   14::437     1e-80  42%  446 aa  SYH_BURMA RecName: Full=Histidyl-tRNA synthetase;       
   14::437     1e-80  42%  446 aa  SYH_BURM9 RecName: Full=Histidyl-tRNA synthetase;       
   14::437     1e-80  42%  446 aa  SYH_BURM7 RecName: Full=Histidyl-tRNA synthetase;       
    6::422     2e-80  41%  424 aa  SYH_SHEPW RecName: Full=Histidyl-tRNA synthetase;       
    7::402     2e-80  42%  432 aa  SYH_RALSO RecName: Full=Histidyl-tRNA synthetase;       
    7::408     2e-80  40%  423 aa  SYH_PROM1 RecName: Full=Histidyl-tRNA synthetase;       
    6::409     2e-80  43%  419 aa  SYH_METFK RecName: Full=Histidyl-tRNA synthetase;       
    6::421     3e-80  44%  422 aa  SYH_METCA RecName: Full=Histidyl-tRNA synthetase;       
    6::406     4e-80  44%  424 aa  SYH_EDWI9 RecName: Full=Histidyl-tRNA synthetase;       
    6::422     5e-80  40%  425 aa  SYH_SHESA RecName: Full=Histidyl-tRNA synthetase;       
    3::396     5e-80  44%  415 aa  SYH_IDILO RecName: Full=Histidyl-tRNA synthetase;       
    4::415     5e-80  41%  423 aa  SYH_HAEDU RecName: Full=Histidyl-tRNA synthetase;       
    5::415     5e-80  41%  434 aa  SYH_CHLPB RecName: Full=Histidyl-tRNA synthetase;       
    6::422     6e-80  40%  425 aa  SYH_SHESM RecName: Full=Histidyl-tRNA synthetase;       
    1::415     6e-80  39%  417 aa  SYH_CLOPH RecName: Full=Histidyl-tRNA synthetase;       
    7::400     8e-80  42%  426 aa  SYH_THICR RecName: Full=Histidyl-tRNA synthetase;       
    5::406     8e-80  43%  436 aa  SYH_PROM3 RecName: Full=Histidyl-tRNA synthetase;       
    4::399     8e-80  43%  429 aa  SYH_DECAR RecName: Full=Histidyl-tRNA synthetase;       
    5::406     1e-79  42%  441 aa  SYH_SYNPW RecName: Full=Histidyl-tRNA synthetase;       
    6::422     1e-79  40%  425 aa  SYH_SHESR RecName: Full=Histidyl-tRNA synthetase;       
    1::414     1e-79  38%  419 aa  SYH_PELCD RecName: Full=Histidyl-tRNA synthetase;       
    1::430     2e-79  41%  432 aa  SYH_SYMTH RecName: Full=Histidyl-tRNA synthetase;       
    6::422     2e-79  40%  425 aa  SYH_SHEON RecName: Full=Histidyl-tRNA synthetase;       
   41::422     2e-79  43%  422 aa  SYH_NOCFA RecName: Full=Histidyl-tRNA synthetase;       
    6::408     2e-79  42%  420 aa  SYH_NITEU RecName: Full=Histidyl-tRNA synthetase;       
    6::424     2e-79  42%  424 aa  SYH_ENT38 RecName: Full=Histidyl-tRNA synthetase;       
    7::409     5e-79  41%  431 aa  SYH_LACF3 RecName: Full=Histidyl-tRNA synthetase;       
    6::419     5e-79  42%  423 aa  SYH_ACTSZ RecName: Full=Histidyl-tRNA synthetase;       
    6::420     7e-79  43%  424 aa  SYH_MARMS RecName: Full=Histidyl-tRNA synthetase;       
    6::417     9e-79  40%  428 aa  SYH_STACT RecName: Full=Histidyl-tRNA synthetase;       
    7::416     9e-79  40%  431 aa  SYH_LACS1 RecName: Full=Histidyl-tRNA synthetase;       
    1::419     9e-79  38%  421 aa  SYH_ANATD RecName: Full=Histidyl-tRNA synthetase;       
    1::352     1e-78  43%  426 aa  SYH_STRGC RecName: Full=Histidyl-tRNA synthetase;       
    6::417     1e-78  40%  420 aa  SYH_STAAW RecName: Full=Histidyl-tRNA synthetase;       
    6::417     1e-78  40%  420 aa  SYH_STAAU RecName: Full=Histidyl-tRNA synthetase;       
    6::417     1e-78  40%  420 aa  SYH_STAAT RecName: Full=Histidyl-tRNA synthetase;       
    6::417     1e-78  40%  420 aa  SYH_STAAS RecName: Full=Histidyl-tRNA synthetase;       
    6::417     1e-78  40%  420 aa  SYH_STAAR RecName: Full=Histidyl-tRNA synthetase;       
    6::417     1e-78  40%  420 aa  SYH_STAAN RecName: Full=Histidyl-tRNA synthetase;       
    6::417     1e-78  40%  420 aa  SYH_STAAM RecName: Full=Histidyl-tRNA synthetase;       
    6::417     1e-78  40%  420 aa  SYH_STAAE RecName: Full=Histidyl-tRNA synthetase;       
    6::417     1e-78  40%  420 aa  SYH_STAAC RecName: Full=Histidyl-tRNA synthetase;       
    6::417     1e-78  40%  420 aa  SYH_STAAB RecName: Full=Histidyl-tRNA synthetase;       
    6::417     1e-78  40%  420 aa  SYH_STAA9 RecName: Full=Histidyl-tRNA synthetase;       
    6::417     1e-78  40%  420 aa  SYH_STAA8 RecName: Full=Histidyl-tRNA synthetase;       
    6::417     1e-78  40%  420 aa  SYH_STAA3 RecName: Full=Histidyl-tRNA synthetase;       
    6::417     1e-78  40%  420 aa  SYH_STAA2 RecName: Full=Histidyl-tRNA synthetase;       
    6::417     1e-78  40%  420 aa  SYH_STAA1 RecName: Full=Histidyl-tRNA synthetase;       
    8::402     1e-78  43%  415 aa  SYH_GLUOX RecName: Full=Histidyl-tRNA synthetase;       
   38::422     2e-78  42%  423 aa  SYH_RHOSR RecName: Full=Histidyl-tRNA synthetase;       
    1::420     2e-78  38%  420 aa  SYH_CLOD6 RecName: Full=Histidyl-tRNA synthetase;       
    5::424     3e-78  40%  429 aa  SYH_CHLPD RecName: Full=Histidyl-tRNA synthetase;       
    1::420     3e-78  41%  428 aa  SYH_BACHD RecName: Full=Histidyl-tRNA synthetase;       
    5::407     4e-78  42%  430 aa  SYH_SYNS9 RecName: Full=Histidyl-tRNA synthetase;       
    5::408     4e-78  42%  414 aa  SYH_SYNR3 RecName: Full=Histidyl-tRNA synthetase;       
    7::416     4e-78  40%  431 aa  SYH_LACBA RecName: Full=Histidyl-tRNA synthetase;       
    7::421     7e-78  40%  426 aa  SYH_LEGPL RecName: Full=Histidyl-tRNA synthetase;       
    7::421     7e-78  40%  426 aa  SYH_LEGPA RecName: Full=Histidyl-tRNA synthetase;       
    1::399     1e-77  41%  414 aa  SYH_PELPD RecName: Full=Histidyl-tRNA synthetase;       
   35::402     1e-77  43%  420 aa  SYH_MYCUA RecName: Full=Histidyl-tRNA synthetase;       
    7::415     1e-77  43%  415 aa  SYH_GLUDA RecName: Full=Histidyl-tRNA synthetase;       
    6::400     1e-77  43%  423 aa  SYH_CHRVO RecName: Full=Histidyl-tRNA synthetase;       
    6::415     1e-77  42%  423 aa  SYH_ACTP7 RecName: Full=Histidyl-tRNA synthetase;       
    7::421     1e-77  40%  426 aa  SYH_LEGPH RecName: Full=Histidyl-tRNA synthetase;       
    1::402     2e-77  41%  407 aa  SYH_WOLPP RecName: Full=Histidyl-tRNA synthetase;       
   26::423     3e-77  41%  456 aa  SYH_RALEJ RecName: Full=Histidyl-tRNA synthetase;       
    5::398     3e-77  42%  413 aa  SYH_GEOMG RecName: Full=Histidyl-tRNA synthetase;       
    1::411     3e-77  38%  416 aa  SYH_CLOK5 RecName: Full=Histidyl-tRNA synthetase;       
    1::411     3e-77  38%  416 aa  SYH_CLOK1 RecName: Full=Histidyl-tRNA synthetase;       
    1::403     3e-77  39%  419 aa  SYH_CALS8 RecName: Full=Histidyl-tRNA synthetase;       
   38::413     4e-77  42%  423 aa  SYH_RHOOB RecName: Full=Histidyl-tRNA synthetase;       
    7::410     4e-77  40%  420 aa  SYH_DESAP RecName: Full=Histidyl-tRNA synthetase;       
   10::409     6e-77  44%  428 aa  SYH_BORA1 RecName: Full=Histidyl-tRNA synthetase;       
    4::410     8e-77  41%  433 aa  SYH_AZOSB RecName: Full=Histidyl-tRNA synthetase;       
    5::414     1e-76  40%  423 aa  SYH_DESOH RecName: Full=Histidyl-tRNA synthetase;       
    1::407     1e-76  37%  415 aa  SYH_CLOBM RecName: Full=Histidyl-tRNA synthetase;       
   26::423     1e-76  41%  456 aa  SYH_RALEH RecName: Full=Histidyl-tRNA synthetase;       
    4::419     1e-76  41%  423 aa  SYH_PASMU RecName: Full=Histidyl-tRNA synthetase;       
   26::423     1e-76  41%  456 aa  SYH_CUPTR RecName: Full=Histidyl-tRNA synthetase;       
    7::368     2e-76  44%  416 aa  SYH_DICT6 RecName: Full=Histidyl-tRNA synthetase;       
    3::417     3e-76  39%  425 aa  SYH_DESAH RecName: Full=Histidyl-tRNA synthetase;       
    6::418     4e-76  40%  421 aa  SYH_NITEC RecName: Full=Histidyl-tRNA synthetase;       
    3::400     4e-76  40%  419 aa  SYH_DESAA RecName: Full=Histidyl-tRNA synthetase;       
    1::407     4e-76  37%  415 aa  SYH_CLOBL RecName: Full=Histidyl-tRNA synthetase;       
    1::407     4e-76  37%  415 aa  SYH_CLOBK RecName: Full=Histidyl-tRNA synthetase;       
    1::407     4e-76  37%  415 aa  SYH_CLOBH RecName: Full=Histidyl-tRNA synthetase;       
    1::407     4e-76  37%  415 aa  SYH_CLOB1 RecName: Full=Histidyl-tRNA synthetase;       
    7::407     5e-76  42%  423 aa  SYH_MOOTA RecName: Full=Histidyl-tRNA synthetase;       
    5::406     7e-76  40%  430 aa  SYH_PORPU RecName: Full=Histidyl-tRNA synthetase, chloroplastic;   
   43::410     7e-76  42%  427 aa  SYH_CORU7 RecName: Full=Histidyl-tRNA synthetase;       
   10::402     7e-76  42%  428 aa  SYH_BORPA RecName: Full=Histidyl-tRNA synthetase;       
   10::402     7e-76  42%  428 aa  SYH_BORBR RecName: Full=Histidyl-tRNA synthetase;       
   38::413     1e-75  42%  423 aa  SYH_RHOE4 RecName: Full=Histidyl-tRNA synthetase;       
    5::406     1e-75  41%  436 aa  SYH_PROMM RecName: Full=Histidyl-tRNA synthetase;       
    7::408     1e-75  41%  411 aa  SYH_DICTD RecName: Full=Histidyl-tRNA synthetase;       
   15::414     2e-75  41%  429 aa  SYH_DESPS RecName: Full=Histidyl-tRNA synthetase;       
   10::402     3e-75  42%  428 aa  SYH_BORPE RecName: Full=Histidyl-tRNA synthetase;       
    1::407     3e-75  36%  415 aa  SYH_CLOB6 RecName: Full=Histidyl-tRNA synthetase;       
    7::400     4e-75  43%  417 aa  SYH_DESVV RecName: Full=Histidyl-tRNA synthetase;       
    8::425     6e-75  41%  425 aa  SYH_STRCO RecName: Full=Histidyl-tRNA synthetase;       
    8::400     6e-75  39%  415 aa  SYH_RICBR RecName: Full=Histidyl-tRNA synthetase;       
    8::400     6e-75  39%  415 aa  SYH_RICB8 RecName: Full=Histidyl-tRNA synthetase;       
    7::422     6e-75  41%  423 aa  SYH_HALHL RecName: Full=Histidyl-tRNA synthetase;       
    1::401     8e-75  41%  408 aa  SYH_WOLPM RecName: Full=Histidyl-tRNA synthetase;       
    5::397     8e-75  40%  423 aa  SYH_PROM4 RecName: Full=Histidyl-tRNA synthetase;       
    7::397     8e-75  41%  414 aa  SYH_EHRRW RecName: Full=Histidyl-tRNA synthetase;       
    7::400     8e-75  43%  417 aa  SYH_DESVH RecName: Full=Histidyl-tRNA synthetase;       
    1::407     8e-75  36%  415 aa  SYH_CLOBJ RecName: Full=Histidyl-tRNA synthetase;       
    8::412     8e-75  39%  416 aa  SYH_BDEBA RecName: Full=Histidyl-tRNA synthetase;       
    5::423     1e-74  42%  426 aa  SYH_PROVI RecName: Full=Histidyl-tRNA synthetase;       
   35::402     1e-74  42%  420 aa  SYH_MYCMM RecName: Full=Histidyl-tRNA synthetase;       
    8::404     1e-74  42%  426 aa  SYH_COLP3 RecName: Full=Histidyl-tRNA synthetase;       
    6::418     1e-74  41%  428 aa  SYH_AZOVD RecName: Full=Histidyl-tRNA synthetase;       
    6::350     1e-74  43%  429 aa  SYH_ALHEH RecName: Full=Histidyl-tRNA synthetase;       
   45::420     2e-74  41%  429 aa  SYH_COREF RecName: Full=Histidyl-tRNA synthetase;       
    1::404     2e-74  42%  428 aa  SYH_SORC5 RecName: Full=Histidyl-tRNA synthetase;       
    6::307     2e-74  48%  429 aa  SYH_PSEU5 RecName: Full=Histidyl-tRNA synthetase;       
    3::420     3e-74  39%  420 aa  SYH_STRAW RecName: Full=Histidyl-tRNA synthetase;       
    7::397     3e-74  41%  414 aa  SYH_EHRRG RecName: Full=Histidyl-tRNA synthetase;       
    1::401     4e-74  40%  408 aa  SYH_WOLWR RecName: Full=Histidyl-tRNA synthetase;       
    6::409     4e-74  38%  420 aa  SYH_THEYD RecName: Full=Histidyl-tRNA synthetase;       
    6::310     4e-74  48%  428 aa  SYH_PSEMY RecName: Full=Histidyl-tRNA synthetase;       
   45::424     4e-74  40%  429 aa  SYH_CORGL RecName: Full=Histidyl-tRNA synthetase;       
    6::410     6e-74  38%  418 aa  SYH_DEHE1 RecName: Full=Histidyl-tRNA synthetase;       
   52::420     6e-74  42%  443 aa  SYH_CORJK RecName: Full=Histidyl-tRNA synthetase;       
    1::403     6e-74  36%  416 aa  SYH_CLONN RecName: Full=Histidyl-tRNA synthetase;       
    6::402     8e-74  40%  425 aa  SYH_TOLAT RecName: Full=Histidyl-tRNA synthetase;       
    1::416     8e-74  36%  428 aa  SYH_LACH4 RecName: Full=Histidyl-tRNA synthetase;       
    5::379     1e-73  43%  449 aa  SYH_ERYLH RecName: Full=Histidyl-tRNA synthetase;       
    1::395     1e-73  41%  413 aa  SYH_WOLTR RecName: Full=Histidyl-tRNA synthetase;       
   26::421     1e-73  42%  436 aa  SYH_PSYWF RecName: Full=Histidyl-tRNA synthetase;       
    6::402     1e-73  41%  426 aa  SYH_PSEHT RecName: Full=Histidyl-tRNA synthetase;       
    6::414     2e-73  41%  431 aa  SYH_NEIMF RecName: Full=Histidyl-tRNA synthetase;       
    1::413     2e-73  38%  425 aa  SYH_STRU0 RecName: Full=Histidyl-tRNA synthetase;       
    7::406     2e-73  39%  426 aa  SYH_PROM0 RecName: Full=Histidyl-tRNA synthetase;       
    5::378     2e-73  43%  419 aa  SYH_NOVAD RecName: Full=Histidyl-tRNA synthetase;       
    6::423     2e-73  41%  431 aa  SYH_NEIMB RecName: Full=Histidyl-tRNA synthetase;       
    7::409     3e-73  41%  413 aa  SYH_EHRCJ RecName: Full=Histidyl-tRNA synthetase;       
    5::406     7e-73  38%  430 aa  SYH_PORYE RecName: Full=Histidyl-tRNA synthetase, chloroplastic;   
   41::402     7e-73  42%  422 aa  SYH_MYCVP RecName: Full=Histidyl-tRNA synthetase;       
    1::416     7e-73  37%  428 aa  SYH_LACGA RecName: Full=Histidyl-tRNA synthetase;       
    1::411     7e-73  37%  428 aa  SYH_LACDB RecName: Full=Histidyl-tRNA synthetase;       
    1::411     7e-73  37%  428 aa  SYH_LACDA RecName: Full=Histidyl-tRNA synthetase;       
    7::402     7e-73  42%  413 aa  SYH_EHRCR RecName: Full=Histidyl-tRNA synthetase;       
    7::393     9e-73  39%  426 aa  SYH_PROMS RecName: Full=Histidyl-tRNA synthetase;       
   20::419     9e-73  39%  420 aa  SYH_MYCPA RecName: Full=Histidyl-tRNA synthetase;       
    6::418     9e-73  39%  423 aa  SYH_LARHH RecName: Full=Histidyl-tRNA synthetase;       
   12::427     9e-73  41%  438 aa  SYH_AZOSE RecName: Full=Histidyl-tRNA synthetase;       
    6::426     9e-73  39%  430 aa  SYH_ACIBT RecName: Full=Histidyl-tRNA synthetase;       
    6::414     1e-72  40%  422 aa  SYH_VIBSL RecName: Full=Histidyl-tRNA synthetase;       
    5::415     1e-72  41%  425 aa  SYH_CHLCH RecName: Full=Histidyl-tRNA synthetase;       
    6::426     1e-72  39%  430 aa  SYH_ACIBC RecName: Full=Histidyl-tRNA synthetase;       
    3::420     2e-72  40%  420 aa  SYH_STRGG RecName: Full=Histidyl-tRNA synthetase;       
    6::414     2e-72  41%  431 aa  SYH_NEIM0 RecName: Full=Histidyl-tRNA synthetase;       
   31::421     2e-72  40%  423 aa  SYH_MYCTU RecName: Full=Histidyl-tRNA synthetase;       
   31::421     2e-72  40%  423 aa  SYH_MYCTA RecName: Full=Histidyl-tRNA synthetase;       
   31::421     2e-72  40%  423 aa  SYH_MYCBT RecName: Full=Histidyl-tRNA synthetase;       
   31::421     2e-72  40%  423 aa  SYH_MYCBP RecName: Full=Histidyl-tRNA synthetase;       
   31::421     2e-72  40%  423 aa  SYH_MYCBO RecName: Full=Histidyl-tRNA synthetase;       
    1::416     2e-72  37%  428 aa  SYH_LACJO RecName: Full=Histidyl-tRNA synthetase;       
    6::405     5e-72  41%  431 aa  SYH_NEIMA RecName: Full=Histidyl-tRNA synthetase;       
    8::384     6e-72  40%  415 aa  SYH_RICFE RecName: Full=Histidyl-tRNA synthetase;       
    8::400     6e-72  39%  415 aa  SYH_RICAH RecName: Full=Histidyl-tRNA synthetase;       
    6::417     6e-72  40%  421 aa  SYH_COXB2 RecName: Full=Histidyl-tRNA synthetase;       
    1::404     6e-72  36%  415 aa  SYH_CLOPS RecName: Full=Histidyl-tRNA synthetase;       
    1::404     6e-72  36%  415 aa  SYH_CLOP1 RecName: Full=Histidyl-tRNA synthetase;       
    1::404     8e-72  36%  415 aa  SYH_CLOPE RecName: Full=Histidyl-tRNA synthetase;       
    6::419     1e-71  41%  419 aa  SYH_THIDA RecName: Full=Histidyl-tRNA synthetase;       
    1::413     1e-71  37%  426 aa  SYH_STRA5 RecName: Full=Histidyl-tRNA synthetase;       
    1::413     1e-71  37%  426 aa  SYH_STRA3 RecName: Full=Histidyl-tRNA synthetase;       
    6::414     1e-71  41%  431 aa  SYH_NEIG1 RecName: Full=Histidyl-tRNA synthetase;       
    6::417     1e-71  40%  421 aa  SYH_COXBU RecName: Full=Histidyl-tRNA synthetase;       
    6::417     1e-71  40%  421 aa  SYH_COXBR RecName: Full=Histidyl-tRNA synthetase;       
    6::417     1e-71  40%  421 aa  SYH_COXBN RecName: Full=Histidyl-tRNA synthetase;       
    1::413     2e-71  36%  426 aa  SYH_STRPM RecName: Full=Histidyl-tRNA synthetase;       
    1::413     2e-71  37%  426 aa  SYH_STRP8 RecName: Full=Histidyl-tRNA synthetase;       
    1::413     2e-71  37%  426 aa  SYH_STRP1 RecName: Full=Histidyl-tRNA synthetase;       
    6::426     2e-71  39%  430 aa  SYH_ACIB5 RecName: Full=Histidyl-tRNA synthetase;       
    1::411     2e-71  38%  422 aa  SYH_SYNWW RecName: Full=Histidyl-tRNA synthetase;       
    1::413     2e-71  37%  426 aa  SYH_STRP6 RecName: Full=Histidyl-tRNA synthetase;       
    1::413     2e-71  37%  426 aa  SYH_STREM RecName: Full=Histidyl-tRNA synthetase;       
    1::413     3e-71  37%  426 aa  SYH_STRPZ RecName: Full=Histidyl-tRNA synthetase;       
    7::406     3e-71  38%  421 aa  SYH_FRATO RecName: Full=Histidyl-tRNA synthetase;       
   40::415     3e-71  41%  423 aa  SYH_CORDI RecName: Full=Histidyl-tRNA synthetase;       
    1::413     4e-71  36%  426 aa  SYH_STRP3 RecName: Full=Histidyl-tRNA synthetase;       
    8::400     4e-71  38%  414 aa  SYH_RICPU RecName: Full=Histidyl-tRNA synthetase;       
    3::416     4e-71  41%  434 aa  SYH_PSYCK RecName: Full=Histidyl-tRNA synthetase;       
    1::416     4e-71  35%  428 aa  SYH_LACAC RecName: Full=Histidyl-tRNA synthetase;       
    6::417     4e-71  39%  421 aa  SYH_COXB1 RecName: Full=Histidyl-tRNA synthetase;       
    6::426     4e-71  39%  430 aa  SYH_ACIBY RecName: Full=Histidyl-tRNA synthetase;       
    6::426     4e-71  39%  430 aa  SYH_ACIB3 RecName: Full=Histidyl-tRNA synthetase;       
    6::420     4e-71  38%  420 aa  SYH_ACHLI RecName: Full=Histidyl-tRNA synthetase;       
    7::406     5e-71  38%  421 aa  SYH_FRATM RecName: Full=Histidyl-tRNA synthetase;       
    1::413     7e-71  36%  426 aa  SYH_STRPG RecName: Full=Histidyl-tRNA synthetase;       
    8::400     7e-71  37%  414 aa  SYH_RICCN RecName: Full=Histidyl-tRNA synthetase;       
    7::406     7e-71  38%  421 aa  SYH_FRATW RecName: Full=Histidyl-tRNA synthetase;       
    7::406     7e-71  38%  421 aa  SYH_FRATT RecName: Full=Histidyl-tRNA synthetase;       
    7::406     7e-71  38%  421 aa  SYH_FRATN RecName: Full=Histidyl-tRNA synthetase;       
    7::406     7e-71  38%  421 aa  SYH_FRATF RecName: Full=Histidyl-tRNA synthetase;       
    7::406     7e-71  38%  421 aa  SYH_FRAT1 RecName: Full=Histidyl-tRNA synthetase;       
    6::410     7e-71  41%  429 aa  SYH_DIAST RecName: Full=Histidyl-tRNA synthetase;       
    6::410     9e-71  38%  418 aa  SYH_DEHSC RecName: Full=Histidyl-tRNA synthetase;       
    6::410     9e-71  38%  418 aa  SYH_DEHSB RecName: Full=Histidyl-tRNA synthetase;       
    8::400     1e-70  38%  414 aa  SYH_RICRO RecName: Full=Histidyl-tRNA synthetase;       
    7::393     1e-70  39%  426 aa  SYH_PROM9 RecName: Full=Histidyl-tRNA synthetase;       
    7::406     1e-70  38%  421 aa  SYH_FRATH RecName: Full=Histidyl-tRNA synthetase;       
    9::398     2e-70  39%  420 aa  SYH_GRATL RecName: Full=Histidyl-tRNA synthetase, chloroplastic;   
    6::426     2e-70  39%  430 aa  SYH_ACIAD RecName: Full=Histidyl-tRNA synthetase;       
    8::400     3e-70  37%  414 aa  SYH_RICAE RecName: Full=Histidyl-tRNA synthetase;       
    4::409     3e-70  37%  409 aa  SYH_CAMFF RecName: Full=Histidyl-tRNA synthetase;       
    4::403     3e-70  38%  408 aa  SYH_CAMC1 RecName: Full=Histidyl-tRNA synthetase;       
    6::410     3e-70  40%  429 aa  SYH_ACISJ RecName: Full=Histidyl-tRNA synthetase;       
    1::413     4e-70  37%  426 aa  SYH_STRA1 RecName: Full=Histidyl-tRNA synthetase;       
    1::414     4e-70  37%  427 aa  SYH_CHLT3 RecName: Full=Histidyl-tRNA synthetase;       
    5::415     4e-70  38%  430 aa  SYH_CHLL2 RecName: Full=Histidyl-tRNA synthetase;       
    7::414     6e-70  37%  428 aa  SYH_BUCAP RecName: Full=Histidyl-tRNA synthetase;       
    9::410     6e-70  42%  430 aa  SYH_ANAMF RecName: Full=Histidyl-tRNA synthetase;       
    6::426     6e-70  39%  430 aa  SYH_ACIBS RecName: Full=Histidyl-tRNA synthetase;       
    1::413     7e-70  37%  426 aa  SYH_STRS7 RecName: Full=Histidyl-tRNA synthetase;       
    1::413     7e-70  36%  426 aa  SYH_STREQ RecName: Full=Histidyl-tRNA synthetase;       
    5::403     1e-69  39%  403 aa  SYH_SULNB RecName: Full=Histidyl-tRNA synthetase;       
    1::413     1e-69  37%  426 aa  SYH_STRE4 RecName: Full=Histidyl-tRNA synthetase;       
    9::412     1e-69  39%  420 aa  SYH_ANAPZ RecName: Full=Histidyl-tRNA synthetase;       
    1::413     2e-69  36%  429 aa  SYH_STRMU RecName: Full=Histidyl-tRNA synthetase;       
    8::400     2e-69  38%  415 aa  SYH_RICCK RecName: Full=Histidyl-tRNA synthetase;       
    3::401     2e-69  39%  410 aa  SYH_ELUMP RecName: Full=Histidyl-tRNA synthetase;       
    9::410     2e-69  42%  430 aa  SYH_ANAMM RecName: Full=Histidyl-tRNA synthetase;       
    7::396     2e-69  40%  411 aa  SYH_ACICJ RecName: Full=Histidyl-tRNA synthetase;       
    9::360     4e-69  41%  438 aa  SYH_BLOPB RecName: Full=Histidyl-tRNA synthetase;       
    6::417     6e-69  37%  422 aa  SYH_VESOH RecName: Full=Histidyl-tRNA synthetase;       
   36::417     8e-69  40%  428 aa  SYH_CHLMU RecName: Full=Histidyl-tRNA synthetase;       
    8::413     1e-68  36%  413 aa  SYH_RICPR RecName: Full=Histidyl-tRNA synthetase;       
    8::407     2e-68  36%  412 aa  SYH_RICTY RecName: Full=Histidyl-tRNA synthetase;       
    7::393     2e-68  38%  429 aa  SYH_PROMP RecName: Full=Histidyl-tRNA synthetase;       
    5::400     3e-68  41%  422 aa  SYH_PROA2 RecName: Full=Histidyl-tRNA synthetase;       
    7::411     3e-68  37%  424 aa  SYH_FRAP2 RecName: Full=Histidyl-tRNA synthetase;       
    1::365     7e-68  39%  414 aa  SYH_UNCTG RecName: Full=Histidyl-tRNA synthetase;       
    7::393     9e-68  37%  429 aa  SYH_PROM5 RecName: Full=Histidyl-tRNA synthetase;       
   31::422     9e-68  39%  430 aa  SYH_CHLFF RecName: Full=Histidyl-tRNA synthetase;       
   12::423     1e-67  38%  433 aa  SYH_BLOFL RecName: Full=Histidyl-tRNA synthetase;       
    1::413     2e-67  36%  426 aa  SYH_STRT2 RecName: Full=Histidyl-tRNA synthetase;       
    1::413     2e-67  36%  426 aa  SYH_STRT1 RecName: Full=Histidyl-tRNA synthetase;       
    1::413     3e-67  36%  426 aa  SYH_STRTD RecName: Full=Histidyl-tRNA synthetase;       
   41::416     3e-67  39%  427 aa  SYH_MYCLE RecName: Full=Histidyl-tRNA synthetase;       
   31::422     3e-67  39%  430 aa  SYH_CHLCV RecName: Full=Histidyl-tRNA synthetase;       
   44::422     4e-67  40%  430 aa  SYH_CHLAB RecName: Full=Histidyl-tRNA synthetase;       
    3::424     1e-66  40%  442 aa  SYH_PSYA2 RecName: Full=Histidyl-tRNA synthetase;       
    7::416     1e-66  37%  424 aa  SYH_PEDPA RecName: Full=Histidyl-tRNA synthetase;       
   30::417     1e-66  39%  428 aa  SYH_CHLTB RecName: Full=Histidyl-tRNA synthetase;       
   30::417     1e-66  39%  428 aa  SYH_CHLT2 RecName: Full=Histidyl-tRNA synthetase;       
    1::422     2e-66  38%  430 aa  SYH_CHLPN RecName: Full=Histidyl-tRNA synthetase;       
    8::418     6e-66  37%  423 aa  SYH_ORITI RecName: Full=Histidyl-tRNA synthetase;       
    6::418     3e-65  37%  422 aa  SYH_RUTMC RecName: Full=Histidyl-tRNA synthetase;       
   30::417     1e-64  39%  428 aa  SYH_CHLTR RecName: Full=Histidyl-tRNA synthetase;       
   30::417     1e-64  39%  428 aa  SYH_CHLTA RecName: Full=Histidyl-tRNA synthetase;       
    1::398     3e-64  37%  406 aa  SYH_NITSB RecName: Full=Histidyl-tRNA synthetase;       
    8::412     5e-64  37%  413 aa  SYH_NEOSM RecName: Full=Histidyl-tRNA synthetase;       
    5::414     6e-64  37%  422 aa  SYH_ONYPE RecName: Full=Histidyl-tRNA synthetase;       
    4::390     2e-63  35%  403 aa  SYH_SULDN RecName: Full=Histidyl-tRNA synthetase;       
    8::418     2e-63  36%  423 aa  SYH_ORITB RecName: Full=Histidyl-tRNA synthetase;       
    3::392     2e-63  35%  410 aa  SYH_CAMHC RecName: Full=Histidyl-tRNA synthetase;       
    4::395     3e-63  37%  408 aa  SYH_CAMLR RecName: Full=Histidyl-tRNA synthetase;       
    5::415     3e-63  37%  427 aa  SYH_AYWBP RecName: Full=Histidyl-tRNA synthetase;       
    6::394     7e-63  35%  423 aa  SYH_BUCAI RecName: Full=Histidyl-tRNA synthetase;       
    1::421     1e-59  34%  423 aa  SYH_PHYMT RecName: Full=Histidyl-tRNA synthetase;       
    5::412     2e-59  35%  415 aa  SYH_PHYAS RecName: Full=Histidyl-tRNA synthetase;       
    4::396     4e-59  36%  408 aa  SYH_CAMJR RecName: Full=Histidyl-tRNA synthetase;       
    4::396     4e-59  36%  408 aa  SYH_CAMJE RecName: Full=Histidyl-tRNA synthetase;       
    6::415     2e-58  32%  425 aa  SYH_BUCBP RecName: Full=Histidyl-tRNA synthetase;       
    4::396     2e-56  35%  408 aa  SYH_CAMJJ RecName: Full=Histidyl-tRNA synthetase;       
    4::396     5e-56  35%  408 aa  SYH_CAMJD RecName: Full=Histidyl-tRNA synthetase;       
    4::396     6e-56  35%  408 aa  SYH_CAMJ8 RecName: Full=Histidyl-tRNA synthetase;       
    8::418     2e-54  34%  420 aa  SYH_UREPA RecName: Full=Histidyl-tRNA synthetase;       
    8::418     2e-54  34%  420 aa  SYH_UREP2 RecName: Full=Histidyl-tRNA synthetase;       
    1::414     3e-54  32%  426 aa  SYH_MYCPE RecName: Full=Histidyl-tRNA synthetase;       
   59::493     1e-52  37%  501 aa  SYHM_DICDI RecName: Full=Probable histidyl-tRNA synthetase,
    8::400     2e-52  33%  414 aa  SYH_MYCGE RecName: Full=Histidyl-tRNA synthetase;       
   48::453     3e-52  33%  457 aa  SYH_MESFL RecName: Full=Histidyl-tRNA synthetase;       
    8::407     6e-51  33%  414 aa  SYH_MYCPN RecName: Full=Histidyl-tRNA synthetase;       
    8::416     1e-50  33%  421 aa  SYH_UREU1 RecName: Full=Histidyl-tRNA synthetase;       
    7::417     1e-50  35%  425 aa  SYH_METTH RecName: Full=Histidyl-tRNA synthetase;       
   23::339     2e-50  35%  445 aa  SYH_MYCMO RecName: Full=Histidyl-tRNA synthetase;       
    6::397     1e-49  36%  410 aa  SYH_METLZ RecName: Full=Histidyl-tRNA synthetase;       
    7::435     5e-49  35%  436 aa  SYH_PYRKO RecName: Full=Histidyl-tRNA synthetase;       
    6::337     1e-48  34%  414 aa  SYH_MYCMS RecName: Full=Histidyl-tRNA synthetase;       
   10::413     6e-48  32%  428 aa  SYH_MYCH7 RecName: Full=Histidyl-tRNA synthetase;       
    6::337     6e-48  34%  414 aa  SYH_MYCCT RecName: Full=Histidyl-tRNA synthetase;       
    7::426     2e-47  34%  426 aa  SYH_SULTO RecName: Full=Histidyl-tRNA synthetase;       
    6::396     3e-47  36%  409 aa  SYH_METPE RecName: Full=Histidyl-tRNA synthetase;       
    7::426     3e-46  34%  426 aa  SYH_SULSO RecName: Full=Histidyl-tRNA synthetase;       
    5::421     6e-46  32%  431 aa  SYH_PYRHO RecName: Full=Histidyl-tRNA synthetase;       
    6::400     6e-46  35%  408 aa  SYH_METHJ RecName: Full=Histidyl-tRNA synthetase;       
   10::414     2e-45  30%  432 aa  SYH_WIGBR RecName: Full=Histidyl-tRNA synthetase;       
   10::413     2e-45  31%  428 aa  SYH_MYCHJ RecName: Full=Histidyl-tRNA synthetase;       
    5::430     4e-45  33%  432 aa  SYH_PYRFU RecName: Full=Histidyl-tRNA synthetase;       
    6::413     4e-45  34%  416 aa  SYH_METMP RecName: Full=Histidyl-tRNA synthetase;       
    7::426     5e-45  33%  426 aa  SYH_SULIM RecName: Full=Histidyl-tRNA synthetase;       
    7::426     5e-45  33%  426 aa  SYH_SULIL RecName: Full=Histidyl-tRNA synthetase;       
    7::426     5e-45  33%  426 aa  SYH_SULIK RecName: Full=Histidyl-tRNA synthetase;       
    7::391     5e-45  35%  409 aa  SYH_ARCFU RecName: Full=Histidyl-tRNA synthetase;       
    7::426     6e-45  33%  426 aa  SYH_SULIY RecName: Full=Histidyl-tRNA synthetase;       
    7::426     8e-45  33%  426 aa  SYH_SULIN RecName: Full=Histidyl-tRNA synthetase;       
    9::416     1e-44  32%  416 aa  SYH_METJA RecName: Full=Histidyl-tRNA synthetase;       
   10::413     2e-44  31%  428 aa  SYH_MYCH2 RecName: Full=Histidyl-tRNA synthetase;       
   34::399     2e-44  39%  410 aa  SYH_METMJ RecName: Full=Histidyl-tRNA synthetase;       
    5::421     3e-44  33%  431 aa  SYH_PYRAB RecName: Full=Histidyl-tRNA synthetase;       
    7::427     7e-44  33%  428 aa  SYH_SULAC RecName: Full=Histidyl-tRNA synthetase;       
    6::415     4e-43  33%  418 aa  SYH_META3 RecName: Full=Histidyl-tRNA synthetase;       
    1::311     8e-43  35%  498 aa  SYH_MYCS5 RecName: Full=Histidyl-tRNA synthetase;       
    6::411     1e-42  36%  421 aa  SYH_METKA RecName: Full=Histidyl-tRNA synthetase;       
    7::426     2e-42  31%  426 aa  SYH_SULIA RecName: Full=Histidyl-tRNA synthetase;       
    8::415     2e-42  33%  418 aa  SYH_METM6 RecName: Full=Histidyl-tRNA synthetase;       
    6::416     3e-42  31%  418 aa  SYH_METVS RecName: Full=Histidyl-tRNA synthetase;       
   39::415     5e-42  35%  418 aa  SYH_METM7 RecName: Full=Histidyl-tRNA synthetase;       
    6::395     6e-42  38%  410 aa  SYH_METB6 RecName: Full=Histidyl-tRNA synthetase;       
    1::394     8e-42  33%  413 aa  SYH_METAC RecName: Full=Histidyl-tRNA synthetase;       
    1::394     1e-41  35%  411 aa  SYH_METMA RecName: Full=Histidyl-tRNA synthetase;       
    1::286     4e-41  35%  420 aa  SYH_MYCPU RecName: Full=Histidyl-tRNA synthetase;       
    7::421     4e-41  30%  430 aa  SYH_METS5 RecName: Full=Histidyl-tRNA synthetase;       
   12::420     7e-41  31%  423 aa  SYH_MYCGA RecName: Full=Histidyl-tRNA synthetase;       
   39::415     3e-40  35%  418 aa  SYH_METM5 RecName: Full=Histidyl-tRNA synthetase;       
    7::427     6e-38  29%  442 aa  SYH_WOLSU RecName: Full=Histidyl-tRNA synthetase;       
    4::423     3e-37  31%  435 aa  SYH_HALMA RecName: Full=Histidyl-tRNA synthetase;       
   10::409     6e-37  33%  417 aa  SYH_THENV RecName: Full=Histidyl-tRNA synthetase;       
   10::409     7e-36  32%  421 aa  SYH_PYRIL RecName: Full=Histidyl-tRNA synthetase;       
    8::427     3e-35  28%  439 aa  SYH_LEPBL RecName: Full=Histidyl-tRNA synthetase;       
    8::427     3e-35  28%  439 aa  SYH_LEPBJ RecName: Full=Histidyl-tRNA synthetase;       
    5::421     8e-35  30%  432 aa  SYH_HALSA RecName: Full=Histidyl-tRNA synthetase;       
    5::421     8e-35  30%  432 aa  SYH_HALS3 RecName: Full=Histidine--tRNA ligase;       
   10::404     1e-34  33%  419 aa  SYH_PYRAE RecName: Full=Histidyl-tRNA synthetase;       
    8::427     2e-34  27%  439 aa  SYH_LEPIN RecName: Full=Histidyl-tRNA synthetase;       
    5::437     8e-34  29%  442 aa  SYH_RHOBA RecName: Full=Histidyl-tRNA synthetase;       
   10::412     1e-33  32%  419 aa  SYH_PYRAR RecName: Full=Histidyl-tRNA synthetase;       
    3::426     1e-33  32%  437 aa  SYH_OPITP RecName: Full=Histidyl-tRNA synthetase;       
    8::427     4e-33  27%  439 aa  SYH_LEPIC RecName: Full=Histidyl-tRNA synthetase;       
    6::426     5e-33  28%  437 aa  SYH_LEPBP RecName: Full=Histidyl-tRNA synthetase;       
    6::426     5e-33  28%  437 aa  SYH_LEPBA RecName: Full=Histidyl-tRNA synthetase;       
    9::422     7e-33  28%  426 aa  SYH_THEAC RecName: Full=Histidyl-tRNA synthetase;       
    8::460     3e-32  34%  502 aa  SYH_BRUME RecName: Full=Histidyl-tRNA synthetase;       
    8::460     3e-32  34%  502 aa  SYH_BRUMB RecName: Full=Histidyl-tRNA synthetase;       
    8::460     4e-32  34%  502 aa  SYH_BRUSU RecName: Full=Histidyl-tRNA synthetase;       
    8::460     4e-32  34%  502 aa  SYH_BRUSI RecName: Full=Histidyl-tRNA synthetase;       
    8::460     4e-32  34%  502 aa  SYH_BRUC2 RecName: Full=Histidyl-tRNA synthetase;       
    8::460     4e-32  34%  502 aa  SYH_BRUAB RecName: Full=Histidyl-tRNA synthetase;       
    8::460     4e-32  34%  502 aa  SYH_BRUA2 RecName: Full=Histidyl-tRNA synthetase;       
    8::460     4e-32  34%  502 aa  SYH_BRUA1 RecName: Full=Histidyl-tRNA synthetase;       
    2::423     8e-32  28%  442 aa  SYH_HELPJ RecName: Full=Histidyl-tRNA synthetase;       
    2::423     8e-32  28%  442 aa  SYH_HELPH RecName: Full=Histidyl-tRNA synthetase;       
    2::423     8e-32  27%  442 aa  SYH_HELAH RecName: Full=Histidyl-tRNA synthetase;       
   13::462     1e-31  32%  494 aa  SYH_PARDP RecName: Full=Histidyl-tRNA synthetase;       
    2::423     1e-31  28%  442 aa  SYH_HELP2 RecName: Full=Histidyl-tRNA synthetase;       
    9::418     1e-31  30%  425 aa  SYH2_BACSK RecName: Full=Histidyl-tRNA synthetase 2;       
   10::385     2e-31  33%  421 aa  SYH_PYRCJ RecName: Full=Histidyl-tRNA synthetase;       
    2::423     3e-31  27%  442 aa  SYH_HELPG RecName: Full=Histidyl-tRNA synthetase;       
    5::458     4e-31  31%  465 aa  SYH_STRM5 RecName: Full=Histidyl-tRNA synthetase;       
    2::423     5e-31  28%  442 aa  SYH_HELPY RecName: Full=Histidyl-tRNA synthetase;       
    5::448     7e-30  31%  464 aa  SYH_STRMK RecName: Full=Histidyl-tRNA synthetase;       
   13::431     7e-30  30%  439 aa  SYH_CLOTE RecName: Full=Histidyl-tRNA synthetase;       
    8::448     1e-29  30%  453 aa  SYH_CYTH3 RecName: Full=Histidyl-tRNA synthetase;       
   11::460     1e-29  34%  496 aa  SYH_BARBK RecName: Full=Histidyl-tRNA synthetase;       
    8::406     2e-29  29%  448 aa  SYH_TREDE RecName: Full=Histidyl-tRNA synthetase;       
   10::460     3e-29  31%  498 aa  SYH_BARQU RecName: Full=Histidyl-tRNA synthetase;       
    1::408     4e-29  29%  426 aa  SYH_THEVO RecName: Full=Histidyl-tRNA synthetase;       
    4::427     6e-29  26%  442 aa  SYH_HELHP RecName: Full=Histidyl-tRNA synthetase;       
    9::455     6e-29  28%  456 aa  SYH_GRAFK RecName: Full=Histidyl-tRNA synthetase;       
    8::460     6e-29  33%  502 aa  SYH_BRUO2 RecName: Full=Histidyl-tRNA synthetase;       
   16::457     8e-29  30%  495 aa  SYH_CAUCR RecName: Full=Histidyl-tRNA synthetase;       
    5::463     1e-28  31%  482 aa  SYH_XANC5 RecName: Full=Histidyl-tRNA synthetase;       
    2::423     1e-28  27%  442 aa  SYH_HELPS RecName: Full=Histidyl-tRNA synthetase;       
    8::447     1e-28  32%  451 aa  SYH_PARD8 RecName: Full=Histidyl-tRNA synthetase;       
   16::460     2e-28  31%  500 aa  SYH_SILST RecName: Full=Histidyl-tRNA synthetase;       
    5::423     2e-28  26%  434 aa  SYH_HALWD RecName: Full=Histidyl-tRNA synthetase;       
    5::459     4e-28  31%  478 aa  SYH_XANAC RecName: Full=Histidyl-tRNA synthetase;       
    5::459     5e-28  31%  477 aa  SYH_XANCP RecName: Full=Histidyl-tRNA synthetase;       
   12::459     5e-28  30%  495 aa  SYH_SILPO RecName: Full=Histidyl-tRNA synthetase;       
   11::463     7e-28  31%  504 aa  SYH_RHIME RecName: Full=Histidyl-tRNA synthetase;       
    5::456     1e-27  30%  466 aa  SYH_XYLFT RecName: Full=Histidyl-tRNA synthetase;       
    5::456     1e-27  30%  466 aa  SYH_XYLFM RecName: Full=Histidyl-tRNA synthetase;       
    5::456     1e-27  30%  466 aa  SYH_XYLFA RecName: Full=Histidyl-tRNA synthetase;       
    5::456     1e-27  30%  466 aa  SYH_XYLF2 RecName: Full=Histidyl-tRNA synthetase;       
   10::460     1e-27  32%  495 aa  SYH_BARHE RecName: Full=Histidyl-tRNA synthetase;       
   13::423     1e-27  29%  438 aa  HISZ_GEOSL RecName: Full=ATP phosphoribosyltransferase regulatory
   11::463     2e-27  34%  507 aa  SYH_RHILW RecName: Full=Histidyl-tRNA synthetase;       
    5::463     2e-27  30%  470 aa  SYH_XANOR RecName: Full=Histidyl-tRNA synthetase;       
    5::463     2e-27  30%  470 aa  SYH_XANOP RecName: Full=Histidyl-tRNA synthetase;       
    8::442     2e-27  29%  454 aa  SYH_PORGI RecName: Full=Histidyl-tRNA synthetase;       
    5::463     3e-27  30%  480 aa  SYH_XANOM RecName: Full=Histidyl-tRNA synthetase;       
    9::474     3e-27  32%  475 aa  SYH_FLAJ1 RecName: Full=Histidyl-tRNA synthetase;       
    5::459     5e-27  30%  477 aa  SYH_XANC8 RecName: Full=Histidyl-tRNA synthetase;       
   11::463     6e-27  34%  504 aa  SYH_AGRRK RecName: Full=Histidyl-tRNA synthetase;       
   11::463     8e-27  34%  523 aa  SYH_RHIL3 RecName: Full=Histidyl-tRNA synthetase;       
   11::462     8e-27  30%  506 aa  SYH_BRAJA RecName: Full=Histidyl-tRNA synthetase;       
   43::465     8e-27  27%  481 aa  SYHC_DICDI RecName: Full=Histidyl-tRNA synthetase, cytoplasmic;    
    5::420     1e-26  28%  432 aa  SYH_NATPD RecName: Full=Histidyl-tRNA synthetase;       
    6::415     1e-26  31%  428 aa  SYH_KORCO RecName: Full=Histidyl-tRNA synthetase;       
   12::470     1e-26  30%  505 aa  SYH_JANSC RecName: Full=Histidyl-tRNA synthetase;       
   12::462     1e-26  30%  497 aa  SYH_DINSH RecName: Full=Histidyl-tRNA synthetase;       
   42::327     1e-26  33%  418 aa  HISZ_HALOH RecName: Full=ATP phosphoribosyltransferase regulatory
    9::448     2e-26  29%  454 aa  SYH_BACTN RecName: Full=Histidyl-tRNA synthetase;       
    9::452     2e-26  27%  454 aa  SYH_BACFN RecName: Full=Histidyl-tRNA synthetase;       
  357::785     2e-26  27%  788 aa  SYH_ORYSJ RecName: Full=Histidyl-tRNA synthetase;       
    9::452     2e-26  27%  454 aa  SYH_BACFR RecName: Full=Histidyl-tRNA synthetase;       
   12::484     3e-26  29%  519 aa  SYH_ROSDO RecName: Full=Histidyl-tRNA synthetase;       
    9::448     4e-26  28%  454 aa  SYH_BACV8 RecName: Full=Histidyl-tRNA synthetase;       
    5::418     5e-26  27%  442 aa  SYH_HALLT RecName: Full=Histidyl-tRNA synthetase;       
   22::418     5e-26  32%  435 aa  SYH_AERPE RecName: Full=Histidyl-tRNA synthetase;       
    9::452     1e-25  28%  467 aa  SYH_GLOVI RecName: Full=Histidyl-tRNA synthetase;       
   11::463     2e-25  32%  507 aa  SYH_AGRT5 RecName: Full=Histidyl-tRNA synthetase;       
   12::462     3e-25  29%  494 aa  SYH_RHOS4 RecName: Full=Histidyl-tRNA synthetase;       
   12::462     4e-25  29%  494 aa  SYH_RHOSK RecName: Full=Histidyl-tRNA synthetase;       
   11::488     6e-25  31%  519 aa  SYH_RHOPB RecName: Full=Histidyl-tRNA synthetase;       
    1::416     1e-24  27%  436 aa  SYH1_BACC1 RecName: Full=Histidyl-tRNA synthetase 1;       
    1::425     3e-24  27%  425 aa  SYH1_BACHK RecName: Full=Histidyl-tRNA synthetase 1;       
    1::441     4e-24  27%  456 aa  SYH_BORGA RecName: Full=Histidyl-tRNA synthetase;       
   12::430     6e-24  29%  430 aa  SYH_CLOAB RecName: Full=Histidyl-tRNA synthetase;       
    1::425     6e-24  27%  425 aa  SYH1_BACAN RecName: Full=Histidyl-tRNA synthetase 1;       
    7::434     8e-24  26%  442 aa  SYH_TREPS RecName: Full=Histidyl-tRNA synthetase;       
    7::434     8e-24  26%  442 aa  SYH_TREPA RecName: Full=Histidyl-tRNA synthetase;       
    1::425     8e-24  26%  425 aa  SYH1_BACCZ RecName: Full=Histidyl-tRNA synthetase 1;       
    1::416     7e-23  25%  423 aa  SYH_PICTO RecName: Full=Histidyl-tRNA synthetase;       
   62::509     2e-22  29%  519 aa  SYHC_TAKRU RecName: Full=Histidyl-tRNA synthetase, cytoplasmic;    
   56::495     7e-22  28%  506 aa  SYHM_BOVIN RecName: Full=Probable histidyl-tRNA synthetase,
   42::418     1e-21  28%  431 aa  SYH_FINM2 RecName: Full=Histidyl-tRNA synthetase;       
    2::426     1e-21  27%  426 aa  SYH1_BACCR RecName: Full=Histidyl-tRNA synthetase 1;       
   13::339     2e-21  30%  399 aa  HISZ_SYMTH RecName: Full=ATP phosphoribosyltransferase regulatory
    1::426     3e-21  28%  456 aa  SYH_BORAP RecName: Full=Histidyl-tRNA synthetase;       
    6::396     4e-21  27%  404 aa  SYH_NANEQ RecName: Full=Histidyl-tRNA synthetase;       
   14::449     4e-21  26%  462 aa  SYH_ANASP RecName: Full=Histidyl-tRNA synthetase;       
   60::494     5e-21  29%  509 aa  SYHC_MOUSE RecName: Full=Histidyl-tRNA synthetase, cytoplasmic;    
    8::378     5e-21  31%  407 aa  HISZ_CYAP8 RecName: Full=ATP phosphoribosyltransferase regulatory
   14::454     6e-21  26%  462 aa  SYH_ANAVT RecName: Full=Histidyl-tRNA synthetase;       
   11::421     8e-21  26%  422 aa  HISZ_CLOBK RecName: Full=ATP phosphoribosyltransferase regulatory
   53::503     1e-20  28%  546 aa  SYH_YEAST RecName: Full=Histidyl-tRNA synthetase, mitochondrial;   
    6::434     1e-20  32%  458 aa  SYH_MICLC RecName: Full=Histidyl-tRNA synthetase;       
   13::325     1e-20  32%  394 aa  HISZ_GEOKA RecName: Full=ATP phosphoribosyltransferase regulatory
   10::459     1e-20  31%  500 aa  SYH_RHILO RecName: Full=Histidyl-tRNA synthetase;       
    9::353     1e-20  27%  391 aa  HISZ_BACP2 RecName: Full=ATP phosphoribosyltransferase regulatory
    8::385     2e-20  26%  401 aa  HISZ_DESRM RecName: Full=ATP phosphoribosyltransferase regulatory
    7::391     2e-20  30%  426 aa  SYH_TROWT RecName: Full=Probable histidyl-tRNA synthetase;       
    7::391     2e-20  30%  426 aa  SYH_TROW8 RecName: Full=Probable histidyl-tRNA synthetase;       
   13::355     2e-20  29%  392 aa  HISZ_GEOSW RecName: Full=ATP phosphoribosyltransferase regulatory
   12::474     3e-20  30%  501 aa  SYH_METSB RecName: Full=Histidyl-tRNA synthetase;       
    7::319     3e-20  29%  385 aa  HISZ_LYSSC RecName: Full=ATP phosphoribosyltransferase regulatory
    1::353     3e-20  30%  412 aa  HISZ_DEHE1 RecName: Full=ATP phosphoribosyltransferase regulatory
    1::426     4e-20  27%  456 aa  SYH_BORBZ RecName: Full=Histidyl-tRNA synthetase;       
    2::427     4e-20  27%  457 aa  SYH_BORBU RecName: Full=Histidyl-tRNA synthetase;       
   11::421     7e-20  26%  422 aa  HISZ_CLOBJ RecName: Full=ATP phosphoribosyltransferase regulatory
   39::314     1e-19  33%  389 aa  HISZ_MOOTA RecName: Full=ATP phosphoribosyltransferase regulatory
   10::409     1e-19  27%  422 aa  HISZ_CLOB6 RecName: Full=ATP phosphoribosyltransferase regulatory
   61::495     2e-19  28%  506 aa  SYHM_PONAB RecName: Full=Probable histidyl-tRNA synthetase,
   11::421     2e-19  26%  422 aa  HISZ_CLOBL RecName: Full=ATP phosphoribosyltransferase regulatory
    9::351     2e-19  28%  391 aa  HISZ_BACLD RecName: Full=ATP phosphoribosyltransferase regulatory
   62::535     2e-19  28%  538 aa  SYH_SCHPO RecName: Full=Histidyl-tRNA synthetase;       
   11::327     2e-19  28%  420 aa  HISZ_BACC2 RecName: Full=ATP phosphoribosyltransferase regulatory
    7::321     3e-19  29%  379 aa  HISZ_THETN RecName: Full=ATP phosphoribosyltransferase regulatory
   61::493     3e-19  28%  506 aa  SYHM_HUMAN RecName: Full=Probable histidyl-tRNA synthetase,
   11::327     3e-19  28%  420 aa  HISZ_BACCR RecName: Full=ATP phosphoribosyltransferase regulatory
   11::327     3e-19  28%  420 aa  HISZ_BACC4 RecName: Full=ATP phosphoribosyltransferase regulatory
   13::325     5e-19  31%  394 aa  HISZ_GEOTN RecName: Full=ATP phosphoribosyltransferase regulatory
    7::136     6e-19  37%  138 aa  SYH_SULSH RecName: Full=Putative histidyl-tRNA synthetase;       
    8::391     6e-19  30%  401 aa  HISZ_CYAP4 RecName: Full=ATP phosphoribosyltransferase regulatory
   11::327     6e-19  30%  420 aa  HISZ_BACC3 RecName: Full=ATP phosphoribosyltransferase regulatory
   11::327     6e-19  30%  420 aa  HISZ_BACC0 RecName: Full=ATP phosphoribosyltransferase regulatory
   11::327     6e-19  30%  420 aa  HISZ_BACAH RecName: Full=ATP phosphoribosyltransferase regulatory
   11::327     8e-19  30%  420 aa  HISZ_BACHK RecName: Full=ATP phosphoribosyltransferase regulatory
   11::327     8e-19  30%  420 aa  HISZ_BACCZ RecName: Full=ATP phosphoribosyltransferase regulatory
   11::327     1e-18  30%  420 aa  HISZ_BACCQ RecName: Full=ATP phosphoribosyltransferase regulatory
   11::327     1e-18  30%  420 aa  HISZ_BACC7 RecName: Full=ATP phosphoribosyltransferase regulatory
   11::358     1e-18  28%  418 aa  HISZ_CLOTH RecName: Full=ATP phosphoribosyltransferase regulatory
   11::327     1e-18  29%  420 aa  HISZ_BACWK RecName: Full=ATP phosphoribosyltransferase regulatory
   34::319     2e-18  31%  380 aa  HISZ_THEP3 RecName: Full=ATP phosphoribosyltransferase regulatory
   11::327     2e-18  30%  420 aa  HISZ_BACAN RecName: Full=ATP phosphoribosyltransferase regulatory
   11::327     2e-18  30%  420 aa  HISZ_BACAC RecName: Full=ATP phosphoribosyltransferase regulatory
   11::327     2e-18  30%  420 aa  HISZ_BACAA RecName: Full=ATP phosphoribosyltransferase regulatory
   66::510     2e-18  27%  521 aa  SYH_CAEEL RecName: Full=Histidyl-tRNA synthetase;       
    8::359     2e-18  31%  403 aa  HISZ_CYAA5 RecName: Full=ATP phosphoribosyltransferase regulatory
   34::319     3e-18  31%  380 aa  HISZ_THEPX RecName: Full=ATP phosphoribosyltransferase regulatory
    8::447     4e-18  26%  458 aa  SYH_AZOPC RecName: Full=Histidyl-tRNA synthetase;       
    1::409     4e-18  29%  413 aa  HISZ_RUBXD RecName: Full=ATP phosphoribosyltransferase regulatory
   11::382     4e-18  26%  419 aa  HISZ_CLOCE RecName: Full=ATP phosphoribosyltransferase regulatory
    9::354     4e-18  27%  390 aa  HISZ_BACA2 RecName: Full=ATP phosphoribosyltransferase regulatory
    6::440     1e-17  29%  466 aa  SYH_BIFA0 RecName: Full=Histidyl-tRNA synthetase;       
   60::478     1e-17  30%  509 aa  SYHC_HUMAN RecName: Full=Histidyl-tRNA synthetase, cytoplasmic;    
   60::478     1e-17  30%  509 aa  SYHC_BOVIN RecName: Full=Histidyl-tRNA synthetase, cytoplasmic;    
    8::399     1e-17  31%  408 aa  HISZ_CYAP7 RecName: Full=ATP phosphoribosyltransferase regulatory
   60::478     2e-17  30%  509 aa  SYHC_PONAB RecName: Full=Histidyl-tRNA synthetase, cytoplasmic;    
   11::342     2e-17  25%  396 aa  HISZ_ALKMQ RecName: Full=ATP phosphoribosyltransferase regulatory
   11::327     2e-17  29%  420 aa  HISZ_BACC1 RecName: Full=ATP phosphoribosyltransferase regulatory
    1::353     3e-17  28%  412 aa  HISZ_DEHSC RecName: Full=ATP phosphoribosyltransferase regulatory
    9::375     4e-17  30%  383 aa  HISZ_DESHD RecName: Full=ATP phosphoribosyltransferase regulatory
    1::353     6e-17  28%  412 aa  HISZ_DEHSB RecName: Full=ATP phosphoribosyltransferase regulatory
   60::494     1e-16  29%  505 aa  SYHM_MOUSE RecName: Full=Probable histidyl-tRNA synthetase,
   13::362     1e-16  29%  434 aa  HISZ_GEOMG RecName: Full=ATP phosphoribosyltransferase regulatory
    9::321     1e-16  28%  391 aa  HISZ_BACSU RecName: Full=ATP phosphoribosyltransferase regulatory
   12::356     2e-16  29%  393 aa  HISZ_BACSK RecName: Full=ATP phosphoribosyltransferase regulatory
   77::432     6e-16  33%  454 aa  SYH_PROAC RecName: Full=Histidyl-tRNA synthetase;       
    1::325     6e-16  29%  392 aa  HISZ_PROMM RecName: Full=ATP phosphoribosyltransferase regulatory
    1::356     6e-16  26%  404 aa  HISZ_ANASP RecName: Full=ATP phosphoribosyltransferase regulatory
   37::313     8e-16  29%  405 aa  HISZ_OCEIH RecName: Full=ATP phosphoribosyltransferase regulatory
   35::364     8e-16  29%  434 aa  HISZ_GEOSF RecName: Full=ATP phosphoribosyltransferase regulatory
  108::429     1e-15  29%  438 aa  SYH_THEFY RecName: Full=Histidyl-tRNA synthetase;       
   14::451     1e-15  26%  470 aa  SYH_NOSP7 RecName: Full=Histidyl-tRNA synthetase;       
    1::356     2e-15  26%  404 aa  HISZ_ANAVT RecName: Full=ATP phosphoribosyltransferase regulatory
   39::337     4e-15  28%  434 aa  HISZ_SYNJB RecName: Full=ATP phosphoribosyltransferase regulatory
    6::446     7e-15  28%  466 aa  SYH_BIFLI RecName: Full=Histidyl-tRNA synthetase;       
    8::310     1e-14  29%  408 aa  HISZ_THEEB RecName: Full=ATP phosphoribosyltransferase regulatory
    8::378     1e-14  30%  405 aa  HISZ_MICAN RecName: Full=ATP phosphoribosyltransferase regulatory
   43::440     2e-14  29%  465 aa  SYH_PELUB RecName: Full=Histidyl-tRNA synthetase;       
   11::362     2e-14  27%  391 aa  HISZ_CLOK5 RecName: Full=ATP phosphoribosyltransferase regulatory
    9::307     3e-14  29%  410 aa  HISZ_SYNJA RecName: Full=ATP phosphoribosyltransferase regulatory
   11::142     4e-14  33%  523 aa  SYH_RHOPA RecName: Full=Histidyl-tRNA synthetase;       
    6::446     4e-14  28%  466 aa  SYH_BIFLO RecName: Full=Histidyl-tRNA synthetase;       
    1::290     4e-14  31%  383 aa  HISZ_AQUAE RecName: Full=ATP phosphoribosyltransferase regulatory
   12::356     2e-13  28%  397 aa  HISZ_BACHD RecName: Full=ATP phosphoribosyltransferase regulatory
    7::380     2e-13  27%  392 aa  HISZ_GLOVI RecName: Full=ATP phosphoribosyltransferase regulatory
   11::145     4e-13  34%  509 aa  SYH_RHOPT RecName: Full=Histidyl-tRNA synthetase;       
   11::326     4e-13  28%  421 aa  HISZ_CLONN RecName: Full=ATP phosphoribosyltransferase regulatory
   40::319     6e-13  30%  382 aa  HISZ_ACISJ RecName: Full=ATP phosphoribosyltransferase regulatory
    8::377     8e-13  29%  404 aa  HISZ_SYNP2 RecName: Full=ATP phosphoribosyltransferase regulatory
    1::356     1e-12  25%  403 aa  HISZ_NOSP7 RecName: Full=ATP phosphoribosyltransferase regulatory
   40::319     1e-12  30%  382 aa  HISZ_DIAST RecName: Full=ATP phosphoribosyltransferase regulatory
    8::352     2e-12  26%  420 aa  HISZ_SYNP6 RecName: Full=ATP phosphoribosyltransferase regulatory
    8::352     2e-12  26%  420 aa  HISZ_SYNE7 RecName: Full=ATP phosphoribosyltransferase regulatory
    9::312     2e-12  29%  383 aa  HISZ_LACPL RecName: Full=ATP phosphoribosyltransferase regulatory
   11::327     3e-12  24%  407 aa  HISZ_CLOAB RecName: Full=ATP phosphoribosyltransferase regulatory
   19::321     2e-11  23%  328 aa  HISZ_LACLA RecName: Full=ATP phosphoribosyltransferase regulatory
    1::325     5e-11  27%  392 aa  HISZ_PROM3 RecName: Full=ATP phosphoribosyltransferase regulatory
    8::318     8e-11  27%  391 aa  HISZ_PROMA RecName: Full=ATP phosphoribosyltransferase regulatory
   25::315     8e-11  28%  318 aa  HISZ_LACLS RecName: Full=ATP phosphoribosyltransferase regulatory
   14::421     1e-10  27%  428 aa  HISZ_PELCD RecName: Full=ATP phosphoribosyltransferase regulatory
    9::314     1e-10  25%  326 aa  HISZ_STRTD RecName: Full=ATP phosphoribosyltransferase regulatory
   60::477     2e-10  27%  508 aa  SYHC_MESAU RecName: Full=Histidyl-tRNA synthetase, cytoplasmic;    
    9::315     2e-10  31%  382 aa  HISZ_LACC3 RecName: Full=ATP phosphoribosyltransferase regulatory
    8::375     2e-10  29%  401 aa  HISZ_SYNY3 RecName: Full=ATP phosphoribosyltransferase regulatory
    1::345     3e-10  25%  393 aa  HISZ_SYNR3 RecName: Full=ATP phosphoribosyltransferase regulatory
    9::300     7e-10  29%  384 aa  HISZ_RHORT RecName: Full=ATP phosphoribosyltransferase regulatory
    9::315     7e-10  29%  382 aa  HISZ_LACCB RecName: Full=ATP phosphoribosyltransferase regulatory
    9::325     1e-09  25%  329 aa  HISZ_STRSV RecName: Full=ATP phosphoribosyltransferase regulatory
   24::315     1e-09  27%  318 aa  HISZ_LACLM RecName: Full=ATP phosphoribosyltransferase regulatory
   40::313     2e-09  30%  382 aa  HISZ_VEREI RecName: Full=ATP phosphoribosyltransferase regulatory
   10::342     2e-09  24%  392 aa  HISZ_LISMF RecName: Full=ATP phosphoribosyltransferase regulatory
   10::342     2e-09  24%  392 aa  HISZ_LISMC RecName: Full=ATP phosphoribosyltransferase regulatory
    9::358     3e-09  36%  431 aa  SYH_LEIXX RecName: Full=Histidyl-tRNA synthetase;       
   10::310     3e-09  25%  393 aa  HISZ_LISMO RecName: Full=ATP phosphoribosyltransferase regulatory
   12::311     4e-09  27%  382 aa  HISZ_RHOFD RecName: Full=ATP phosphoribosyltransferase regulatory
   23::374     6e-09  26%  395 aa  HISZ_AZOVD RecName: Full=ATP phosphoribosyltransferase regulatory
   10::342     7e-09  24%  392 aa  HISZ_LISMH RecName: Full=ATP phosphoribosyltransferase regulatory
    1::318     9e-09  25%  392 aa  HISZ_SYNS9 RecName: Full=ATP phosphoribosyltransferase regulatory
    9::325     9e-09  26%  329 aa  HISZ_STRGC RecName: Full=ATP phosphoribosyltransferase regulatory
   11::329     1e-08  27%  391 aa  HISZ_NITEU RecName: Full=ATP phosphoribosyltransferase regulatory
   10::342     1e-08  24%  393 aa  HISZ_LISW6 RecName: Full=ATP phosphoribosyltransferase regulatory
   43::371     3e-08  25%  395 aa  HISZ_PSEMY RecName: Full=ATP phosphoribosyltransferase regulatory
   14::370     3e-08  31%  376 aa  HISZ_OCHA4 RecName: Full=ATP phosphoribosyltransferase regulatory
   10::342     3e-08  24%  392 aa  HISZ_LISIN RecName: Full=ATP phosphoribosyltransferase regulatory
   38::319     4e-08  29%  387 aa  HISZ_POLNS RecName: Full=ATP phosphoribosyltransferase regulatory
  311::366     4e-08  51%  375 aa  HISZ_AGRT5 RecName: Full=ATP phosphoribosyltransferase regulatory
   40::313     5e-08  27%  382 aa  HISZ_DELAS RecName: Full=ATP phosphoribosyltransferase regulatory
  314::376     6e-08  45%  377 aa  HISZ_SINMW RecName: Full=ATP phosphoribosyltransferase regulatory
  308::371     6e-08  44%  373 aa  HISZ_RHILO RecName: Full=ATP phosphoribosyltransferase regulatory
    9::161     6e-08  26%  349 aa  HISZ_ANASK RecName: Full=ATP phosphoribosyltransferase regulatory
    9::161     6e-08  26%  349 aa  HISZ_ANADE RecName: Full=ATP phosphoribosyltransferase regulatory
    9::161     6e-08  26%  349 aa  HISZ_ANAD2 RecName: Full=ATP phosphoribosyltransferase regulatory
  311::366     8e-08  49%  373 aa  HISZ_RHIE6 RecName: Full=ATP phosphoribosyltransferase regulatory
  263::366     8e-08  37%  373 aa  HISZ_MESSB RecName: Full=ATP phosphoribosyltransferase regulatory
    9::330     8e-08  27%  383 aa  HISZ_DESHY RecName: Full=ATP phosphoribosyltransferase regulatory
  311::366     1e-07  49%  373 aa  HISZ_RHIEC RecName: Full=ATP phosphoribosyltransferase regulatory
   13::166     1e-07  25%  379 aa  HISZ_MAGSA RecName: Full=ATP phosphoribosyltransferase regulatory
  311::366     1e-07  49%  373 aa  HISZ_RHILW RecName: Full=ATP phosphoribosyltransferase regulatory
  311::366     1e-07  49%  373 aa  HISZ_RHIL3 RecName: Full=ATP phosphoribosyltransferase regulatory
    1::318     2e-07  26%  392 aa  HISZ_SYNSC RecName: Full=ATP phosphoribosyltransferase regulatory
   16::169     2e-07  27%  379 aa  HISZ_GLUOX RecName: Full=ATP phosphoribosyltransferase regulatory
   34::372     2e-07  29%  401 aa  HISZ_ALHEH RecName: Full=ATP phosphoribosyltransferase regulatory
  314::375     3e-07  44%  379 aa  HISZ_RHIME RecName: Full=ATP phosphoribosyltransferase regulatory
  311::372     3e-07  48%  372 aa  HISZ_AGRRK RecName: Full=ATP phosphoribosyltransferase regulatory
   40::320     5e-07  28%  390 aa  HISZ_NITEC RecName: Full=ATP phosphoribosyltransferase regulatory
  220::334     9e-07  33%  416 aa  PYLS_METBU RecName: Full=Pyrrolysyl-tRNA synthetase;       
   11::319     9e-07  24%  387 aa  HISZ_METFK RecName: Full=ATP phosphoribosyltransferase regulatory
    9::319     9e-07  22%  386 aa  HISZ_LACF3 RecName: Full=ATP phosphoribosyltransferase regulatory
  316::378     9e-07  43%  378 aa  HISZ_BRUSU RecName: Full=ATP phosphoribosyltransferase regulatory
  314::376     9e-07  43%  376 aa  HISZ_BRUSI RecName: Full=ATP phosphoribosyltransferase regulatory
  314::376     9e-07  43%  376 aa  HISZ_BRUO2 RecName: Full=ATP phosphoribosyltransferase regulatory
  316::378     9e-07  43%  378 aa  HISZ_BRUME RecName: Full=ATP phosphoribosyltransferase regulatory
  314::376     9e-07  43%  376 aa  HISZ_BRUMB RecName: Full=ATP phosphoribosyltransferase regulatory
  314::376     9e-07  43%  376 aa  HISZ_BRUC2 RecName: Full=ATP phosphoribosyltransferase regulatory
  316::378     9e-07  43%  378 aa  HISZ_BRUAB RecName: Full=ATP phosphoribosyltransferase regulatory
  316::378     9e-07  43%  378 aa  HISZ_BRUA2 RecName: Full=ATP phosphoribosyltransferase regulatory
  314::376     9e-07  43%  376 aa  HISZ_BRUA1 RecName: Full=ATP phosphoribosyltransferase regulatory
  311::369     9e-07  47%  372 aa  HISZ_AGRVS RecName: Full=ATP phosphoribosyltransferase regulatory
   14::321     2e-06  28%  397 aa  HISZ_NITOC RecName: Full=ATP phosphoribosyltransferase regulatory
   48::179     2e-06  27%  563 aa  SYP_PERMH RecName: Full=Prolyl-tRNA synthetase;       
   20::316     2e-06  27%  321 aa  HISZ_THIDA RecName: Full=ATP phosphoribosyltransferase regulatory
    9::314     2e-06  23%  320 aa  HISZ_STRMU RecName: Full=ATP phosphoribosyltransferase regulatory
  314::367     2e-06  47%  379 aa  HISZ_RHISN RecName: Full=ATP phosphoribosyltransferase regulatory
    1::318     4e-06  24%  391 aa  HISZ_PROM1 RecName: Full=ATP phosphoribosyltransferase regulatory
   47::199     7e-06  30%  575 aa  SYP_DESVM RecName: Full=Prolyl-tRNA synthetase;       
  223::344     7e-06  32%  419 aa  PYLS_METBA RecName: Full=Pyrrolysyl-tRNA synthetase;       
   59::323     7e-06  28%  382 aa  HISZ_BURM1 RecName: Full=ATP phosphoribosyltransferase regulatory
   59::323     1e-05  28%  382 aa  HISZ_BURA4 RecName: Full=ATP phosphoribosyltransferase regulatory
    1::318     1e-05  23%  391 aa  HISZ_PROMT RecName: Full=ATP phosphoribosyltransferase regulatory
  279::454     2e-05  31%  633 aa  SYT_WOLPP RecName: Full=Threonyl-tRNA synthetase;       
  247::361     2e-05  30%  443 aa  PYLS_METAC RecName: Full=Pyrrolysyl-tRNA synthetase;       
   12::314     2e-05  26%  400 aa  HISZ_HAHCH RecName: Full=ATP phosphoribosyltransferase regulatory
  225::317     3e-05  32%  419 aa  PYLS_METBF RecName: Full=Pyrrolysyl-tRNA synthetase;       
   48::173     4e-05  29%  567 aa  SYP_FUSNN RecName: Full=Prolyl-tRNA synthetase;       
   59::323     5e-05  27%  382 aa  HISZ_BURCM RecName: Full=ATP phosphoribosyltransferase regulatory
   47::178     6e-05  24%  581 aa  SYP_VEREI RecName: Full=Prolyl-tRNA synthetase;       
    1::112     1e-04  28%  392 aa  HISZ_SYNPX RecName: Full=ATP phosphoribosyltransferase regulatory
    1::113     1e-04  24%  392 aa  HISZ_PROM4 RecName: Full=ATP phosphoribosyltransferase regulatory
  279::423     1e-04  28%  633 aa  SYT_WOLWR RecName: Full=Threonyl-tRNA synthetase;       
   47::155     1e-04  25%  572 aa  SYP_HAEIG RecName: Full=Prolyl-tRNA synthetase;       
   47::195     2e-04  27%  574 aa  SYP_DESDG RecName: Full=Prolyl-tRNA synthetase;       
   31::233     2e-04  26%  426 aa  SYP_ANAPZ RecName: Full=Prolyl-tRNA synthetase;       
   48::175     2e-04  31%  425 aa  SYP_ANAMM RecName: Full=Prolyl-tRNA synthetase;       
  258::372     2e-04  28%  454 aa  PYLS_METMA RecName: Full=Pyrrolysyl-tRNA synthetase;       
   16::138     2e-04  28%  386 aa  HISZ_RHOCS RecName: Full=ATP phosphoribosyltransferase regulatory
  279::423     3e-04  28%  633 aa  SYT_WOLPM RecName: Full=Threonyl-tRNA synthetase;       
   47::195     3e-04  27%  575 aa  SYP_DESMR RecName: Full=Prolyl-tRNA synthetase;       
   48::154     4e-04  34%  593 aa  SYP_SYNSC RecName: Full=Prolyl-tRNA synthetase;       
   48::154     4e-04  29%  600 aa  SYP_SYNR3 RecName: Full=Prolyl-tRNA synthetase;       
   51::180     4e-04  31%  593 aa  SYP_SYNPX RecName: Full=Prolyl-tRNA synthetase;       
   47::155     4e-04  25%  572 aa  SYP_HAEIE RecName: Full=Prolyl-tRNA synthetase;       
  282::387     4e-04  28%  478 aa  PYLS_METTE RecName: Full=Pyrrolysyl-tRNA synthetase;       
  252::370     4e-04  27%  384 aa  HISZ_DECAR RecName: Full=ATP phosphoribosyltransferase regulatory
  543::645     5e-04  26%  657 aa  SYT_PROA2 RecName: Full=Threonyl-tRNA synthetase;       
   51::154     5e-04  35%  593 aa  SYP_SYNS9 RecName: Full=Prolyl-tRNA synthetase;       
   48::172     5e-04  27%  566 aa  SYP_STAS1 RecName: Full=Prolyl-tRNA synthetase;       
   48::151     5e-04  27%  575 aa  SYP_HELMI RecName: Full=Prolyl-tRNA synthetase;       
   38::178     5e-04  26%  570 aa  SYP_AQUAE RecName: Full=Prolyl-tRNA synthetase;       
  274::420     7e-04  29%  635 aa  SYT_BURTA RecName: Full=Threonyl-tRNA synthetase;       
   48::154     7e-04  33%  598 aa  SYP_SYNS3 RecName: Full=Prolyl-tRNA synthetase;       
   47::151     7e-04  26%  571 aa  SYP_PSEF5 RecName: Full=Prolyl-tRNA synthetase;       
   47::172     7e-04  27%  571 aa  SYP_PSEA6 RecName: Full=Prolyl-tRNA synthetase;       
   12::361     7e-04  23%  388 aa  HISZ_ACIBY RecName: Full=ATP phosphoribosyltransferase regulatory
   12::361     7e-04  24%  388 aa  HISZ_ACIBS RecName: Full=ATP phosphoribosyltransferase regulatory
   12::361     7e-04  23%  388 aa  HISZ_ACIBC RecName: Full=ATP phosphoribosyltransferase regulatory
   12::361     7e-04  23%  388 aa  HISZ_ACIB5 RecName: Full=ATP phosphoribosyltransferase regulatory
   12::361     7e-04  23%  388 aa  HISZ_ACIB3 RecName: Full=ATP phosphoribosyltransferase regulatory
  372::478     7e-04  25%  701 aa  ATKB1_ANASP RecName: Full=Potassium-transporting ATPase B chain 1; 
  279::419     0.001  28%  632 aa  SYT_WOLTR RecName: Full=Threonyl-tRNA synthetase;       
  250::402     0.001  28%  518 aa  SYSM_MOUSE RecName: Full=Seryl-tRNA synthetase, mitochondrial;     
   38::151     0.001  27%  580 aa  SYP_RHOFD RecName: Full=Prolyl-tRNA synthetase;       
   48::158     0.001  35%  600 aa  SYP_PROM4 RecName: Full=Prolyl-tRNA synthetase;       
  183::323     0.001  35%  382 aa  HISZ_BURCJ RecName: Full=ATP phosphoribosyltransferase regulatory
    1::421

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTARAVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAATDIVRKEMFTFQD
SYH_THET8       MTARAVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAATDIVRKEMFTFQD
SYH_THET2       MTARAVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAATDIVRKEMFTFQD
SYH_DEIRA       MAIQRPKGTNDLLPQRAAAHEWLIAQAREVLERAGAQRIDTPMFEEAELVKRGVGGSTDIVRKEMFTFGD
SYH_DEIDV       -------------------------TARRVLERAGAQFTDTPLFEEAELVQRGVGGSTDIVRKEMFTFGD
SYH_DEIGD       -------------------------TARRVLERAGAQFIATPLFEEAELVRRGVGGSTDIVRKEMFTFGD
SYH_HALOH       MDVKAPRGTNDILPPVSLKWQYIEDTARRIFQMYNYKEIRTPIFEYTELFQRGIGETTDIVEKEMYTFED
SYH_CYAP4       ---QASRGTRDILPEEIVYWQRVEAMARQILQRAAYQEIRTPMFEQTALFERGIGEATDIVGKEMYTFLD
SYH_SYNP2       -TIQALRGTKDIFAPEIAYWQQVEAVVRDCLGRAMYQEIRTPIFEQTSLFERGIGEATDVVSKEMYSFTD
SYH_THESQ       MKYRRIKGTNDIFGEEIWYWRYVEETFRNVCESAGIEEIRTPIFEQTELFVRSVGEESDIVQKEMYTFQD
SYH_THEMA       MKYRRIKGTNDIFGEEIWYWRYVEETFRNVCESAGIEEIRTPIFEQTELFVRSVGEESDIVQKEMYTFQD
SYH_SYNJA       ---QAVRGTRDILPQEVRLWQQVEASAREILGRANYQEIRTPILELTELFARSIGSATDVVGKEMYSFST
SYH_THEEB       MGLQAPRGTRDILPAERVYWQYLETIARQILDRAAYREICTPIFEQTPLFERGIGEATDIVSKEMYTFRD
SYH_SOLUE       ---KAVKGTRDLLPPSTEVWNRVEQVARAIFRAYNYHEIRTPIFEETQLFSRGVGTETDIVTKEMYTFED
SYH_GEOSW       MAFQIPRGTQDILPGEVEKWQYVEKIARDICKRYNYHEIRTPIFEHTELFLRGVGDTTDIVQKEMYTFED
SYH_RUBXD       MSYRRPKGTYDVYPGDAARQERLYDAARDLFRRYGYAEVRTPVFEEAELFVRSTGETSDIVRKEMFVFRD
SYH_DESHY       MAIQRPKGTQDLLPGVVEQWQDLEEQIRKICREYGYQEIRTPIFEATELFQRGVGETTDIVNKEMYTFLD
SYH_DESHD       MAIQRPKGTQDLLPGVVEQWQDLEEQIRKICREYGYQEIRTPIFEATELFQRGVGETTDIVNKEMYTFLD
SYH_ANOFW       MSFQIPRGTQDILPEQAAKWQYIEHIARELCRRYNYQEIRTPIFEHTELFLRGVGDTTDIVQKEMYTFED
SYH_GEOKA       MAFQIPRGTQDVLPGDSEKWQYVEHIARSLCSRYGYQEIRTPIFEHTELFLRGVGDTTDIVQKEMYTFED
SYH_DESRM       ------RGTNDILPGEVEKWQFLEQLTRQVCREYGYGEIRTPIFEHTELFARGVGETTDIVEKEMYTFTD
SYH_PELTS       ------RGTNDILPGEVEKWQYIESQFRRICREYGYGEIRTPVFEHTELFLRGVGDTTDIVEKEMYTFTD
SYH_MICAN       ---QAIRGTKDILPAEVGYWQWLEETASRILGTALYQEIRTPIFEQTQLFERGIGEATDVVGKEMYTFLD
SYH1_BACSK      MSIQLPRGTQDILPDDAAIWQYIEQVAKETCETYHYQEIRTPIFEHTEIFSRGVGDTTDIVQKEMYTFSD
SYH_LISIN       MDLQLPRGTRDILPEEVSKWHFLESAFNKVCENYQYEEIRTPIFEHTELFERGVGDSTDIVSKEMYTFLD
SYH_BACA2       ------RGTQDILPGESDRWQFVEQIMRETCRTYQYKEIRTPIFEHTELFARGVGESTDIVQKEMYTFED
SYH_SYNE7       ---QALRGTRDILPPETQVWQWIEQTAREILGRAAVQEVRTPIFEQTALFERGIGEATDVVGKEMYSFRD
SYH_BACSU       ------RGTQDILPGESDRWQFVEQIMRDTCRTYQYKEIRTPIFEHTELFARGVGESTDIVQKEMYTFED
SYH_BACCN       MSIQIPRGTQDILPGSVELWQYIEGQAREICRRYNYKEIRTPIFEHTELFLRGVGDTTDIVQKEMYTFQD
SYH_LISMF       MDLQLPRGTRDILPEEVSKWHFLETEFKKVCENYQYEEIRTPVFEHTELFERGVGDSTDIVSKEMYTFQD
SYH_LISMO       MDLQLPRGTRDILPEEVSKWHFLETEFKNVCENYQYEEIRTPVFEHTELFERGVGDSTDIVSKEMYTFQD
SYH_CYAP7       ---QALRGTRDILPHEVGYWQQVERVAAEILSRALYLEIRPPIFEQTALFERGIGEGTDVVGKEMYTFKD
SYH_ACIBL       ---KAVRGTRDLLPPDTELWNRVEATVRDVFQRYNFHEIRTPIFEDTALFARGVGEETDIVSKEMFTWED
SYH_SYNY3       ---QAIRGTRDILPPETNYWQWVEAIAKSILDRALYQEIRTPIFEQTSLFERGIGEATDVVGKEMYSFTD
SYH_BACLD       ------RGTQDILPGESERWQYVEKIARETCHAYQYKEIRTPIFEHTELFSRGVGESTDIVQKEMYTFAD
SYH_FERNB       -----IKGTEDLYGDEMKYWYWIEKKAKDLAIRYGYGEIRTPIFEETKLFIRSVGQDTDIVQKEMYTFED
SYH_SYNP6       ---QALRGTRDILPPETQVWQWIEQTAREILGRAAVQEVRTPIFEQTALFERGIGEATDVVGKEMYSFRD
SYH_ACAM1       ------RGTRDILPDEVIYWQYVEATARQLLHQAAYRELRTPIFEQTNLFERGIGEATDVVGKEMYTFQD
SYH_THEAB       ---KRIKGTEDIFGDDIKYWYYIENVVKETVRLYGYSEIRTPIFEATELFIRSVGEETDIVQKEMYTFED
SYH_THEP3       MLTKAPRGTKDILPSESYKWQYIEGLIREICDVYGFKEIRTPGFEHTELFLRGVGESTDIVRKEMYTFTD
SYH_MACCJ       ------RGTQDILPAETAKWRYVESKLHNIAANYNYKEIRTPMFESTDLFARGVGGSTDIVQKEMYTFKD
SYH_THEM4       ---KKIKGTDDIYGEDMKYWYFIENTAREITRLYGYSEIRTPIFEQTELFVRSVGEETDIVQKEMYTFKD
SYH_CYAA5       -TIQTLPGTRDILPEEIGYWQYVETVATQILSRAMYYEIRPPIFEQTSLFERGIGEATDVVGKEMYTFSD
SYH2_BACC1      MSIQIPRGTQDILPGTVELWQYIEGQAREICRRYNYKEIRTPIFEHTELFLRGVGDTTDIVQKEMYSFQD
SYH_THEPX       MLTKAPRGTKDILPSESYKWQYIEGLIREICDVYGFKEIRTPGFEHTELFLRGVGESTDIVRKEMYTFTD
SYH2_BACHK      MSIQIPRGTQDILPGTVELWQYIEGQAREICRRYNYKEIRTPIFEHTELFLRGVGDTTDIVQKEMYSFQD
SYH2_BACCZ      MSIQIPRGTQDILPGTVELWQYIEGQAREICRRYNYKEIRTPIFEHTELFLRGVGDTTDIVQKEMYSFQD
SYH2_BACCR      MSIQIPRGTQDILPGTVELWQYIEGQAREICRRYNYKEIRTPIFEHTELFLRGVGDTTDIVQKEMYSFQD
SYH2_BACAN      MSIQIPRGTQDILPGTVELWQYIEGQAREICRRYNYKEIRTPIFEHTELFLRGVGDTTDIVQKEMYSFQD
SYH_ERWCT       ---QAIRGMNDYLPAETALWQRIENSLKQVLSGYGYNEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFDD
SYH_CORK4       ----APKGVPDYVPPNSHEFNAVRSTFHHCATVAGYEPVELPIFEDTSLFARGVGESSDVVTKEMYTFED
SYH_STAES       ------RGTQDILPQDSAKWRYIENRLHTLMELYNYKEIRTPIFESTELFARGVGDSTDVVQKEMYTFKD
SYH_STAEQ       ------RGTQDILPQDSAKWRYIENRLHTLMELYNYKEIRTPIFESTELFARGVGDSTDVVQKEMYTFKD
SYH_PECCP       ---QAIRGMNDYLPAETALWQRIENSLKQVLSGYGYNEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFDD
SYH_CYAP8       -TIQTLPGTRDILPEEIGYWQYVETITTEILSRAMYQEIRAPIFEQTSLFERGIGEATDVVGKEMYTFKD
SYH_NATTJ       MLTKAPRGTKDILPQESSKWHALEETAKKISNLYGFNEVRFPIFEHTELFTRSVGETSDIVSKEMYTFTD
SYH_CARHZ       MLTQKPKGTNDLFPPEVFLWEEIERKFREVCRRFGYQEIRTPIFEHTELFERGVGETTDIVEKEMYTFLD
SYH_ALKOO       MLTNGPRGTKDVLPSEAYKWHYVEGVFKEVAKRFGFEEIRTPVFEHTELFERGVGDTTDVVEKEMYTFLD
SYH_ENTFA       MSYQKPKGTNDILPGTSEKWQFVEETARLIFKDYQYQEIRTPIFEHYEVISRSVGDTTDIVSKEMYDFYD
SYH_DESDG       ---KKIKGFADLFSPESDVFTFMENTARDVFSSYGYGELRTPILERTELFCRSIGTETDVVQKEMYTFPD
SYH_THISH       -TLQSIRGMHDVLPADTPAWQWLEAAARELLAGYGYEEIRMPIVEQTELFARSIGEVTDIVEKEMYTFED
SYH_STAS1       ------RGTQDILPNETKKWRFIEARLDELMEVYNYQEIRTPIFESTELFARGVGDSTDVVQKEMYTFKD
SYH_LACPL       ------KGTADILPGDSEKWQYVEATARAVFKTYQFKEIRTPMFENFEVFSRSAGDTSDIVTKEMYDFHD
SYH_SHEB8       ---QAIRGMNDILPTQSPLWQKVEAVLRSSVSAYGYSEIRTPIVENTDLFKRSIGEVTDIVEKEMYTFAD
SYH_SHEB5       ---QAIRGMNDILPTQSPLWQKVEAVLRSSVSAYGYSEIRTPIVENTDLFKRSIGEVTDIVEKEMYTFAD
SYH_SHEB2       ---QAIRGMNDILPTQSPLWQKVEAVLRSSVSAYGYSEIRTPIVENTDLFKRSIGEVTDIVEKEMYTFAD
SYH_PSEPF       ---QAIRGMNDILPEQTPVWRYFEGTVSRLLDNYGYKQIRMPIVEFTELFKRSIGEVTDIVEKEMYTFED
SYH_PARUW       -------------------------TIRKTVRDYGYQEIRTPLFERTELFQRSVGETSDIISKEMYTFED
SYH_RHORT       -----VRGTHDYLPDEARSHRHVEETARTVAERFGFGEIITPIFEFTDVFARTLGDTSDVVTKEMYTFTD
SYH_SHEB9       ---QAIRGMNDILPTQSPLWQKMEAVLRSSVSAYGYSEIRTPIVENTDLFKRSIGEVTDIVEKEMYTFAD
SYH_PSEPK       ---QAIRGMNDILPEQSPLWRYFEGTVAGLLDTYGYSQIRTPIVEFTELFKRSIGEVTDIVEKEMYTFED
SYH_PSEPG       ---QAIRGMNDILPEQSPLWRYFEGTVAGLLDTYGYSQIRTPIVEFTELFKRSIGEVTDIVEKEMYTFED
SYH_PSEP1       ---QAIRGMNDILPEQSPLWRYFEGTVAGLLDTYGYSQIRTPIVEFTELFKRSIGEVTDIVEKEMYTFED
SYH_ECOLU       ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_SHIB3       ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_SHEDO       ---QAIRGMNDILPTQSPLWQKVEAVLRSSVSAYGYSEIRTPIVESTDLFKRSIGEVTDIVEKEMYTFED
SYH_SERP5       ---QAIRGMNDYLPEETALWQRIEGILKQVLSGYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFDD
SYH_SHISS       ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_SHIFL       ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_ECOUT       ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_ECOSM       ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_ECOLI       ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_ECOLC       ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_ECOL6       ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_ECOL5       ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_ECOK1       ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_ECOHS       ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_ECODH       ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_ECOBW       ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_ECO8A       ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_ECO81       ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_ECO7I       ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_ECO5E       ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_ECO57       ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_ECO55       ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_ECO45       ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_ECO24       ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_YERPY       ---QAIRGMNDYLPADTAIWQRIESILKQVLSGYGYSEIRMPIVEQTPLFKRAIGEVTDVVEKEMYTFDD
SYH_YERPS       ---QAIRGMNDYLPADTAIWQRIESILKQVLSGYGYSEIRMPIVEQTPLFKRAIGEVTDVVEKEMYTFDD
SYH_YERPP       ---QAIRGMNDYLPADTAIWQRIESILKQVLSGYGYSEIRMPIVEQTPLFKRAIGEVTDVVEKEMYTFDD
SYH_YERPN       ---QAIRGMNDYLPADTAIWQRIESILKQVLSGYGYSEIRMPIVEQTPLFKRAIGEVTDVVEKEMYTFDD
SYH_YERPG       ---QAIRGMNDYLPADTAIWQRIESILKQVLSGYGYSEIRMPIVEQTPLFKRAIGEVTDVVEKEMYTFDD
SYH_YERPE       ---QAIRGMNDYLPADTAIWQRIESILKQVLSGYGYSEIRMPIVEQTPLFKRAIGEVTDVVEKEMYTFDD
SYH_YERPB       ---QAIRGMNDYLPADTAIWQRIESILKQVLSGYGYSEIRMPIVEQTPLFKRAIGEVTDVVEKEMYTFDD
SYH_YERPA       ---QAIRGMNDYLPADTAIWQRIESILKQVLSGYGYSEIRMPIVEQTPLFKRAIGEVTDVVEKEMYTFDD
SYH_STRZT       MKLQKPKGTQDILPAESAKWQYVEGFAREIFKRYNYAEVRTPIFEHYEVISRSVGDTTDIVTKEMYDFYD
SYH_STRPN       MKLQKPKGTQDILPAESAKWQYVEGFAREIFKRYNYAEVRTPIFEHYEVISRSVGDTTDIVTKEMYDFYD
SYH_GEOTN       MAFQIPRGTQDLLPGETEKWQYVEQVARDLCRRYGYEEIRTPIFEHTELFLRGVGDTTDIVQKEMYTFED
SYH_CHLP8       ---QAVKGTRDIFPDEIARWHYVEGVIRSVAELYGFSEVRTPVFEYTELFQRGIGATTDIVGKEMFTFQD
SYH_KLEP3       ---QAIRGMNDYLPGETALWQRIEGSLKQVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_ECO27       ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_YERP3       ---QAIRGMNDYLPADTAIWQRIESILKQVLSGYGYSEIRMPIVEQTPLFKRAIGEVTDVVEKEMYTFDD
SYH_STRPI       MKLQKPKGTQDILPAESAKWQYVEGFAREIFKRYNYAEVRTPIFEHYEVISRSVGDTTDIVTKEMYDFYD
SYH_SODGM       ---QAIRGMNDYLPEETAFWQCVEGTLKNVLASYGYSEIRLPIVEQTPLFQRAIGEVTDVVEKEMYTFAD
SYH_SHIBS       ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_VIBFM       -TIQAIRGMNDCLPTQSPLWQKVEGSVKRVISAYGYNEVRMPIVEQTHLFKRAIGEVTDVVEKEMYTFED
SYH_VIBF1       -TIQAIRGMNDCLPTQSPLWQKVEGSVKRVISAYGYNEVRMPIVEQTHLFKRAIGEVTDVVEKEMYTFED
SYH_STRPS       MKLQKPKGTQDILPPESAKWQYVEGFAREIFKRYNYAEVRTPIFEHYEVISRSVGDTTDIVTKEMYDFYD
SYH_SHEAM       ---QAIRGMNDILPNQSPVWQKLEAVLRDAVAAFGYSEIRTPIVESTDLFKRSIGEVTDIVEKEMYTFED
SYH_LACCB       MNYQRPKGTADILPGQSERWQQVEAVARKIFAQYQYHEIRTPIFENVDVFSRSAGDTSDIVTKEMYTFKD
SYH_LACC3       MNYQRPKGTADILPGQSERWQQVEAVARKIFAQYQYHEIRTPIFENVDVFSRSAGDTSDIVTKEMYTFKD
SYH_STRR6       MKLQKPKGTQDILPAESAKWQYVEGFAREIFKRYNYAEVRTPIFEHYEVISRSVGDTTDIVTKEMYDFYD
SYH_STRPJ       MKLQKPKGTQDILPAESAKWQYVEGFAREIFKRYNYAEVRTPIFEHYEVISRSVGDTTDIVTKEMYDFYD
SYH_STRP4       MKLQKPKGTQDILPAESAKWQYVEGFAREIFKRYNYAEVRTPIFEHYEVISRSVGDTTDIVTKEMYDFYD
SYH_STRP2       MKLQKPKGTQDILPAESAKWQYVEGFAREIFKRYNYAEVRTPIFEHYEVISRSVGDTTDIVTKEMYDFYD
SYH_PSEPW       ---QAIRGMNDILPEQSPLWRYFEGTVAGLLDTYGYSQIRTPIVEFTELFKRSIGEVTDIVEKEMYTFED
SYH_BURP8       -----VKGMNDILPQDAGLWEFFETTVKSMLRSYGYQNIRTPIVEHTQLFTRGIGEVTDIVEKEMYSFTD
SYH_SYNS3       ---QTLRGMVDLLPEQTRRWQAVESVAREHFRCAGLDEIRTPLLEFTDLFARGIGEGTDVVGKEMYTFLD
SYH_STRZP       MKLQKPKGTQDILPAESAKWQYVEGFAREIFKRYNYAEVRTPIFEHYEVISRSVGDTTDIVTKEMYDFYD
SYH_SHIDS       ---QAIRGMNDYLPSETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_SALTI       ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_SALPK       ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_SALPA       ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_SALHS       ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_SALAR       ---QAIRGMNDYLPGETAIWQRIESTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_ECOSE       ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_SALCH       ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_STRZJ       MKLQKPKGTQDILPAESAKWQYVEGFAREIFKRYNYAEVRTPIFEHYEVISRSVGDTTDIVTKEMYDFYD
SYH_STRP7       MKLQKPKGTQDILPAESAKWQYVEGFAREIFKRYNYAEVRTPIFEHYEVISRSVGDTTDIVTKEMYDFYD
SYH_SALTY       ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_SALPC       ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_SALPB       ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_SALNS       ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_SALEP       ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_SALDC       ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_CLOTH       MLTQAPKGTKDILPSEVYKWHYIEKEIAKLCHDFGYKEIRIPVFEHTELFQRGVGDTTDIVQKEMYTFLD
SYH_THETN       MLTKAPRGTKDVLPSESYKWQYVENLMREICEFYGYKEIRTPGFEHTELFLRGVGESTDIVRKEMYTFND
SYH_SALSV       ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_SALA4       ---QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_HELMI       MLISAPRGTKDILPGQSRHWQTLEDTIRRLCREYGYEEIRTPIFEHSEVFHRGVGDTTDIVQKETYDFQD
SYH_AQUAE       MNIQSVRGFHDILGKDAKKFRKISDTARKILKLYNFEEIILPVVEYAELFQRSVGETTDIVQKEMFVFED
SYH_VIBCM       -TIQAIRGMNDCLPTQSPLWQKVEGVVKNVISAYGYSEVRMPIVEMTHLFSRAIGEVTDVVEKEMYTFED
SYH_VIBCH       -TIQAIRGMNDCLPTQSPLWQKVEGVVKNVISAYGYSEVRMPIVEMTHLFSRAIGEVTDVVEKEMYTFED
SYH_VIBC3       -TIQAIRGMNDCLPTQSPLWQKVEGVVKNVISAYGYSEVRMPIVEMTHLFSRAIGEVTDVVEKEMYTFED
SYH_THEP1       MNYKRIKGTNDIFGEEIWYWRYVEETFRNVCESAGIEEIRTPIFEQTELFVRSVGEESDIVQKEMYTFQD
SYH_SHEWM       ---QAIRGMNDILPTQSPLWQKLETVLRETVAAYGYSEIRTPIVESTDLFKRSIGEVTDIVEKEMYTFDD
SYH_SALG2       ---QAIRGMKDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_PROMH       ---QAIRGMNDYLPADTRVWQKIENTLKQILAGYGFSEIRTPIVEHTPLFQRAIGEVTDVVEKEMYTFTD
SYH_HAEI8       -TIQAIRGMNDCAPTESPLWQWIEAQVRNVLNSYGYSEVRMPIVESTPLFARAIGEVTDVVSKEMYTFWD
SYH_PHOLL       ---QAIRGMNDYLPADTVIWQRIETILKRVLAGYGYSEIRTPIVEQTPLFRRAIGEVTDVVEKEMYTFDD
SYH_ALCBS       ----SIRGMNDILPEQTGLWQWLEAKVGAVLASYGYQEIRMPIVEQTDLFKRSIGEVTDIVEKEMYTFDD
SYH_AERHH       ---QAIRGMNDCLPEQSPVWQKVEQILRQVVASYGYSEVRMPIVEQTHLFKRAIGEVTDVVEKEMYTFED
SYH_YERE8       ---QAIRGMNDYLPADTAIWQRIEGILKQVLAGYGYSEIRMPIVEQTPLFKRAIGEVTDVVEKEMYTFDD
SYH_MANSM       -TIQAIRGMNDCLPTETPVWQWVESKVRSTLASYGYSEIRMPIVENTPLFARAIGEVTDVVSKEMFTFND
SYH_HAEIN       -TIQAIRGMNDCAPTESPLWQWIEAQVRNVLNSYGYSEVRMPIVESTPLFARAIGEVTDVVSKEMYTFWD
SYH_PSEF5       ---QAIRGMNDILPEQTPLWRYFEGTVARLLDNYGYKQIRMPIVEFTELFKRSIGEVTDIVEKEMYTFED
SYH_AERS4       ---QAIRGMNDCLPEQSPVWQKVEQILRQVVASYGYSEVRMPIVEQTHLFKRAIGEVTDVVEKEMYTFED
SYH_HAES2       -TIQAIRGMNDCSPTESLLWQWVEEKVRSVLQTYGYSEVRMPIVESTPLFARAIGEVTDVVSKEMYTFWD
SYH_STRSV       MKLQKPKGTQDILPQESAKWQYVEDFARKTFRKYNYGEIRTPIFEHYEVISRSVGDTTDIVTKEMYDFYD
SYH_PHOPR       ---QAIRGMNDCLPTQSALWQKVEGTIKQVVSAYGYNEIRMPIVESTHLFKRAIGEVTDVVEKEMYTFED
SYH_SHELP       ---QAIRGMNDILPTQSPLWQKLEAVLRDTVAAYGYSEIRTPIVESTDLFKRSIGEVTDIVEKEMYTFAD
SYH_SHEHH       ---QAIRGMNDILPTQSPLWQKLETVLRETVGSYGYSEIRTPIVESTDLFKRSIGEVTDIVEKEMYTFED
SYH_SHESH       ---QAIRGMNDILPTQSPLWQKLETVLRETVSAYGYSEIRTPIVESTDLFKRSIGEVTDIVEKEMYTFDD
SYH_SHEFN       ---QAIRGMNDILPTQSPLWQKVEAVLRSSVSAFGYSEIRTPIVESTDLFKRSIGEVTDIVEKEMYTFED
SYH_PSE14       ---QAIRGMNDILPEQTPLWRHFEGTVSRLLDNYGYRQIRMPIVEFTELFKRSIGEVTDIVEKEMYTFAD
SYH_LYSSC       MSFKVPRGTQDILPGQSEKWQKVEAIIRDICRVYRYNEIRTPIFEQTDLFARGVGETTDVVQKEMYTFED
SYH_GEOLS       MSITGIKGFNDLLPAESGLWQFIEQTARQVFARYGFNEIRVPIVEKTELFCRSIGDTTDIVEKEMYTFMD
SYH_PSESM       ---QAIRGMNDILPEQTPLWRHFEGTVSRLLDNYGYRQIRMPVVEFTDLFKRSIGEVTDIVEKEMYTFAD
SYH_HAES1       -TIQAIRGMNDCSPTESLLWQWVEEKVRSVLQTYGYSEVRMPIVESTPLFARAIGEVTDVVSKEMYTFWD
SYH_BURPP       -----VKGMNDILPQEAGLWEFFETTVKSMLRSYGYQNIRTPIVEHTQLFKRGIGEVTDIVEKEMYSFTD
SYH_SHEPA       ---QAIRGMNDILPTQSPLWQKLETVLRDTVGSYGYSEIRTPIVESTDLFKRSIGEVTDIVEKEMYTFED
SYH_LACLA       MKLQKPKGTADLLPAETAKWQYIEEIARGVFNDYNFKEIRTPMFESYELFSRATGETSDIVTKEMYDFED
SYH_STRSY       MKLQKPKGTQDLLPQDSAKWQYVENFTRSIFKQYNYAEIRTPIFEHYEVISRSVGDTTDIVTKEMYDFYD
SYH_STRS2       MKLQKPKGTQDLLPQDSAKWQYVENFTRSIFKQYNYAEIRTPIFEHYEVISRSVGDTTDIVTKEMYDFYD
SYH_FUSNN       ---KAVRGTKDIIGEEAKKYIYISNVAQKMFENYGYNFVKTPIFEETELFKRGIGEATDVVEKEMYTFKD
SYH_DESAD       -----IKGVADLFPEDSARYAFMEKTARDVFSSYGYGELRVPILEKTELFCRSIGEETDVVQKEMYTFPD
SYH_PROMT       -----LRGMVDLLPAQSQGWQKVESIALEHFSRAGLQEIRTPIIEQTELFSRGIGENTDVVGKEMYSFDD
SYH_OCEIH       MSMKAPRGTVDLLPEQSIKWQFAESKIKEICHNYHYQEIRTPLFEHTEVFQRGVGDTTDIVQKEMYTFED
SYH_PSEU2       ---QAIRGMNDILPEQTPLWRHFEGTVARLLDNYGYRQIRMPIVEFTELFKRSIGEVTDIVEKEMYTFAD
SYH_LACLM       MKLQKPKGTADLLPAETAKWQYIEEIARGVFNDYNFKEIRTPMFESYELFSRATGETSDIVTKEMYDFED
SYH_EXISA       ---KAPRGTQDLLPGTVETWQYVEEKLRDMSARYNYKEIRTPIFETTNLFTRSVGETTDIVQKEMFTLVK
SYH_ESCF3       ---QSVRGMNDYLPVETAVWQRVERIIKSVVESYGYSEIRTPILEQTPLFKRAIGEVTDVVEKEMYTFND
SYH_BURXL       -----VKGMNDILPQEAGLWEFFETTVKSMLRSYGYQNIRTPIIEHTQLFKRGIGEVTDIVEKEMYSFTD
SYH_HAEIG       -TIQAIRGMNDCAPTESPLWQWIEAQVRNVLNSYGYSEVRMPIVESTPLFARAIGEVTDVVSKEMYTFWD
SYH_PELPB       ---QAVKGTRDIFPEEAARWKYVEGVVHAIASLYGFSEIRTPVFEYTELFQRGIGSTTDIVGKEMFSFPD
SYH_VIBVY       -TIQAIRGMNDCLPTQSPLWQKLEGAVKNVISAYGYNEMRMPIVEMTHLFSRAIGEVTDVVEKEMYTFED
SYH_VIBVU       -TIQAIRGMNDCLPTQSPLWQKLEGAVKNVISAYGYNEMRMPIVEMTHLFSRAIGEVTDVVEKEMYTFED
SYH_SHESW       ---QAIRGMNDILPTQSPLWQKVEAVLRSSVSAYGYSEIRTPIVENTDLFKRSIGEVTDIVEKEMYTFED
SYH_SHEPC       ---QAIRGMNDILPTQSPLWQKVEAVLRSSVSAYGYSEIRTPIVENTDLFKRSIGEVTDIVEKEMYTFED
SYH_PSEFS       ---QAIRGMNDILPEQTPLWRYFESTVARLLDNYGYKQIRMPIVEFTELFKRSIGEVTDIVEKEMYTFED
SYH_PELLD       ---QAVKGTRDIFPEEAAQWKHVEEVVHTLASLYGFSEVRTPVFEYTELFQRGIGATTDIVGKEMFTFPD
SYH_ERWT9       ---QAIRGMNDYLPADTAVWQRVEQILKQVLSSYGFSEIRMPIVEQTPLFKRAIGEVTDVVEKEMYTFDD
SYH_CHRSD       ---QAIRGMNDLLPEQSPVWQYFERQIQHLMQRYGYNEIRTPILEQTALFKRSIGEVTDIVEKEMYTFED
SYH_BURVG       -----VKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTQLFTRGIGEVTDIVEKEMYSFTD
SYH_GEOSL       -----IKGFNDILPGEVERWQHIEATARRVFSLYGFSEIRIPILEKTELFRRSIGDTTDIVEKEMYSFVD
SYH_BURP6       -----VKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTQLFTRGIGEVTDIVEKEMYSFVD
SYH_BURCM       -----VKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTQLFTRGIGEVTDIVEKEMYSFTD
SYH_BURCJ       -----VKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTQLFTRGIGEVTDIVEKEMYSFTD
SYH_BURCC       -----VKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTQLFTRGIGEVTDIVEKEMYSFTD
SYH_BURA4       -----VKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTQLFTRGIGEVTDIVEKEMYSFTD
SYH_VIBPA       -TIQAIRGMNDCLPTQSPLWQKLENTVKNVISAYGYNEVRMPIVEETNLFSRAVGEETDVVSKEMYTFDD
SYH_PSEA6       ---QAIRGMNDCLPEQSGLWQWAEKAIREVVASYGYQEVRTPIVESTDLFKRSIGEVTDIVEKEMYTFAD
SYH_HAEIE       -TIQAIRGMNDCAPTESPLWQWIEAQVRNVLNSYGYSEVRMPIVESTPLFARAIGEVTDVVSKEMYTFWD
SYH_BURS3       -----VKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTQLFTRGIGEVTDIVEKEMYSFTD
SYH_BURM1       -----VKGMNDILPQDAGLWEFFESTVKSLLRAYGYQNIRTPIVEHTQLFTRGIGEVTDIVEKEMYSFTD
SYH_PSEE4       ---QAIRGMNDILPDQSPLWRYFEGTVAGLLDSYGYSQIRTPIVEFTELFKRSIGEVTDIVEKEMYTFQD
SYH_PSEAE       ---QAIRGMNDILPEQTPAWRYLERTFAGLLDGYGYSEIRLPILEFTELFARGIGEGTDVVDKEMYTFLD
SYH_PSEAB       ---QAIRGMNDILPEQTPAWRYLERTFAGLLDGYGYSEIRLPILEFTELFARGIGEGTDVVDKEMYTFLD
SYH_PSEA8       ---QAIRGMNDILPEQTPAWRYLERTFAGLLDGYGYSEIRLPILEFTELFARGIGEGTDVVDKEMYTFLD
SYH_STAHJ       ---RIPRGTQDILPEDSSKWRYIENQLDKLMKLYNYKEIRTPIFESTDLFARGVGDSTDVVQKEMYTFKD
SYH_DESMR       -----IKGFADLFPPDSTVFSFIEETARQVFSRYGYKELRVPVLERTELFCRSIGEETDVVQKEMYTFPD
SYH_CHLTE       ---QGVKGTRDIFPDEISRWHYVEGVVHSVAALYGFSEIRTPVFEYTELFQRGIGATTDIVGKEMFTFPD
SYH_BURCH       -----VKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTQLFTRGIGEVTDIVEKEMYSFTD
SYH_BURCA       -----VKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTQLFTRGIGEVTDIVEKEMYSFTD
SYH_SACEN       -TFNAPKGIPEYFPPESAAFLAVRETLADAARRAGYGYIELPLFEDTTLFARGVGESTDVVSKEMYTFAD
SYH_LACLS       MKLQKPKGTADLLPAETAKWQYIEEIARGVFNDYNFKEIRTPMFESYELFSRATGETSDIVTKEMYDFED
SYH_BURPS       -----VKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTQLFTRGIGEVTDIVEKEMYSFVD
SYH_BURP0       -----VKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTQLFTRGIGEVTDIVEKEMYSFVD
SYH_ANAD2       MKINGVKGMNDVLPADVARWHEMEAVAREVFALYGYREVRTPAVEHAALFARGVGEATDIVNKEMYVFED
SYH_VIBHB       ---QAIRGMNDCLPTQSPLWQKLENAVKSTVSAYGYNEVRMPIVEETNLFSRAVGEETDVVSKEMYTFDD
SYH_BURTA       -----VKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTPLFTRGIGEVTDIVEKEMYSFVD
SYH_ALTMD       -TIQAIRGMNDCLPEISGTWQKVESVLRQVVASYGYQEIRTPIVESTDLFKRSIGEVTDIVEKEMYTFED
SYH_THELT       MRYERVKGTVDIFGQDIPYWYFVEQRAIQVALLFGYKEIRTPVFEQTELFARSVGQETDIVQKEMYTFTD
SYH_SYNPX       ---QSLRGMVDLLPETLQCWQAVEAVAREHFRRSGFGEIRTPLLETTDLFCRGIGEGTDVVGKEMYSFTD
SYH_PSEA7       ---QAIRGMNDILPEQTPAWRYLERTFAGLLDGYGYSEIRLPILEFTELFARGIGEGTDVVDKEMYTFLD
SYH_LACSS       ------KGTADILPGESDQWQLVEKTARDVFARYQFKEIRTPLFESYDVFSRSSGDTSDIVSKEMYDFMD
SYH_ANASK       MKINGVKGMNDVLPADVARWHEMESVAREVFALYGYREVRTPAVEHAALFARGVGEATDIVNKEMYVFED
SYH_PROMA       ---KTLRGMVDLLPSHSARWQKVETLAIKNFERAGIKEIRTPILELTELFSRGIGEATDVVGKEMYSFED
SYH_BURP1       -----VKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTQLFTRGIGEVTDIVEKEMYSFVD
SYH_BURMS       -----VKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTQLFTRGIGEVTDIVEKEMYSFVD
SYH_BURMA       -----VKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTQLFTRGIGEVTDIVEKEMYSFVD
SYH_BURM9       -----VKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTQLFTRGIGEVTDIVEKEMYSFVD
SYH_BURM7       -----VKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTQLFTRGIGEVTDIVEKEMYSFVD
SYH_SHEPW       ---QAIRGMNDILPTQSPIWQKLETVLRETVSAYGYSEIRTPIVESTDLFKRSIGEVTDIVEKEMYTFDD
SYH_RALSO       -----VKGMNDLLPGDAPLWEHFDNAVRSMLRAYGYQQIRTPIVEQTQLFVRGIGEVTDIVEKEMYSFTD
SYH_PROM1       -----LRGMLDLLPAQSQGWQKVESIALEHFSRAGLQEIRTPILEQTELFSRGIGENTDVVGKEMYSFDD
SYH_METFK       ---QSIKGFYDILPADTALWQRIEDSARQVLSQYGYRNIRLPIVEPTELFIRGVGEHTDIVEKEMYSWED
SYH_METCA       ---QAIRGMHDILPDMTPRWQQVEHQIRSVMANYGYREIRLPIVEKTELFKRSIGEVTDIVEKEMYVFED
SYH_EDWI9       ---QAIRGMNDYLPADTALWQPIEAALKQVLASYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_SHESA       ---QAIRGMNDILPTQSPLWQKVEAVLRASVAAYGYSEIRTPIVENTDLFKRSIGEVTDIVEKEMYTFED
SYH_IDILO       ----------DLLPEQSPAWQQVEAVIRRVAASYGYSEIRMPVLESTQLFKRSIGEVTDIVEKEMYTFDD
SYH_HAEDU       -TIQAIRGMNDCATTESPLWQWVESNVRNVLASYGYSEVRMPIVESTPLFARAIGEVTDVVSKEMYTFWD
SYH_CHLPB       ---RAVKGTKDIFPDEITSWKYIEGVIHRVVGLYGFQEIRTPVFEYTDLFQRSIGSTTDIVGKEMFSFRE
SYH_SHESM       ---QAIRGMNDILPTQSPLWQKVEAVLRASVAAYGYSEIRTPIVENTDLFKRSIGEVTDIVEKEMYTFED
SYH_CLOPH       MITQRPKGTLDWYGDNMYKRTLIEELARKLCKAYNIKEIITPVFEHTILFQRGVGETTDVVQKEMYTFLD
SYH_THICR       ----AIRGMNDLYGDQSHAFDYLVQTAESVLKQYGFQSIRLPIVEKTELFARSIGEVTDIVEKEMYTFED
SYH_PROM3       ---QSLRGMVDLLPEQTRCWQAVESVARDHFRRAGLQEIRTPLLEVTELFARGIGEATDVVGKEMYTFVD
SYH_DECAR       -TLQAVRGMNDVLPDEAEFWELFEDTIRSWLKGYGYRPIRMPIVEPTPLFKRAIGEVTDIVEKEMYSFVD
SYH_SYNPW       ---QSLRGMVDLLPEQTRRWQAVEAVARDHFRRAGVEEIRTPLLEVTELFARGIGEGTDVVGKEMYSFLD
SYH_SHESR       ---QAIRGMNDILPTQSPLWQKVEAVLRASVAAYGYSEIRTPIVENTDLFKRSIGEVTDIVEKEMYTFED
SYH_PELCD       MSISGIKGMNDILPSDVETWQFLEREAHRIFKLYGFAEIRVPVVEKTELFCRSIGETTDIVEKEMYTFDD
SYH_SYMTH       MSIQAPRGFNDILPRDSYRWQRLEEIFREVARLYGYQELRPPMVEYVDLFIHGVGATTDIVTKEMFNITP
SYH_SHEON       ---QAIRGMNDILPTQSPLWQKVEAVLRSSVAAYGYSEIRTPIVENTDLFKRSIGEVTDIVEKEMYTFED
SYH_NOCFA       ----------------------------------GHIEL--PIFEDTGLFARGVGESTDVVTKEMYTFAD
SYH_NITEU       ---RAVRGMNDILPDESGLWAFFEDTIRTWLAAYGYRNLRTPIVEQTDLFVRSIGEVTDIVEKEMYTFVD
SYH_ENT38       ---QAIRGMNDYLPGETAIWQRIEGTLKQVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFED
SYH_LACF3       ------KGTADILPGDSQTWQYVEGQARQIFKTYGYQEIRTPLFESYDIFSRSAGDTSDVVTKEMYDFKD
SYH_ACTSZ       ---KAIRGMNDCSPTDSPLWQWIEDKVRNVLASYGYSEVRMPIVESTPLFARAIGEVTDVVSKEMYTFWD
SYH_MARMS       ---QAIRGMNDILPDQSSVWLYLEKTVADVVKSYGYQQIRFPIVENTDLFKRGVGETTDIVEKEMYTFDD
SYH_STACT       ------RGTQDILPDQSRKWRYIEAKLDELMELYNYKEIRTPIFESTDLFARGVGDSTDVVQKEMYTFKD
SYH_LACS1       ------KGTADILPSESAKWQYVEEKARELFKKYRYEEMRTPIFESFEVFSRTSGETSDIVTKEMYDFYD
SYH_ANATD       MKIQAPKGTKDVLPEESYMWQYVENKFREVCKLYGYQEVRFPTFEYTELFQRGVGDTTDIVQKEMYTFLD
SYH_STRGC       MKLQKPKGTQDILPQESAKWQYVEEFARETFRKYNYAEIRTPIFEHYEVISRSVGDTTDIVTKEMYDFYD
SYH_STAAW       ------RGTQDILPEDSKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDVVQKEMYTFKD
SYH_STAAU       ------RGTQDILPEDSKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDVVQKEMYTFKD
SYH_STAAT       ------RGTQDILPEDSKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDVVQKEMYTFKD
SYH_STAAS       ------RGTQDILPEDSKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDVVQKEMYTFKD
SYH_STAAR       ------RGTQDILPEDSKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDVVQKEMYTFKD
SYH_STAAN       ------RGTQDILPEDSKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDVVQKEMYTFKD
SYH_STAAM       ------RGTQDILPEDSKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDVVQKEMYTFKD
SYH_STAAE       ------RGTQDILPEDSKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDVVQKEMYTFKD
SYH_STAAC       ------RGTQDILPEDSKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDVVQKEMYTFKD
SYH_STAAB       ------RGTQDILPEDSKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDVVQKEMYTFKD
SYH_STAA9       ------RGTQDILPEDSKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDVVQKEMYTFKD
SYH_STAA8       ------RGTQDILPEDSKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDVVQKEMYTFKD
SYH_STAA3       ------RGTQDILPEDSKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDVVQKEMYTFKD
SYH_STAA2       ------RGTQDILPEDSKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDVVQKEMYTFKD
SYH_STAA1       ------RGTQDILPEDSKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDVVQKEMYTFKD
SYH_GLUOX       ------RGTHDLIGETMRRHHHVVETARRVLRTYGFEEWSTPIFEDTRVFSRTLGETSDVVSKEMYTFED
SYH_RHOSR       ---------------------------------AGYGHIELPIFEDTGLFARGVGESTDVVSKEMYTFAD
SYH_CLOD6       MLTKAPRGTKDITPKEAYKWRYVENKFREICALYGYEEMVTPIFEHTELFKRSVGDTTDIVQKEMYSFKD
SYH_CHLPD       ---QVVKGARDIFPDEIVRWHYVEDVVHRLASLYGYSEIRTPVFEYTELFQRSIGTTTDIVGKEMFSFPD
SYH_BACHD       MAIQIPRGTQDILPGDVETWQWIEQKAYDLCRRYNYQEIRVPMFEHTELFLRGVGDTTDIVQKEMYTFED
SYH_SYNS9       ---QSLRGMVDLLPQALQRWQAVESVARTHFQRSGFGEIRTPVMEPTDLFCRGIGEATDVVGKEMYTFND
SYH_SYNR3       ---QSLRGMVDLLPAATSRWQWLEQTAREHFRRSCIREIRTPLLEATELFARGIGEATDVVGKEMYSFND
SYH_LACBA       ------KGTADILPGDSQTWQFVEATARQLFANYRFEEIRTPMFENFEVFSRTSGDTSDIVTKEMYDFKD
SYH_LEGPL       ---QAIRGMNDILPDSTSVWRFIEQTFINCLVRYGYKEIRFPIVENTQLFKRTIGEITDIVEKEMYTFND
SYH_LEGPA       ---QAIRGMNDVLPDSTSVWRFIEQTFINCLVRYGYKEIRFPIVENTQLFKRTIGEITDIVEKEMYTFND
SYH_PELPD       MAITAIKGCNDILPEESGRWQYIEQAARRIFERNGFSEIRVPIMEKTELFCRSIGDTSDIVEKEMYTFTD
SYH_MYCUA       ---------------------------------AGYGHIELPIFEDTALFARGVGESTDVVSKEMYTFAD
SYH_GLUDA       -----VRGTHDLIGETQLRHAHVVETARRIAGLYGFDEWATPIFEDTRVFARSLGDTSDVVSKEMYSFED
SYH_CHRVO       ---QAVKGMNDVLPAESYQWEYFEEALRKLLADYGYQNIRTPIVEGTPLFVRSIGEVTDIVEKEMYTFVD
SYH_ACTP7       ---QAIRGMNDCSPTESPLWQWIENKVRNVLAGYGYSEVRMPIVESTPLFARAIGEVTDVVSKEMYTFWD
SYH_LEGPH       ---QAIRGMNDVLPDSTSIWRFIEQTFINCLVRYGYKEIRFPIVENTQLFKRTIGEITDIVEKEMYTFND
SYH_WOLPP       MTNQTVRGTKDLLFDEWYKFKHIEQTASRISSLYGFLPVQTPIFEYTEVFTKTLGDSSDIITKEMYTFID
SYH_RALEJ       ---QGVKGMNDMLPADAPLWEHFENAARAMLRAYGYQQIRTPIVEHTQLFVRGIGEVTDIVEKEMYSFTD
SYH_GEOMG       -----IKGFNDILPGEVERWQHIEATARRVFGLYGYAEIRVPILEKTELFCRSIGDTTDIVEKEMYSFVD
SYH_CLOK5       MAIQAPKGTKDILPTESYKWHYLEDKFKNIADSYGYREIRTPVFEYTELFQRGVGETTDVVQKEMYTFLD
SYH_CLOK1       MAIQAPKGTKDILPTESYKWHYLEDKFKNIADSYGYREIRTPVFEYTELFQRGVGETTDVVQKEMYTFLD
SYH_CALS8       MKIQAPKGTKDVLPEESYIWQYVESKFRQICKLYGYQEVRFPTFEYTELFQRGVGETTDIVQKEMYTFLD
SYH_RHOOB       ---------------------------------AGYGHIELPIFEDTGLFARGVGESTDVVSKEMYTFAD
SYH_DESAP       ------RGTSDLLPGDTARWQRVEAVIRDLCRVYGYGEIRTPLFEATELFQRGVGDITDIVEKEMYTFTD
SYH_BORA1       ----AIRGMNDVLPGPSAQWERFEEIVRAWLQGYGYRNVRTPILEQTRLFTRGIGEVTDIVEKEMYTFTD
SYH_AZOSB       -TLQAVRGMNDILPDEAETWEHFEDIVRDWLKSYGYRPIRMPLVEPTPLFKRAIGEVTDIVEKEMYSFED
SYH_DESOH       -----IKGFKDILPGEADRWRRIETLAAVTFGAFGFSEIRPPVMERTELFKRSIGEDTDIVEKEMYTFED
SYH_CLOBM       MSLQAPKGTKDLLPTESYKWQYLENKFRNIAADFGCREIRTPVFEYTELFQRGVGETTDVVQKEMYTFED
SYH_RALEH       ---QGVKGMNDMLPADAPLWEHFENAARAMLRAYGYQQIRTPIVEHTQLFVRGIGEVTDIVEKEMYSFTD
SYH_PASMU       -TIQAIRGMNDCSPTESPLWQWVEGKVRSVLQNYGYSEVRMPIVESTPLFARAIGEVTDVVSKEMYTFWD
SYH_CUPTR       ---QGVKGMNDMLPADAPLWEHFENAARAMLRAYGYQQIRTPIVEHTQLFVRGIGEVTDIVEKEMYSFTD
SYH_DICT6       ------RGVQDILPDETPFWHLIENTARNLFEKYNYEEIRTPIFEFTELFIKGTGETTDIVMKEMYTFQD
SYH_DESAH       ---QTIRGFRDILPGETPLWQTIERAASQLFEDFGFQEIRLPLIERTELFARSIGEVTDIVEKEMYTFPD
SYH_NITEC       ---RAVRGMNDILPDESDLWGFFEDTIRTWLAAYGYRNLRTPIVEQTDLFVRSIGEVTDIVEKEMYSFID
SYH_DESAA       ---KLIRGFRDILPGQVELWQDIESKARVLLENFGFREIRLPIMESTELFARGIGADTDIVEKEMYTFPD
SYH_CLOBL       MSLQAPKGTKDLLPTESYKWQYLENKFRNIAADFGCREIRTPVFEYTELFQRGVGETTDVVQKEMYTFED
SYH_CLOBK       MSLQAPKGTKDLLPTESYKWQYLENKFRNIAADFGCREIRTPVFEYTELFQRGVGETTDVVQKEMYTFED
SYH_CLOBH       MSLQAPKGTKDLLPTESYKWQYLENKFRNIAADFGCREIRTPVFEYTELFQRGVGETTDVVQKEMYTFED
SYH_CLOB1       MSLQAPKGTKDLLPTESYKWQYLENKFRNIAADFGCREIRTPVFEYTELFQRGVGETTDVVQKEMYTFED
SYH_MOOTA       ------RGTEDILPEEVGRWYLLENTAREVSRLYGYREIRTPIFEHTELFNRGVGDTSDIVEKEMYTFID
SYH_PORPU       ---QAIRGTKDILPDEQLYWQFIHEKVASLLKYANYKEIKTPIFENSDLYDRGIGENTDIVNKEMYRFND
SYH_CORU7       ---------------------------------AGYEHIELPVFEDTSLFARGVGESTDVVSKEMYTFAD
SYH_BORPA       ----AIRGMNDVLPGPSARWEKFEEIVRGWLRSYGYRNVRTPVLEHTRLFARGIGEVTDIVEKEMYTFTD
SYH_BORBR       ----AIRGMNDVLPGPSARWEKFEEIVRGWLRSYGYRNVRTPVLEHTRLFARGIGEVTDIVEKEMYTFTD
SYH_RHOE4       ---------------------------------AGYGHIELPIFEDTGLFARGVGESTDVVSKEMYTFAD
SYH_PROMM       ---QSLRGMVDLLPEQTRCWQAVESVARDHFRRAGLQEIRTPLLEVTELFARGIGEATDVVGKEMYTFVD
SYH_DICTD       ------RGVQDILPDEIPFWHLIENIARSLFEKYNYEEIRTPIFEFTELFVKGTGETTDIVMKEMYTFQD
SYH_DESPS       ---KVLKGFKDILPGEVELWQQVEKITRDIFTRHNFSEIRMPILEQTDLFARSIGEATDIVEKEMYTFVD
SYH_BORPE       ----AIRGMNDVLPGPSARWEKFEEIVRGWLRSYGYRNVRTPVLEHTRLFARGIGEVTDIVEKEMYTFTD
SYH_CLOB6       MSLQAPKGTKDLLPTESYKWQYLENKFRNIAADFGCREIRTPVFEYTELFQRGVGETTDVVQKEMYTFED
SYH_DESVV       -----IKGFADLFPPESDVFTRMESVARQVFGRYGFVELRTPILERTDLFCRSIGTETDVVQKEMYTFPD
SYH_STRCO       -TFKAPKGTYDLLAKFLAVREAIAAPLRN----SGYGYIETPGFENVELFARGVGESTDIVTKEMYVFET
SYH_RICBR       -----LRGMKDLLPDDYKVHDYIIKKAKEVGELYGYKQMSTPILEYTKVFNRSMGESSDVISKEIYSFLD
SYH_RICB8       -----LRGMKDLLPDDYKVHDYIIKKAKEVGELYGYKQMSTPILEYTKVFNRSMGESSDVISKEIYSFLD
SYH_HALHL       ---QSIRGFSDILPEESPLWQYAESAIRRVLESYGYREIRLPVLERTELFSRSIGEVTDIVEKEMYTFDD
SYH_WOLPM       MTNQTVRGTKDLLFDEWYKFKYIEQTANRISSLYGFLPAQTPIFECTEVFTKTLGDSSDIITKEMYSFND
SYH_PROM4       ---QTLRGMVDLLPMQTQRWQIVENLARHHFHRAGLKEIRTPLLEITELFARGIGEATDVVGKEMYTFLD
SYH_EHRRW       ---REVRGTKDLLDDELYKFQYIQHLAQTIASRYGFIPVDTPIIEFTEVFTK-LGNTSDIVTKEMYNFKD
SYH_DESVH       -----IKGFADLFPPESDVFTRMESVARQVFGRYGFVELRTPILERTDLFCRSIGTETDVVQKEMYTFPD
SYH_CLOBJ       MSLQAPKGTKDLLPTESYKWQYLENKFRNIAADFGCREIRTPVFEYTELFQRGVGETTDVVQKEMYTFED
SYH_BDEBA       -----VRGTRDLLPEDSILFRFVEESAYEKALLYGYGEIETPIFEFSDVFHRTLGETSDVVNKETYDFTD
SYH_PROVI       ---QAVKGTKDVFPDEAVQWQLVEGVVRRLAGLYAFGEVRTPVFEYTELFQRGIGATTDIVGKEMFSFPD
SYH_MYCMM       ---------------------------------AGYGHIELPIFEDTALFARGVGESTDVVSKEMYTFAD
SYH_COLP3       ---QAIRGMNDCLPSETNIWQMVETVLRRVASNYGFAEIRMPIVESTALFKRGIGEVTDIVEKEMYTFDD
SYH_AZOVD       ---QAIRGMNDILPEQTPLWRYFEKSVAGLLDGYGYRQIRMPIVEFTELFKRSIGEVTDIVEKEMYTFED
SYH_ALHEH       ---RSIRGFSDILPEQTPLWQFVESNIQATLEAYGYREIRLPIVEKTELFSRSIGEVTDIVEKEMYTFED
SYH_COREF       ---------------------------------AGFEHIELPIFEETGLFARGVGESTDVVSKEMYTFAD
SYH_SORC5       MELRAVRGMNDILPEEVERWHKLEGAFRLHAELHGYAEVRTPLLEPTELFRHQMGETTDVVEKEMYSFE-
SYH_PSEU5       ---QAIRGMNDILPAQTPTWRYLESTFAQLLESYGYSEIRLPILEFTDLFARGIGEGTDVVDKEMYTFLD
SYH_STRAW       -TFKAPKGTYDLIPPDSAKYLAVREAIAAPLRNSGYGYIETPGFENVELFARGVGESTDIVTKEMYAFET
SYH_EHRRG       ---REVRGTKDLLDDELYRFQYIQHLAQTIASRYGFIPVDTPIIEFTEVFTK-LGNTSDIVTKEMYNFKD
SYH_WOLWR       MTNQTVRGTKDFLFDEWYKFKHIEQTASRISNLYGFLPAQTPIFEYTEVFTKTLGDSSDIITKEMYSFND
SYH_THEYD       -----LRGMQDIFSEQIYLWQHIEEHARKILENYNFQEIRTPIVENAELFLRSIGEDTDIVEKEMYVFQD
SYH_PSEMY       ---QAIRGMNDILPEQTPAWRYLESTLVSLLDGYGYKEIRLPIVEYTELFARGIGEGTDVVDKEMYTFLD
SYH_CORGL       ---------------------------------AGFEHIELPIFEDTGLFARGVGESTDVVSKEMYTFAD
SYH_DEHE1       ------RGTEDILPEDQPYWHFVRQQAARIAALYGYQRTDTPVFEDAGLFVRSVGEGTDIVSKEMYTFED
SYH_CORJK       --------------------------------AAGYEHVELPIFEETSLFARGVGESTDVVSKEMYTFAD
SYH_CLONN       MAIQAPKGTKDLLPMDSYKWHYIXXXXXXXXXXXXXXXIRTPAFEHTELFERGVGETTDVVQKEMYTFKD
SYH_TOLAT       ---QAIRGMNDCLPEQTPVWQMVEATLRRVVSSYGYSEIRMPVVEMTNLFQRAIGEVTDVVEKEMYTFND
SYH_LACH4       MRVQKPKGTVDILPEQSGSWQKVEETARNFFNRANYREIRTPSFENYEIFSRSSGDSSEIVEKQMYDFND
SYH_ERYLH       -TPQAIRGTQDIFSADAEAFAFVVETFERVRKLYRFRRVEMPVFEKTEVFSRAIGETTDVVSKEMYSFED
SYH_WOLTR       MTNQTVRGTKDLLFDEWYRFKYIQQIANRISSLYGFLPAQTPIFEYTEVFMKTLGDGSDIINKEMYTFYD
SYH_PSYWF       --------------------RQLEAMLKQALDQFGYEEIRLPIVEETQLFARAIGDATDIVEKEMFSFTD
SYH_PSEHT       ---QAVRGMNDCLPGDTQVWQKVENILRETVASFGYQEIRFPIVESTDLFKRSIGEVTDIVEKEMYTFAD
SYH_NEIMF       ---QSVKGMNDLLPVEQKDFKLTAATVNRWTRAYGYRQIRTPIVEQTGLFVRSIGEETDVVGKEMYTFXX
SYH_STRU0       MKLQKPKGTQDILPGEAAKWQYLENVARETFKKYHYGEIRTPMFEHYEVISRSVGDTTDIVTKEMYDFHD
SYH_PROM0       -----LRGTVDLFPDQLIKWQNVERILLEQLSRASIKEIRTPILEMTELFIRGIGEGTDVVSKEMYTFLD
SYH_NOVAD       -TPQPIRGTQDIFGPDAEAFAFVVETFERVRKLYRFRRVEMPVFEKTAVFSRSLGETTDVVSKEMYSFED
SYH_NEIMB       ---QSVKGMNDLFKLTAAFWQAFEDTVGRWTRAYGYQQIRTPIVEQTGLFVRSIGEETDVVGKEMYTFXX
SYH_EHRCJ       ---KEVRGTKDLLGAEFYKFQYIQHLSQAIANRYGFIAVDTPIIEFTEVFTKTLGDDSDIVTKEMYNFQD
SYH_PORYE       ---QAIRGTKDILPDEIQYWQFIHNKISKLLECANYQEIRTPIFENSELYDRGIGEDTDIVNKEMYRFHD
SYH_MYCVP       ----------------------------------GDIEL--PIFEDTALFARGVGESTDVVSKEMYTFAD
SYH_LACGA       MKVQRPKGTVDILPAESGSWEKVETIARNFFKRANYREIRTPSFENYEVFSRSSGESSDVVEKEMYDFND
SYH_LACDB       MRVQRPKGTVDILPETSGQWEKVEQTARDLFKRANYHEIRTPSFENYELFSRSSGETSDVVEKEMYDFED
SYH_LACDA       MRVQRPKGTVDILPETSGQWEKVEQTARDLFKRANYHEIRTPSFENYELFSRSSGETSDVVEKEMYDFED
SYH_EHRCR       ---REVRGTKDLLGIELYKFQYIHRLSQSIAHRYGFIAVDTPIIEFTEVFTKTLGDDSDIVMKEMYNFQD
SYH_PROMS       -----LRGTVDLFPDQLIKWQNVEKILLEQLSRASIKEIRTPILEMTELFIRGIGEGTDVVSKEMYTFLD
SYH_MYCPA       ---------------------QFVAVRSGLLDAAGYGDIELPIFEDTALFARGVGESTDVVSKEMYTFAD
SYH_LARHH       ---QAIRGMNDILPAESHQWEYFEGVLRGLLADYGYQNIRTPIVESTPLFIRSIGEVTDIVEKEMYTFTD
SYH_AZOSE       ---QAVRGMNDILPDEAEAWEHFEDIVRDWLRSYGYRPIRMPIVEPTPLFKRAIGEVTDIVEKEMYSFED
SYH_ACIBT       ----AIKGFNDVLPTQTAAWRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDATDIVEKEMYTFFD
SYH_VIBSL       ---QAIRGMNDCLPTQSPLWQXXXXXXXXXXXXYGYNEVRMPIVEETNLFSRAVGEETDVVSKEMYTFDD
SYH_CHLCH       ---QCVKGTRDILPDESLLWXXXXXXXXXXASLYGFREIRTPMFEYTDLFQRGIGATTDIVGKEMFSFQD
SYH_ACIBC       ----AIKGFNDVLPTQTAAWRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDATDIVEKEMYTFFD
SYH_STRGG       -TFQAPKGTYDLTPPRSATFLAVREAIAAPLRDSGYGYIETPGFENVELFARGVGESTDIVTKEMYTLTT
SYH_NEIM0       ---QSVKGMNDLLPVEQKDFKLTAATVGRWTRTYGYQQIRTPIVEQTGLFVRSIGEETDVVGKEMYTFXX
SYH_MYCTU       ----------------------LLAAARQ----AGYSHIELPIFEDTALFARGVGESTDVVSKEMYTFAD
SYH_MYCTA       ----------------------LLAAARQ----AGYSHIELPIFEDTALFARGVGESTDVVSKEMYTFAD
SYH_MYCBT       ----------------------LLAAARQ----AGYSHIELPIFEDTALFARGVGESTDVVSKEMYTFAD
SYH_MYCBP       ----------------------LLAAARQ----AGYSHIELPIFEDTALFARGVGESTDVVSKEMYTFAD
SYH_MYCBO       ----------------------LLAAARQ----AGYSHIELPIFEDTALFARGVGESTDVVSKEMYTFAD
SYH_LACJO       MKVQRPKGTVDILPGESGSWEKVESIARNFFKRANYREIRTPSFENYEVFSRSSGETSDVVSKEMYDFND
SYH_NEIMA       ---QSVKGMNDLLPVEQKDFKLTAATVGRWTRTYGYQQIRTPIVEQTGLFVRSIGEETDVVGKEMYTFXX
SYH_RICFE       -----LRGMKDLLPDDYKVHDYIINKARDVGVLYGYKQMSIPILEYTKVFNRSMGESSDVISKEIYSFLD
SYH_RICAH       -----LRGIKDLLPDDYKVHDYIISKARDVGVLYGYKQMSTPILEYTKVFNRSMGESSDVISKEIYSFLD
SYH_COXB2       ---QAIRGMSDTLPEEIPYWSFLENACRSVVSAYHYREIRFPVVEQTALFKRTIGEATDIVEKEMYTFTD
SYH_CLOPS       MAIQAQKGTKDMLPNDAYKWHYIEEKLRKISAEYGIREIRTPMFEATELFKRGVGETTDVVQKEMYTFED
SYH_CLOP1       MAIQAQKGTKDMLPNDAYKWHYIEEKLRKISAEYGIREIRTPMFEATELFKRGVGETTDVVQKEMYTFED
SYH_CLOPE       MAIQAQKGTKDMLPNDAYKWHYIEEKLRKISAEYGIREIRTPMFEATELFKRGVGETTDVVQKEMYTFED
SYH_THIDA       ---QSVRGMNDCLPDAADAWQGFEAIVRDWLRRYGYREMRTPILEHTGLFKRAIGEVTDIVEKEMYTFVD
SYH_STRA5       MKLQKPKGTQDILPGESAKWQYVENVIRNLFKQYHYDEIRTPMFEHYEVISRSVGDTTDIVTKEMYDFHD
SYH_STRA3       MKLQKPKGTQDILPGESAKWQYVENVIRNLFKQYHYDEIRTPMFEHYEVISRSVGDTTDIVTKEMYDFHD
SYH_NEIG1       ---QSVKGMNDLLPKDFKLTQAFEDTVNRWTRAYGYQQIRTPIVEQTGLFVRSIGEETDVVGKEMYTFXX
SYH_COXBU       ---QAIRGMSDTLPEEIPYWSFLENACRSVVSAYHYREIRFPVVEQTALFKRTIGEATDIVEKEMYTFTD
SYH_COXBR       ---QAIRGMSDTLPEEIPYWSFLENACRSVVSAYHYREIRFPVVEQTALFKRTIGEATDIVEKEMYTFTD
SYH_COXBN       ---QAIRGMSDTLPEEIPYWSFLENACRSVVSAYHYREIRFPVVEQTALFKRTIGEATDIVEKEMYTFTD
SYH_STRPM       MKLQKPKGTQDILPEDAAKWQYVESVARDTFSQYNYGEIRTPMFEHYEVISRSVGDTTDIVTKEMYDFYD
SYH_STRP8       MKLQKPKGTQDILPGDAAKWQYVESVARDTFSQYNYGEIRTPMFEHYEVISRSVGDTTDIVTKEMYDFYD
SYH_STRP1       MKLQKPKGTQDILPGDAAKWQYVESVARDTFSQYNYGEIRTPMFEHYEVISRSVGDTTDIVTKEMYDFYD
SYH_ACIB5       ----AIKGFNDVLPTQTAAWRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDATDIVEKEMYTFFD
SYH_SYNWW       MQVKAPRGTYDILPQDSVKWQYIEKIMRDSAESFGFRAIRTPLFEHTELFQRGVGQGTDIVSKEMYSFND
SYH_STRP6       MKLQKPKGTQDILPGDAAKWQYVESVARDTFSQYNYGEIRTPMFEHYEVISRSVGDTTDIVTKEMYDFYD
SYH_STREM       MKLQKPKGTQDILSVAAAKWQYVEGVARETFKQYHYGEIRTPMFEHYEVISRSVGDTTDIVTKEMYDFYD
SYH_STRPZ       MKLQKPKGTQDILPGDAAKWQYVESVARDTFSQYNYGEIRTPMFEHYEVISRSVGDTTDIVTKEMYDFYD
SYH_FRATO       -----VRGFNDVLPLDSYKWQFLESKVKLILDRYNYSETRLPIVERSELFHRSVGESSDIVSKETYDFQD
SYH_CORDI       ---------------------------------AGYEHIELPIFEDTTLFARGVGESTDVVTKEMYTFAD
SYH_STRP3       MKLQKPKGTQDILPGDAAKWQYVESVARDTFSQYNYGEIRTPMFEHYEVISRSVGDTTDIVTKEMYDFYD
SYH_RICPU       -----LRGMKDLLPDDYKVHDYIINTARDVGVLYGYKQMSTPIVEYTKVFNRSMGESSDIISKEIYSFLD
SYH_PSYCK       ---KAIKGFNDILPAQSAKWLYLESILANVLGRYGYEHIRLPIVEQTDLFARAIGGATDIVEKEMYSFTD
SYH_LACAC       MRVQKPKGTVDILPDQSSSWQKVEETARNFFNRANYREIRTPSFENYEIFSRSSGDSSEIVEKQMYDFND
SYH_COXB1       ---QAIRGMSDTLPEEIPYWSFLENACRSVVSAYHYREIRFPVVEQTALFKRTIGEATDIVEKEMYTFTD
SYH_ACIBY       ----AIKGFNDVLPTQTAAWRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDATDIVEKEMYTFFD
SYH_ACIB3       ----AIKGFNDVLPTQTAAWRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDATDIVEKEMYTFFD
SYH_ACHLI       -----VKGTYDVLPTEAENWVALESYVRKLFKTYNYGEIRTPMMEYSNVIHRET-ELSDMVIKETYNFKD
SYH_FRATM       -----VRGFNDVLPLDSYKWQLLESKVKLILDRYNYSETRLPIVERSELFHRSVGESSDIVSKETYDFQD
SYH_STRPG       MKLQKPKGTQDILPGDAAKWQYVESVARDTFSQYNYGEIRTPMFEHYEVISRSVGDTTDIVTKEMYDFYD
SYH_RICCN       -----LRGMKDLLPDDYKVHDYIINKARDVGVLYGYKQMSTPIVEYTKVFNRSMGESSDVISKEIYSFLD
SYH_FRATW       -----VRGFNDVLPLDSYKWQLLESKVKLILDRYNYSETRLPIVERSELFHRSVGESSDIVSKETYDFQD
SYH_FRATT       -----VRGFNDVLPLDSYKWQLLESKVKLILDRYNYSETRLPIVERSELFHRSVGESSDIVSKETYDFQD
SYH_FRATN       -----VRGFNDVLPLDSYKWQFLESKVKLILDRYNYSETRLPIVERSELFHRSVGESSDIVSKETYDFQD
SYH_FRATF       -----VRGFNDVLPLDSYKWQFLESKVKLILDRYNYSETRLPIVERSELFHRSVGESSDIVSKETYDFQD
SYH_FRAT1       -----VRGFNDVLPLDSYKWQLLESKVKLILDRYNYSETRLPIVERSELFHRSVGESSDIVSKETYDFQD
SYH_DIAST       ----AIKGMNDILPPDSARWEWLEDKVRTLMARYAYRNIRTPIVEPTPLFVRGLGEVTDIVEKEMYSFED
SYH_DEHSC       ------RGTEDILPEDQPYWHFVRQQAARIAALYGYQRTDTPVFEDAGLFVRSVGEGTDIVSKEMYTFED
SYH_DEHSB       ------RGTEDILPEDQPYWHFVRQQAARIAALYGYQRTDTPVFEDAGLFVRSVGEGTDIVSKEMYTFED
SYH_RICRO       -----LRGMKDLLPDDYKVHDYIINKARDVGVLYGYKQMSTPIVEYTKVFNRSMGESSDVISKEIYSFLD
SYH_PROM9       -----LRGTVDLLPDQLIKWQNVEKIVLEQLARASIKEIRTPILEMTELFIRGIGEGTDVVSKEMYTFLD
SYH_FRATH       -----VRGFNDVLPLDSYKWQFLESKVKLILDRYNYSETRLPIVERSELFHRSVGESSDIVSKETYDFQD
SYH_GRATL       -----LRGTKDILPNEINYWHHIHDKALTILSLHNYSEIRTPIIESTSLFKRSIGETSDIINKEMYTFTD
SYH_ACIAD       ----AIKGFNDVLPTQTAAWRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDATDIVEKEMYTFFD
SYH_RICAE       -----LRGMKDLLPDDYKVHDYIINKARDVGVLYGYKQMSTPLVEYTKVFNRSMGESSDVISKEIYSFLD
SYH_CAMFF       ----ALRGMKDLLDSDGKLYKFIVETCEQITKNYGYELCETPKMEETSLFKRSVGESSDIVGKEMYQFID
SYH_CAMC1       ----ALRGMKDMLPARAKLYAQIIKTCEEVAKNYGYEQILTPHLEETALFKRSVGESSDIVGKEMYQFED
SYH_ACISJ       ----AIKGMNDILPPDSARWEWLEDKVRTLMARYAYRNIRTPIVEPTPLFVRGLGEVTDIVEKEMYSFED
SYH_STRA1       MKLQKPKGTQDILPGESAKWQYVENVIRNLFKQYHYDEIRTPMFEHYEVISRSVGDTTDIVTKEMYDFHD
SYH_CHLT3       MKFQTIKGTKDILPSEIHKWHYVENTVRGVFQRFGYNEIRTPVFEQTALFQRGIGETTDIVGKEMYSFQD
SYH_CHLL2       ---QVVKGARDIFPDEILQWKHVEGVIHRLAALYGFNEIRTPVFEYTELFQRSIGSSTDIVGKEMFSFPD
SYH_BUCAP       ----SVRGMHDYLPEELKIWKKIENIIQKILTSYCYEEIRLPILEKTKIFQRAIGNITDVVEKEMYSFKD
SYH_ANAMF       -----VRGTRDLLPEECYKFWHIRDVAHDIGERYGFVPVETPIFEFQDVFLKTLGDSSDIIGKEMYSFPD
SYH_ACIBS       ----AIKGFNDVLPTQTAAWRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDATDIVEKEMYTFFD
SYH_STRS7       MKLQKPKGTQDILPVAAAKWQYVEDVARETFKQYHYGEIRTPMFEHYEVISRSVGDTTDIVTKEMYDFYD
SYH_STREQ       MKLQKPKGTQDILSVAAAKWQYVEGVARETFKQYHYGEIRTPMFEHYEVISRSVGDTTDIVTKEMYDFYD
SYH_SULNB       -----LRGMKDLTFDEAQRFVHIVKTAITIAKRYGYSYIETPILEETALFKRSVGDSSDIVSKEMYQFED
SYH_STRE4       MKLQKPKGTQDILPVAAAKWQYVEGVARETFKQYHYGEIRTPMFEHYEVISRSVGDTTDIVTKEMYDFYD
SYH_ANAPZ       -----VRGTKDLLSEEYYKLFHIQNVAQEIGERFGFMPVQTPIFEFQEVFCKTLGDSTDVIGKEMYTFAD
SYH_STRMU       MTLQKPKGTQDILPQETVKWQYVENVARKTFKKYHYGEIRTPMFERYEVISRSVGDTTDIVTKEMYDFHD
SYH_RICCK       -----LRGMKDLLPDDYKVHDYIINKARDVGVLYGYKQMSTPILEYTKVFNRSMGESSDIISKEIYSFLD
SYH_ELUMP       ---KLVRGFRDIFAPESNNFAELEACARRVFTLAGGTEVRIPTLELKELFIKSTGDTTDIVQKEMYAFED
SYH_ANAMM       -----VRGTRDLLPEECYKFWHIRDVAHDIGERYGFVPVETPIFEFQDVFLKTLGDSSDIIGKEMYSFPD
SYH_ACICJ       -----VRGTQDIIGEDARRHHHVVETARRVAGLYGAAEWATPVFELTSVFARNLGETSDVVTKEMYTFED
SYH_BLOPB       ---QSVRGMHDYLPKDTILWQYIENILITILDSYGYKEIRFPIIEDTNLFKRSIGEVTDVIEKEMYNFTD
SYH_VESOH       ---QAIRGMNDLLPKNSALWLSLEKTIFDLFITYGYQNIRTPIVEKTDTFCRAIGGDTDIVEKEMYSWKE
SYH_CHLMU       --------------------------AHRICNLYGFDEIRTPVFEKTETFLR-VGEHSDIVKKEVYTFLD
SYH_RICPR       -----LRGMKDLLPNDYQIHNYIINKARDVGALYGYKQMSTPILEYTKVFNRSMGESSDVMSKEIYSFVD
SYH_RICTY       -----LRGMKDLLPDDYQVHNYIINKARDVGVLYGYKQMSTPILEYTRVFNRCMGDSSDVISKEIYSFVD
SYH_PROMP       -----LRGTVDLLPDQLIKWQNVEKIIIQQLFRSSVKEIRTPILEMTELFMRGIGEGTDVVSKEMYTFLD
SYH_PROA2       ---RAVKGTRDIFPDEVAAWQYVESVIHRVASFYAFHEIRTPVFEYTDLFQRSIGATTDIVGKEMFTFQD
SYH_FRAP2       -----IRGFNDILPQESCKWQFLESKIKSILDKYNYDEVRLPVLEKSELFHRSVGETSDIVSKETYDFVD
SYH_UNCTG       MNYKAPRGTHDIFGINASGMSWLEQKAKVIFKRHGFEEVRTPVFEDAALFMRSIGQTTDIVEKEMYIFED
SYH_PROM5       -----LRGTVDLLPDNLIKWQNVEKIILELLLRASVKEIRTPILEMTELFMRGIGEGTDVVSKEMYTFLD
SYH_CHLFF       ---------------------RVEDVIHEVCDLYGFSEVRTPVFEKSEVFLHA-GEQSDIVKKEMYTFLD
SYH_BLOFL       ---QSVRGMHDCLPKDVIQWQYIEDVLKTILNGYGYNEIRFPIIECTDLFKRSIGEVTDVVEKEMYTFID
SYH_STRT2       MKLQKPKGTQDILPGDSAKWQYVENVARETFKKYNYGEIRTPMFEHYEVISRSVGDTTDIVTKEMYDFHD
SYH_STRT1       MKLQKPKGTQDILPGDSAKWQYVENVARETFKKYNYGEIRTPMFEHYEVISRSVGDTTDIVTKEMYDFHD
SYH_STRTD       MKLQKPKGTQDILPGDSAKWQYVENVARETFKKYNYGEIRTPMFEHYEVISRSVGDTTDIVTKEMYDFHD
SYH_MYCLE       ---------------------------------AGYGDIELPVFEDTALFARGVGESTDVVAKEMYTFAD
SYH_CHLCV       ---------------------RVEDVIHEVCDLYGFSEIRTPVFEKSEVFLH-VGEQSDIVKKEMYTFLD
SYH_CHLAB       ----------------------------------GFSEIRTPVFEKSEVFLH-VGEQSDIVKKEMYTFLD
SYH_PSYA2       ---KAIKGFNDILPAQSAKWLYLESILADVLGRYGYEHIRLPIVEQTDLFARAIGGATDIVEKEMYSFTD
SYH_PEDPA       ------KGTADILPPFSKEWQFVEQNARETFALYNYEEIRTPIFEKFEVFSRSAGDTSDIVTKEMYDFDD
SYH_CHLTB       --------------------KRVEHAAHRICNLYGFDEIRTPVFEKTETFLR-VGEHSDIVKKEVYTFLD
SYH_CHLT2       --------------------KRVEHAAHRICNLYGFDEIRTPVFEKTETFLR-VGEHSDIVKKEVYTFLD
SYH_CHLPN       MTVTLPKGVFDIFAKQLWRHTSLWHSVEKAIHTVGFCEIRTPIFEKSEVFLH-VGEESDVVKKEVYSFLD
SYH_ORITI       -----VKGSKDLLPEEFGKHDYIVSVSRNLSQLYGFQPISTPIIEYTEIFNRTLGKDSDVLSKEMYVFLD
SYH_RUTMC       ---QAIRGMSDLLPKDSAFWLSLERTIFDLFISYGYQNIRTPIVEKTDTFCRAIGGATDIVEKEMYSWIE
SYH_CHLTR       --------------------KRVEHAAHRICNLYGFDEIRTPVFEKTETFLR-VGEYSDIVKKEVYTFLD
SYH_CHLTA       --------------------KRVEHAAHRICNLYGFDEIRTPVFEKTETFLR-VGEYSDIVKKEVYTFLD
SYH_NITSB       MAIKALRGMKDILPPLSEKYLNFLQTASHYAHNYGFSYIETPLLEETALFKRSVGESSDIVGKEMYQFID
SYH_NEOSM       -----VKGTRDLFGEQLEKMRLIEQVAKNLSIRYLFTELETPIIEHTELFIRNLGETSDVVNKEIYSFQD
SYH_ONYPE       -----IKGTYDLMSDKMVCWQKVENHIRTLFAKYHLQEIRTPIIEYRGVFDRAA-QHSEMVSKETYTFAD
SYH_SULDN       ----SLRGMNDILSEDYERFTHFITVATKIAQRYGFHFIETPLLEETALFKRSVGESSDIVGKEMYQFVD
SYH_ORITB       -----VKGSKDLLPEEFGKHDYIISVSRNLSKLYGFQPISTPIIEYTEIFNRTLGKDSDVLSKEMYVFLD
SYH_CAMHC       ---QALRGMNDMMDDEAKLYKKIIDVCEDTAKKYGYEYIEIPKLEETALFKRSVGESSDIVGKEMYQFTD
SYH_CAMLR       ----ALKGMKDLQDDQATLYEKVVKTCEEVAKNYGFTFINCPHLELTKLFKRSVGESSDIVGKEMYEFVD
SYH_AYWBP       -----IKGTHDLMLDKMVCWQKVENHIRTLFAKYHLQEIRTPIIEYRGVFDRAA-QHSEMVSKETYTFTD
SYH_BUCAI       ---KSIRGMYDYFPKDLKIWNYIEIIFKEVLNSYCYLEIRLPILEKTEIFKRAIGNVTDVVEKEMYSFND
SYH_PHYMT       MIIKKPKGTYDLLFDEISQWQELEKKVKFFFENYNYLEIRTPIIEYNEIFNR-TATHSDMVNKEIYNFYD
SYH_PHYAS       -----IKGTHDLLPTQTTSWQKVENSFHSFFKKHQFQEIRTPIMEYAEVFHRAA-QHSEMVSKETYAFPD
SYH_CAMJR       ----ALKGMKDLLDKDAYYYEKVIKICEEVAKNYGFTFINTPHLELCTLFKRSVGESSDIVGKEMYEFID
SYH_CAMJE       ----ALKGMKDLLDKDAYYYEKVIKICEEVAKNYGFTFINTPHLELCTLFKRSVGESSDIVGKEMYEFID
SYH_BUCBP       ---RSIKGMHDYIPDDVITWQYIEYIVKRILKNYCYNEIRFPLIEKTSLFAHSIGNITDIIEKEMYSFKD
SYH_CAMJJ       ----ALKGMKDLLDKDAYCYEKVIKTCEEVAKNYGFTFINTPHLELCTLFKRSVGESSDIVGKEMYEFID
SYH_CAMJD       ----ALKGMKDLLDKDAYYYEKVIQTCEEVVKNYGFTFINTPHLELCILFKRSVGESSDIVGKEMYEFID
SYH_CAMJ8       ----ALKGMKDLLDKDAYYYEKVIKTCEEVAKNYGFTFINTPHLELCTLFKRSVGESSDIVGKEMYEFID
SYH_UREPA       ------RGTIDLYNKEMNDFKLLENFLLSTTKRYGFQQIKTPVFEFAELFMKSAGESSDLVSKEMYLFKD
SYH_UREP2       ------RGTIDLYNKEMNDFKLLENFLLSTTKRYGFQQIKTPVFEFAELFMKSAGESSDLVSKEMYLFKD
SYH_MYCPE       MVIKKPRGTYDLFGEEIEVFNKINDVLKTISNTYNCHEIKTPIFEHKELYIRNIGESSDIVTKEFYDFKD
SYHM_DICDI      -----IKGTYDLFPNEQRIHKFIFDVGRGVAERYGFKEISTPIIEPFELFNRSVGESSDIVMKEMFKFKD
SYH_MYCGE       ------RGVKDWFGDELVYFNWIVKKIRSLAFNWGFSEVKTPLFENAQLFQRS-NANADIVQKELYQFFD
SYH_MESFL       ------RGTQDLFLNNSKEWNAVEEKFRKVLNLFNYGEIITPMFESKELFVRGVGDSSDIVSKEMYEFTD
SYH_MYCPN       ------RGVKDWYGEELIYFNWTVHQITNLAWKWGFSEVKTPLLEYAEAFKR-TNANADIVKKELYEFHD
SYH_UREU1       ------RGTVDLYNEAMNEFKSLENFLLTTTKKYGFQQIKTPIFEFAELFMKSAGESSDLVSKEMYLFKD
SYH_METTH       ------RGTRDFLFAEMRNRKEVEGVLRRTFETYGYHEIKTPIFEELKLFTVKSG---EEVVNQIYHFTD
SYH_MYCMO       ------KGTSDFFLEKADLFQYILDTFRKEAELFNYSYIQTPILEFYDLFYRSVGETTDVVSKEMFIFND
SYH_METLZ       ------RGTRDFLPAEMAQRRFVEQKMRAVAATFGYGEIVTPMFEELELFTIKSGEG---IINEMYAFED
SYH_PYRKO       -----VKGTRDLLPEEMAKRRWVFERIREVFEGFNFQEVLTPTFEYTELFKLRSG---EEVVKQLYAFQD
SYH_MYCMS       ------RGTQDFFLDEAKLWNKVETKLKEILDQFNYSEIRTPMFESKELFIRSIGSTTDIVSKEMYEFVD
SYH_MYCH7       ------KGTYDFFGQSAKIFIDVRKVFFDQAKKFNFSYIETPIFEYANIFLT-TNQIADIVSKELYKFFD
SYH_MYCCT       ------RGTQDFFLDETKLWIKVETKLREILNKFNYSEIRTPMFESKELFIRSIGSTSDIVSKEMYEFVD
SYH_SULTO       -----VRGMKDYYGEELHKIKVVENAFLKIVKLAGYQEVETPIVEDFQLFALKGG---EELRNTMYVFKD
SYH_METPE       ------RGTRDFLPDEMEARRMIEGRMREAVRRWGYREVATPIFEDLSLFTMRSGQG---IIDEMYVFQD
SYH_SULSO       -----VRGMKDYIGIDAEKIRYLESTFRDLAKKYGYSEIITPVVEEFKLFELKGG---EELRQTMYVFKD
SYH_PYRHO       -----VKGTRDFLPEDMAKRRWVFEKIREVFEAYGFKEILTPVMEYTKLFQLRSG---EEVVKQLYAFKD
SYH_METHJ       ------RGTRDMLPDXXXXXXXXXXXXXXXXXLYGFREIATPVFEELELFTIRSGEG---IINEMYVFED
SYH_WIGBR       -----VRGSKDITPECMHIWNYVETKIIKIVDSYNYKEIRFPIMEFAKLFSKAIGDDNIVVNKEMYIFLD
SYH_MYCHJ       ------KGTYDFFGQGAKIFIDVRKVFFNQAKKFNFSYIETPIFEYANIFLT-TNQIADIVSKELYKFFD
SYH_PYRFU       -----VKGTRDFLPEEMVKRRWVFERIRERFETYGFKEVLTPTMEYTKLFELRSG---EEVVKQLYAFKD
SYH_METMP       ------KGTRDFLPXXXXXXXXXXXXXXXVFDSYNFSEINTPTFESFELLSKKTG---DEIRTQLFVFRD
SYH_SULIM       -----VRGMKDYIGIDAEKIRYLESTFRDLAIKYGYSEIITPVVEEFKLFALKGG---EELRETMYVFKD
SYH_SULIL       -----VRGMKDYIGIDAEKIRYLESTFRDLAIKYGYSEIITPVVEEFKLFALKGG---EELRETMYVFKD
SYH_SULIK       -----VRGMKDYIGIDAEKIRYLESTFRDLAIKYGYSEIITPVVEEFKLFALKGG---EELRETMYVFKD
SYH_ARCFU       ------RGTRDFLPDXXXXXXXXXXXXXXXAESFGYREVATPTFEYLELFTRKSGEG---IIEEMYVFKD
SYH_SULIY       -----VRGMKDYIGIDAEKIRYLESTFRDLAIKYGYSEIITPVVEEFKLFALKGG---EELRETMYVFKD
SYH_SULIN       -----VRGMKDYIGIDAEKIRYLESTFRDLAIKYGYSEIITPVVEEFKLFALKGG---EELRETMYVFKD
SYH_METJA       ------RGTRDFLPEEMKKRRFVENKLREVFERYGYKEILTPTFESFELIAKKTG---EEIRKQLYVFKD
SYH_MYCH2       ------KGTYDFFGQGAKIFIDVRKVFFNQAKKFNFSYIETPIFEYANIFLT-TNQIADIVSKELYKFFD
SYH_METMJ       ----------------------------------GYREVCTPDFEHLELFTMKSGEG---IIQEMYVFED
SYH_PYRAB       -----VKGTRDFLPEEMVKRRWVFEKIREVFETYGFKEVLTPVMEYTKLFQLRSG---EEVVKQLYAFKD
SYH_SULAC       -----IRGMKDYYGEELNKIKFIEETFRTVVLNSGYQEVYTPIVEDFKLFSLKSG---EEIRKTMYVFKD
SYH_META3       ------KGTRDFAPSEMKKRKIIENKLKSVFMAYNFNEINTPTFEYFELLSKKTG---EDIRKQLFVFKD
SYH_MYCS5       MKYQRVKGTQDYGVEKAFLKDAVESLFLKEVRLHGFEYVELPTLEHAQLFRSTV-AQSDIGNKEMYEFLD
SYH_METKA       MKVERPKGTRDFTPEEMRARRWLERYLLDVFRSYGYEEVLTPTFEHAKLFEEKSG---EEILEEMYVFKD
SYH_SULIA       -----VRGMKDYIGIDAEKIRYLESIFRDLAIKYGYSEIITPVVEEFKLFALKGG---EELRETMYVFKD
SYH_METM6       ------KGTRDFLPXXXXXXXXXXXXXXXVFDSYNFSEINTPTFESFELLSKKTG---EEIRKQLFVFKD
SYH_METVS       ------KGTRDFLPVEMKKRKLIEKKLRNIFDSYNFSEINTPTFESFELLSKKTG---EEIRNQLFVFND
SYH_METM7       -------------------------------------EINTPTFESFELLSKKTG---DEIRTQLFVFKD
SYH_METB6       ------RGTRDFLPDEMEARRSIEAKMREAVRRFGYREVCTPXXXXXXXXTLRSGEG---IMQEMYVFED
SYH_METAC       MTVNRPRGTRDFLPADTARRRYVESVMRNVVRNWGYSEIITPTFEHLDLFTLKSGEG---IVGELYNFTD
SYH_METMA       MSVNRPRGTRDFLPADTARRRYVESVMRNVVLNWGYSEIITPTFEHLDLFTLKSGEG---IIGELYNFTD
SYH_MYCPU       MKFQKLKGTRDYYSNKLEIIRNAFFTSAKKFNFSF---LETPIIENVELFKRTSGDFSDLVKKELYSFED
SYH_METS5       -----MRGMEDYFDVDSKIIRWIESNFRETVEKAGYKEAMTPIVEDFELFSLKGG---EELRNTMYVFKD
SYH_MYCGA       ----AVRGTTDWFDQAMILFNAISHKIIALSDLYTFQRIKTPVFEHAELFSRNL-EHSDIVKKELYQLID
SYH_METM5       -------------------------------------EINTPTFESFELLSKKTG---DEIRTQLFVFKD
SYH_WOLSU       ITPRTLSGFKDRLPQEAMAKSRLLRTVSEVFEGFGFVPIETPHLEYAEILVK---QGSDEIQKELYRFFD
SYH_HALMA       ----SVKGFRDFYPKEMQARRWAMDTLEDVAQRYGFREIGTPALEPTEMY---VDKSGEEIVEELYSFED
SYH_THENV       ---RPPRGMRDWLPPQLYALIEMEERLSKVAESFGYRRVETPVVEHFEVLAKKAGQE---VVNEIYYFKD
SYH_PYRIL       ---RPPRGMRDWLPPQFYALRHMEETLSKVAEAFGYRRVETPVVEHFEVLAKKAGQE---VVNEIYYFKD
SYH_LEPBL       LTTAPYKGTRDFYPEEMRLRNWMFSIMRETVLSFGYEEYDGPILESFDLYKAKSGE--EIVERQLYDFID
SYH_LEPBJ       LTTAPYKGTRDFYPEEMRLRNWMFSIMRETVLSFGYEEYDGPILESFDLYKAKSGE--EIVERQLYDFID
SYH_HALSA       -----LKGFRDFYPAEMGPRRXXXXXXXXXXXSYGFREVGTPAMERTEMYVDKSGAE---IVDELYSFTD
SYH_HALS3       -----LKGFRDFYPAEMGPRRXXXXXXXXXXXSYGFREVGTPAMERTEMYVDKSGAE---IVDELYSFTD
SYH_PYRAE       ---RPVRGMRDWLPPQYYALRHMEEVLCKVAESFGYRRVETPVVEHFEVLAKKAGQ--DVIN-EIYYFKD
SYH_LEPIN       LTTAPYKGTRDFYPEDMRLRNWMFSVMRETVLSFGYEEYDGPILESFDLYKAKSGE--EIVERQLYDFID
SYH_RHOBA       ---RTLKGFRDYLPAAMIPREQLMQTAREVFRSFGFAPIDTPTLEHLEIL---TGKGSDETDRQLYSFED
SYH_PYRAR       ---RPVRGMRDWMPQQLYALRRMEEVLSSVAEQYGYRRVETPVVEHFEVLAKKAGQE---VINEIYYFRD
SYH_OPITP       -TFQSLPGFREFYPDALARRNHIFRLWRQTAVAFGFAEYDAPVLEPLELYKTKSG---DEIEAQLFSFTD
SYH_LEPIC       LTTAPYKGTRDFYPEDMRLRNWMFSVMRETVLSFGYEEYDGPILESFDLYKAKSGE--EIVERQLYDFID
SYH_LEPBP       LTTENYKGTRDFYPEDMRLRNYLFSVMKDVVRSYGYEEYDGPMVESLDLYRAKTGE--EIVGKQIYNFID
SYH_LEPBA       LTTENYKGTRDFYPEDMRLRNYLFSVMKDVVRSYGYEEYDGPMVESLDLYRAKTGE--EIVGKQIYNFID
SYH_THEAC       -----IRGFRDFYPEDMDVEKFIFKTXXXXXXXFGFRRIDFPSLEYLDLYRIKSG---EELLQQTYSFVD
SYH_BRUME       MKARLPRGFVDRVPDDLRAAEKMMATIREVYDLYGFEPVETPLVEYTDALGKFL-PDQDRPNEGVFSFQD
SYH_BRUMB       MKARLPRGFVDRVPDDLRAAEKMMATIREVYDLYGFEPVETPLVEYTDALGKFL-PDQDRPNEGVFSFQD
SYH_BRUSU       MKARLPRGFVDRVPDDLRAAEKMMATIREVYDLYGFEPVETPLVEYTDALGKFL-PDQDRPNEGVFSFQD
SYH_BRUSI       MKARLPRGFVDRVPDDLRAAEKMMATIREVYDLYGFEPVETPLVEYTDALGKFL-PDQDRPNEGVFSFQD
SYH_BRUC2       MKARLPRGFVDRVPDDLRAAEKMMATIREVYDLYGFEPVETPLVEYTDALGKFL-PDQDRPNEGVFSFQD
SYH_BRUAB       MKARLPRGFVDRVPDDLRAAEKMMATIREVYDLYGFEPVETPLVEYTDALGKFL-PDQDRPNEGVFSFQD
SYH_BRUA2       MKARLPRGFVDRVPDDLRAAEKMMATIREVYDLYGFEPVETPLVEYTDALGKFL-PDQDRPNEGVFSFQD
SYH_BRUA1       MKARLPRGFVDRVPDDLRAAEKMMATIREVYDLYGFEPVETPLVEYTDALGKFL-PDQDRPNEGVFSFQD
SYH_HELPJ       ITPKVLSGFKDRLPKDAIQKAQLLAKVSVVFQSFGFVPIETPHLEYAQTL---LPDASSDIQKEIYRFKD
SYH_HELPH       ITPKVLSGFKDRLPKDAIQKAQLLAKVSVVFQSFGFVPIETPHLEYAEVL---LPDASSDIQKEIYRFKD
SYH_HELAH       ITPKVLSGFKDRLPKDAIQKAQLLSKVSVVFQSFGFVPIETPHLEYAETL---LPDASSDIQKEIYRFKD
SYH_PARDP       --AETPKGFRDYFGADVTERKQMLDRIAQIYHRHGFEPLETSAVETVEALGKFL-PDVDRPNAGVFAWQE
SYH_HELP2       ITPKVLSGFKDRLPKDAIQKAQLLAKVSVVFQSFGFVPIETPHLEYAQTL---LPDTSSDIQKEIYRFKD
SYH2_BACSK      -----VRGTQDYLPEDESVRVWLRRELEEVFQQYGCKPMETPMINYTDLLASKYGGGAEI-KKEMYTLTD
SYH_PYRCJ       ---RPVRGMRDWLPHXXXXXXXXXXXXSRVAESFGYRRVETPVVEHFEVLARKAGQE---IVNEIYYFRD
SYH_HELPG       ITPKVLSGFKDRLPKDAIQKAQLLAKVSVVFQSFGFVPIETPHLEYAEAL---LPDASSDIQKEIYRFKD
SYH_STRM5       ---RTPPGTLELLPREQIAFQRMLDVIRRNYERFGFLPVETPVFELSDVLLTKSGGETE---RQVYFVQE
SYH_HELPY       ITPKVLSGFKDRLPKDAIQKAQLLAKVSVVFQSFGFVPIETPHLEYAQTL---LPDASSDIQKEIYRFKD
SYH_STRMK       ---RTPPGTLELLPREQIAFQRMLDVIRRNYERFGFLPVETPVFELSDVLLTKSGGETE---RQVYFVQE
SYH_CLOTE       -------GFMELLPADQIVFNKMKDTIRHNYEKFGFIPLDTPTIEKSEILLAKGGGETE---KQIYRF-N
SYH_CYTH3       ------KGTRDFGPAQMLKRQYLLQTIREIFTKYGFLPIETPAMENLSVLTGKYGDEGDQLIYKILNSGD
SYH_BARBK       ---RLPRGFVDRTSAQLHALETMIAQIHEVYESYGFEALETPIFEYTDVLGKFL-PDSDRPNAGVFSLQD
SYH_TREDE       ---KVLKGFRDFLPADEIERALLMERLVKVFRDYGFVPIDTPALEYSEILLRKSGGETE---KQVFRFSD
SYH_BARQU       --ARLPRGFIDRTSAQLYATETMIAQIREVYELYGFEALETPIFEYTDVLGKFL-PDEDRPNAGVFSLQD
SYH_THEVO       MQIERIKGFRDFYPEDMEIEKFIFETASSVAESYGFKRIDFPSLEYIDLYRIKSG---EELLNQTYSFTD
SYH_HELHP       VTPRTLSGFKDRLPKEALAKAHLLNKVSNVFMNFGFVPIETPHLEYADVLIK---QGSDEIQKELYRFKD
SYH_GRAFK       ------KGTRDFSPEEVAKRNYIFNTIQTEFKGFGFQPIETPSFENSSTLMGKYGDEGDLKKADKDALAN
SYH_BRUO2       MKARLPRGFVDRVPDDLRAAEKMMATIREVYDLYGFEPVETPLVEYTDALGKFL-PDQDRPNEGVFSFQD
SYH_CAUCR       --ARAPRGFADKRARDLRAERAILEAVSAVYERYGFEALDTGAFEYADALGKFL-PDSDRPNEGVFALQD
SYH_XANC5       ---RTPPGIMELLPREQIAFQRMLDVIRRNYERFGFLPVETPVFELSDVLLTKSGGETE---RQVYFVQS
SYH_HELPS       ITPKVLSGFKDRLPKDAIQKAQLLSKVSVVFQSFGFVPIETPHLEYAEVL---LPDASSDIQKEIYRFKD
SYH_PARD8       ------KGTRDFSPEEMAKRNYIFNTIREVFHLYGFQQIETPAMENLSTLMGKYGEEGDLMEKNPLRFAA
SYH_SILST       ------KGFRDYFGEEVTQRTHMLATIAEVYHHYGFEALESSAVETVEALGKFL-PDVDRPNEGVFAWQD
SYH_HALWD       -----LKGFRDFYPPEMTARRQVIDILETTATQYGFREVGTPTLEQTQMY---VDKSGEGIEEELYAFSD
SYH_XANAC       ---RTPPGIMELLPREQIAFQRMLDVIRRNYERFGFLPVETPVFELSDVLLTKSGGETE---RQVYFVQS
SYH_XANCP       ---RTPPGIMELLPREQIAFQRMLDVIRRNYERFGFLPVETPVFELSDVLLTKSGGETE---RQVYFVQS
SYH_SILPO       --AETPKGFRDYFGAEVTQRTEMLRDIAGVYHRYGFEALESSAVETVEALGKFL-PDVDRPNEGVFAWQD
SYH_RHIME       LRARLPRGFVDRSAADIRAVDEMIAKIREVYERYGFDPVETPLFEYTDALGKFL-PDSDRPNEGVFSLTD
SYH_XYLFT       ---RTPPGVLELLPREQIAFQRMLDVIRRNYERFGFLPVETPVFELSDVLLTKSGGETE---RQVYFVQS
SYH_XYLFM       ---RTPPGVLELLPREQIAFQRMLDVIRRNYERFGFLPVETPVFELSDVLLTKSGGETE---RQVYFVQS
SYH_XYLFA       ---RTPPGVLELLPREQIAFQRMLDVIRRNYERFGFLPVETPVFELSDVLLTKSGGETE---RQVYFVQS
SYH_XYLF2       ---RTPPGVLELLPREQIAFQRMLDVIRRNYERFGFLPVETPVFELSDVLLTKSGGETE---RQVYFVQS
SYH_BARHE       --ARLPRGFVDRTSAQLYAIEVMIAQIRQVYELYGFEALETPIFEYTDVLGKFL-PDEDRPNAGVFSLQD
HISZ_GEOSL      ------KGVTDFLPEKADKIGYIEGKIRKVFELWGFRRIITPLLEFEDVIAAGLG---DDLKAKTFRFDD
SYH_RHILW       LKARLPRGFVDRTAGDIRAVNEMTAKIREVYEHYGFDPLETPQFEYTDALGKFL-PDSDRPNEGVFSLQD
SYH_XANOR       ---RTPPGIMELLPREQIAFQRMLDVIRRNYERFGFLPIETPVFELSDVLLTKSGGETE---RQVYFVQS
SYH_XANOP       ---RTPPGIMELLPREQIAFQRMLDVIRRNYERFGFLPIETPVFELSDVLLTKSGGETE---RQVYFVQS
SYH_PORGI       ------KGMRDFSPVEMSRRNYIFDTIREVYELFGFNQIETPTMEMLSTLMGKYGCAEELAEKNSLRFAA
SYH_XANOM       ---RTPPGIMELLPREQIAFQRMLDVIRRNYERFGFLPIETPVFELSDVLLTKSGGETE---RQVYFVQS
SYH_FLAJ1       ------KGTRDFSPAEVSKRQYIIQTIKANFEKFGFQPIETPSFENSDTLELQLNSAEKITLEQRIELNK
SYH_XANC8       ---RTPPGIMELLPREQIAFQRMLDVIRRNYERFGFLPVETPVFELSDVLLTKSGGETE---RQVYFVQS
SYH_AGRRK       LKARLPRGFVDRSASDIRAVNEMTAKIRAVYEHYGFDPMETPLLEYTDALGKFL-PDSDRPNEGVFSLQD
SYH_RHIL3       LKARLPRGFVDRTAGDIRAVNEMTAKIREVYEHYGFDPLETPLFEYTDALGKFL-PDSDRPNEGVFSLQD
SYH_BRAJA       LKARLPRGLEDRDPAAIRATREMVEKIRAVYELYGFEPVETPAMEYTDALGKFL-PDQDRPNEGVFSFQD
SYHC_DICDI      ------KGTQDYNPRQMTIREQVFDGIKQVFKRHGAVTIETPVFELKETLTGKYGEDSKLI----YDLQD
SYH_NATPD       -----LKGFREFYPGEMSARREVTDTIETRARRYGFREVGTPALERTQLY---VDKSGEEIVEELYAFED
SYH_KORCO       ------RGFRDFPPPMMILRKRVLSKIEEIFRRYGFDPIETPSLEYWETVKGKLGEEAE--NKLMFIFPD
SYH_JANSC       --AETPKGFRDYFGAEVVERQTMLRKIGEVYHRYGFDPLETSAVETVEALGKFL-PDVDRPNEGVFAFQE
SYH_DINSH       --AQTPKGFRDYFGTEVTERKAMLDKIAEVYHLYGFDPLETSAVETVEALGKFL-PDVDRPNEGVFAWQE
HISZ_HALOH      --------------------------------------IITPTLEYYESLTTGIG---EKYKKQMYKFID
SYH_BACTN       ------KGTRDFSPVEMAKRNYIFNTIRDVYHLYGFQQIETPSMEMLSTLMGKYGDEGD---KLLFKIQN
SYH_BACFN       ------KGTRDFSPVEMAKRNYIFNTIRDVYHLYGFQQIETPSMEMLSTLMGKYGEEGD---KLLFKIQN
SYH_ORYSJ       ------KGTRD-FGKEIREHAFSIITG--VFKMHGAVSLDTPVFELRETLMGKYGEDSKLI----YDLAD
SYH_BACFR       ------KGTRDFSPVEMAKRNYIFNTIRDVYHLYGFQQIETPSMEMLSTLMGKYGEEGD---KLLFKIQN
SYH_ROSDO       --AQTPKGFRDYFGAEVSQRAEMLQRIAGVYHRYGFDALESSGVETVEALGKFL-PDVDRPNEGVFAWQD
SYH_BACV8       ------KGTRDFSPVEMAKRNYIFNTIRDVFHLFGYQQIETPSMENLSTLMGKYGDEGD---KLLFKIQN
SYH_HALLT       -----LKGFRDFYPGEQSARREVTDAIEDAASRYGFREIATPALERTEMY---VDKSGEEIVEELYAFED
SYH_AERPE       ------------------LRKRLLSRLERVFESYGFDPLDTPAVEYWETLSGKYGEEAE--SRLIWRFQD
SYH_GLOVI       -------GTRDFLPDEMIRREYVIDTLKTIFRKYGFEPLETPAIERWETLEEGEKLIYHVVSSGSLGTLK
SYH_AGRT5       LKARLPRGFVDRSAADIHATNEMVDKIRRVYELYGFDPIETPLFEYTDALGKFL-PDSDRPNEGVFSLQD
SYH_RHOS4       --AETPKGFRDYFGADVTERKAMLDAVAEVYHRYGFDPLETSAVETVEALGKFL-PDVDRPNEGVFGWQD
SYH_RHOSK       --AETPKGFRDYFGADVTERKAMLDAVAEVYHRYGFDPLETSAVETVEALGKFL-PDVDRPNEGVFGWQD
SYH_RHOPB       LRARLPRGLADRGPAELAATRAMVETIRAVYERYGFEPVETPAFEFTDALGKFL-PDQDRPNEGVFSFQD
SYH1_BACC1      MEMKNVKGTKDYLPEEQVLRNKIKRACEDTFERYGCKPLETPTLNMYELMSYKYGGGDEIL-KEIYTLQD
SYH1_BACHK      MEMRNVKGTKDYLPEEQVLRNKIKRACEDTFERYGCKPLETPTLNMYELMSYKYGGGDEIL-KEIYTLQD
SYH_BORGA       MDVKTLKGFKDYLPKDSLIRIHIVKQIFSVLNSYNFDLIDTPVLEYSELLLKKSG---DESEKQIYRFKD
SYH_CLOAB       -------GFMELLPKEQLVFNDIVSKITGVYEQNGFLPMDTPIIEKEEVLLAKSAGETE---KQVYRI-D
SYH1_BACAN      MEIRNVKGTKDYLPEEQVLRSKIKRACEDTFERYGCKPLETPTLNMYELMSYKYGGGDEIL-KEIYTLQD
SYH_TREPS       VSPKVLKGFRDLLPDEEIERALLVEKLTVALRQMGFVPIDTPALEYTEVLLRKSEGDTE---KQMFRFVD
SYH_TREPA       VSPKVLKGFRDLLPDEEIERALLVEKLTVALRQMGFVPIDTPALEYTEVLLRKSEGDTE---KQMFRFVD
SYH1_BACCZ      MEMKNVKGTKDYLPEEQVLRNKIKRACEDTFERYGCKSLETPTLNMYELMSYKYGGGDEIL-KEIYTLRD
SYH_PICTO       MKIERLKGFRDHYPDDMEIRYDFIKKMMDTAISFGYKMIDFPSLESMDLYRLKSG--TELV-EQTFSFTD
SYHC_TAKRU      ---KTAKGTRDYNPKQMAIREKVFNTIVSCFKRHGAETIDTPVFELKETLTGKYGEDSKLI----YDLKD
SYHM_BOVIN      -TIKTPKGTRDLSPQQMVVREKILDVVVSCFKRHGAKGLDTPAFELKEILTEKYGEDSGLI----YDLKD
SYH_FINM2       ----------------------------------------TPAIEKLDVLLSKGGGETS---KQVFRI-D
SYH1_BACCR      MEMRNVKGTKDYLPEEQVLRNKIKRACEDTFERYGCKPLETPTLNMYELMSYKYGGGDEIL-KEIYTLQD
HISZ_SYMTH      -------GVRDRLPSEAAAMRRLSARLDNVFRAWGYREVSTPVIEYLEAV--AAGAANWGRREDLYQFFD
SYH_BORAP       MDIKTLKGFKDYLPKDSLIRIHIVRQIFSVLNSYNFDLIDTPVLEYSELLLKKSG---DEAEKQIYRFKD
SYH_NANEQ       ------RGTKDFTPELAILWKEIVSKIESVYQKYGFDPIITPIVEYWDTLXXXXXXXXXXXXIWRFRVP-
SYH_ANASP       -------GFPEFLPSEKRLELYLLDTIRRVYESYGFTPIETPAVERLEVLQAKGNQGDNIIQAEKDKSGD
SYHC_MOUSE      ------KGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLTGKYGEDSKLI----YDLKD
HISZ_CYAP8      -------GARDLLPLEVVQKAWINDRLQQVFGGWGYQRIVTSTIEWLETLMAG-GA---IQHSTVIQLQD
SYH_ANAVT       -------GFPEFLPSEKRLELYLLDTIRRVYESYGFTPIETPAVERLEVLQAKGNQGDNIIQAEKDKSGE
HISZ_CLOBK      -------GMKDILFKESNIKLNIEDQLRKVYKYSGFSEIISPTIEFYDVFNSNIQA---IPQEKMYKLFD
SYH_YEAST       VSLKTPKGTKDWADSDMVIREAIFSTLSGLFKKHGGVTIDTPVFELREILAGKYGEDSKLI----YNLED
SYH_MICLC       ----SLSGFHEWLPAERLVEQHVLDTLRRTFELHGAVETLGQLLRKGEV-DKEVYAVSRLAEDEEVAAGR
HISZ_GEOKA      -------GMRDTLPFLYELKKQVRSVMAEEIERWGYEFIETPTLE----YYETVGAASAIADHRLFKLLD
SYH_RHILO       --ARLPRGFADRSAEDIRAVEKMMATIRSVYELYGFEPADQPLIEYTDALGKFL-PDQDRPNEGVFSFQD
HISZ_BACP2      -------GMRDSLPGLYETKKKVRHSLTEVMNGWGYRLMETPTLE----FYDTVGVQSAITDTQLFKLLD
HISZ_DESRM      ---RLAPGVRDVLPAEAHLMRGLKEKFTKLVETWGYKEVVTPTFEYMENL-----ASXXXXXXXXXXXXD
SYH_TROWT       ------RGMQDFLPHEKEHRDRITEVIYKSYISHGFNPIETPSLENIERLACGVGQENEKLTYKIIRRGL
SYH_TROW8       ------RGMQDFLPHEKEHRDRITEVIYKSYISHGFNPIETPSLENIERLACGVGQENEKLTYKIIRRGL
HISZ_GEOSW      -------GMRDTLPFLYEIKKRVRQAMIREIETWGYELIETPTLE----YYETVGTVSAIDDHQLFKLLD
SYH_METSB       -SAKLPRGFGDRGPAEIAATEKMLAAIRASYELYGFEAVETPFIEFTDALGKFL-PDLDRPNEGVFSFKD
HISZ_LYSSC      -------GMRDTFPQIFEKVEAVRQTGRDFLTKRGYEFIKTPAVE----YFDTVGKASAIADTHLFKLVD
HISZ_DEHE1      MIARC-KGCSDLLPEDMLRFRYIESIFHDSCITWGYEEVRTPMLEYLSLFTSS-GTLTPQMLKRVYSFLD
SYH_BORBZ       MDIKTLKGFKDYLPKDSLIRIHIVRQIFSVLNSYNFDLIDTPVLEYSDLLLKKSGDETE---KQIYRFKD
SYH_BORBU       MDIKTLKGFKDYLPKDSLIRIHIVRQIFSVLNSYNFDLIDTPVLEYSDLLLKKSGDETE---KQIYRFKD
HISZ_CLOBJ      -------GMKDILFKESNIKLNIEDQLRKIYKYSGFSEIISPTIEFYDVFNSNIQA---IPQEKMYKLFD
HISZ_MOOTA      ----------------------------------GYQEVMTPTFEFATTFQAGSPAGEE---GALYKFID
HISZ_CLOB6      ------KGMKDILFEESNIKLDIEDQLRKIYKYSGFSEIISPTIEFYDVFNSNIQA---IPQEKMYKLFD
SYHM_PONAB      ------KGTRDLSPQHMVVREKILDLVISCFKRHGAKGMDTPAFELKETLTEKYGEDSGL----MYDLKD
HISZ_CLOBL      -------GMKDILFEESNIKLNIEDQLRKIYKYSGFSEIISPTIEFYDVFNSNIQA---IPQEKMYKLFD
HISZ_BACLD      -------GMRDTLPMLYETKKKVRSSLTEVMALWGYQFMETPALE----FYDTVGVQSAILDQQLFKLLD
SYH_SCHPO       -TLKTPKGTKDWCDKDVVLREHIFSTVTEIFKRHGGVTLDTPVFELKEILSGKYGEDSKLI----YDLKD
HISZ_BACC2      -------GTRDYLFEECTLIEEVEQKLRLTFLERGYEEIRTPTIEFYDVF---AFQNRPIDEEKMYKFFD
HISZ_THETN      -------GVQDFLPEEYEFKRNIEDKFREVFKSFGYKEIMPPTFEYSENFSHLFD------ENSMYRFFD
SYHM_HUMAN      ------KGTRDLSPQHMVVREKILDLVISCFKRHGAKGMDTPAFELKETLTEKYGEDSGL----MYDLKD
HISZ_BACCR      -------GTRDYLFEECTLIEEVEQKLRLTFLERGYEEIRTPTIEFYDVF---AFQNRPIDEEKMYKFFD
HISZ_BACC4      -------GTRDYLFEECTLIEEVEQKLRLTFLERGYEEIRTPTIEFYDVF---AFQNRPIDEEKMYKFFD
HISZ_GEOTN      -------GMRDTLPFLYEMKKQVRRTMAEEIERWGYEFIETPTLE----YYETVGTASAIADHRLFKLLD
SYH_SULSH       -----VRGMKDYIGIDAEKIRYLESIFRDLAIKYGYSEIITPVVEEFKLFALKGG---EELRETMYVFKD
HISZ_CYAP4      -------GARDVLPLEVAQKRWIEQRLQQTFHRWSYQQIITPTLERLETLMAG-GA---IQPETVIQFWD
HISZ_BACC3      -------GTRDYLFEECTLIEEVEQKLRRTFLERGYEEIRTPTIEFYDVF---AFQSRPIDEEKMYKFFD
HISZ_BACC0      -------GTRDYLFEECTLIEEVEQKLRRTFLERGYEEIRTPTIEFYDVF---AFQSRPIDEEKMYKFFD
HISZ_BACAH      -------GTRDYLFEECTLIEEVEQKLRRTFLERGYEEIRTPTIEFYDVF---AFQSRPIDEEKMYKFFD
HISZ_BACHK      -------GTRDYLFEECTLIEEVEQKLRRTFLERGYEEIRTPTIEFYDVF---AFQSRPIDEEKMYKFFD
HISZ_BACCZ      -------GTRDYLFEECTLIEEVEQKLRRTFLERGYEEIRTPTIEFYDVF---AFQSRPIDEEKMYKFFD
HISZ_BACCQ      -------GTRDYLFEECTLIEEVEQKLRRTFLERGYEEIRTPTIEFYDVF---AFQSRPIDEEKMYKFFD
HISZ_BACC7      -------GTRDYLFEECTLIEEVEQKLRRTFLERGYEEIRTPTIEFYDVF---AFQSRPIDEEKMYKFFD
HISZ_CLOTH      -------GVQDILQNECFFKKNLEDRIRKVFRASGYYEVETPIVEFYDVFSTEENI---IPQETMFKFFD
HISZ_BACWK      -------GTRDYLFEECTLIEEVEQKLRRTFLERGYEEIRTPTIEFYDVF---AFQNRPIDEEKMYKFFD
HISZ_THEP3      ----------------------------------GYQEIMPPTFEYSDNF------SVLFDENNLYRFFD
HISZ_BACAN      -------GTRDYLFEECTLIEEVEQKLRRTFLERGYEEIRTPTIEFYDVF---AFQSRPIDEEKMYKFFD
HISZ_BACAC      -------GTRDYLFEECTLIEEVEQKLRRTFLERGYEEIRTPTIEFYDVF---AFQSRPIDEEKMYKFFD
HISZ_BACAA      -------GTRDYLFEECTLIEEVEQKLRRTFLERGYEEIRTPTIEFYDVF---AFQSRPIDEEKMYKFFD
SYH_CAEEL       ------KGTRDYGPAQSALRNSVLQTVTETFNRYGAETIDTPVFELRDVL---MGKYGEEGGKLVYDLQD
HISZ_CYAA5      -------GARDLLPLEVVQKAWINDTLQQVFGQWGYQRIVTSTIERLDTLKAG-GAIED---ETVIQLHN
HISZ_THEPX      ----------------------------------GYQEIMPPTFEYNDNF------SVLFDENNLYRFFD
SYH_AZOPC       ------KGTRDFTPCEMDKRNYIFDTIRSVFYLYGFKQIETPALENLSTLLGKYGEEND---KLLFKILN
HISZ_RUBXD      MRSRAARGTRDVLPPE---STRLLDVQRRVLRLHGFREVITPALEYAEVVEEAR------LRDSAFKLFD
HISZ_CLOCE      -------GVQDILFDECYKKREIEKRIRNTFRSYGYYEIETPTIEFFDVFSSEI---EHFPQESMVKFFD
HISZ_BACA2      -------GMRDTLPGLYEAKKKVRSTLTDLIDKWGYQFMETPTLE----FYETVGVQSAIEEQQLFKLLD
SYH_BIFA0       ----SISGFPEWLPAERVVEQRVIDTLREVFELNGFIGIETRAVEQSSLLKKGETS------KEIYLLQE
SYHC_HUMAN      ------KGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLI----YDLKD
SYHC_BOVIN      ------KGTRDYSPRQMAVREKVFDVIISCFKRHGAEVIDTPVFELKETLTGKYGEDSKLI----YDLKD
HISZ_CYAP7      -------GARDLLPLEVAQKGWINDCLQQVFQRWGYQRIVTSTIEWLDTLMAG-GA---IERSTVIQLQD
SYHC_PONAB      ------KGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLI----YDLKD
HISZ_ALKMQ      -------GVQDLLMKDCHHRRLIEGRLMEEWVKQGYMEVSSPTLEYYDLFRQG----EQMLRNKMFKLID
HISZ_BACC1      -------GTRDYLFEECTLIEEVEQKLRRTFLERGYEEIRTPTIEFYDVF---AFQSRPIDEEKMYKFFD
HISZ_DEHSC      MIARC-KGCSDLLPEDMLRFRYIESIFHDSCITWGYEEVRTPMLEYLSLFTSS-GTLTPQMLKRVYSFLD
HISZ_DESHD      ---RIPEGMHDLLPDELALQERAEASALDLFKAWAYQKVVTPTLE--------YGACIQPVEEEFFKLFD
HISZ_DEHSB      MIARC-KGCSDLLPEDMLRFRYIESIFHDSCITWGYEEVRTPMLEYLSLFTSS-GTLTPQMLKRVYSFLD
SYHM_MOUSE      ------KGTRDLSPQQMVVREKILDKIISCFKRHGAKGLDTPAFELTEKYEDNFGL--------MYDLKD
HISZ_GEOMG      ------KGVTDFLPEKADKIGYIEGKIRRVFELWGFRRIITPLLEFQDVMAAGLG---EDLKERTFRFDD
HISZ_BACSU      -------GMRDTLPGLYETKKKVRRSLTDLIDKWGYQFMETPTLE----FYDTVGVQSAIEEQQLFKLLD
HISZ_BACSK      -------GMRDVLPNLHSMQRKLGDRVLQEFRLWGYEQVQTPTLE----YYETVGKASAISDKQLFKLID
SYH_PROAC       ----------------------------------------------------------------------
HISZ_PROMM      MALQPAAGARDLNPQQVELNQKLSQRLAEVYRLWGYDEVSPPRVERLETLKAGGAIASDIVRLV------
HISZ_ANASP      MVYQPAAGARDLLPLDVAQKRWIEDKLQQVFHRWGYHRIITSTLERMDTLMAGEA----IQRQMVIQLQN
HISZ_OCEIH      -------------------------------------QIETPLFEDYDMYSNVQGT---VQQDDMVKVIH
HISZ_GEOSF      ----------------------------RIFELWGFRRIITPLLEFQDVISLGMG---EDLKEKTFRFDD
SYH_THEFY       ----------------------------------------------------------------------
SYH_NOSP7       -------GFPEFLPSEKRLELYLLDIIRRVFESYGFTPIETPAVERLEVLQAKGNQGDNIIYKSGETGKD
HISZ_ANAVT      MVYQPAAGARDLLPLDVAQKRWIEDKLQQVFHRWGYHRIITSTLERMDTLMAGEA----IQRQMVIQLQN
HISZ_SYNJB      -------GARDLLPREVQRREKLEAQLTRVFRRHGYQRIITPTLERLETLLAG----GSIRAESVLQLRD
SYH_BIFLI       ----SISGFPEWLPSERVVEQRVIDTLRKVFELNGFIGIETRAVETASLLKKGETS------KEIYLLQE
HISZ_THEEB      -------GARDILPLDVARQRWLEQRLERVFQSWGYQEIITPTIETLATLTAGGTVHPETV----IQVQG
HISZ_MICAN      -------GTRDLLPLEVTQKGWINDRLQSVFQRWGYQRIVTSTIEWLDTLTAGGAIDPSTVIQLHGDSQG
SYH_PELUB       ----------------------------------GALE--TPSFEISENIGSFLADDDSNPMSDVFSFKD
HISZ_CLOK5      -------GTKDILFQECKKKVQVENILREIYINSGFLEVKSPTLEFYDVFNI---ENSTLPQEKIYKLID
HISZ_SYNJA      ---RPPTGARDFLPREVQRRERLEAQLTQVFRRYGYQRIIXXXXXXXXXXXAGGSIRAEAVLQ----LRD
SYH_RHOPA       LRARLPRGLADRGPAEIAATRAMVEKIREVYERYGFEPVETPAFEYTDALGKFL-PDQDRPNEGVFSLQD
SYH_BIFLO       ----SISGFPEWLPSERVVEQRVIDTLRKVFELNGFIGIETRAVETASLLKKGETS------KEIYLLQE
HISZ_AQUAE      MKTSLISGERFYSLEESNLVKEIFKKAVKIFEAFGYDYINLSHFEPYEFQELTFGEGS----KEAITFKD
HISZ_BACHD      -------GMRDTLPEWYKTKKNICDQMTEEINLWGYDMIETPTLE----YYETVGVVSAIXXXXXXXXXX
HISZ_GLOVI      -------GVRDLLPLDVSQKLWIEQRLQRVFTRWGYQRIITPTLERMETLQ----ASGSVDLQAILQLRD
SYH_RHOPT       LRARLPRGLADRGPAEIAATRAMVEKIREVYERYGFEPVETPAFEYTDALGKFL-PDQDRPNEGVFSLQD
HISZ_CLONN      -------GMRDILFKECEEKLYVEKKLRNLYKLNGFSEIISPTLEFYDVFNF---ENQPIAQEKMYKLFD
HISZ_ACISJ      --------------------------------------VMPPLLEHLESLLTGTGEALDL---QTFKLVD
HISZ_SYNP2      -------GARDLLPLEVAQKAWINDNLQRVFQQWGYQRIVTSTLEWLETLT--AGGAVD--RTKVIQLQT
HISZ_NOSP7      MVYQPASGARDLLPLDVEKKRWIEDRLQQVFHRWGYHRIITSTLERMDTLMAGEA----IQRQMVIQLQN
HISZ_DIAST      --------------------------------------VMPPLLEHLESLLTGTGEALDL---QTFKLVD
HISZ_SYNP6      -------GTRDLLPQDVTQKRWIESRLQQVFQQWGYQRIITPTLERLDTLVAG-GA---VQRSAVIQVQS
HISZ_SYNE7      -------GTRDLLPQDVTQKRWIESRLQQVFQQWGYQRIITPTLERLDTLVAG-GA---VQRSAVIQVQS
HISZ_LACPL      -------GTRDEFGRRARTKQHLIAVIQAHFKQRGLAPIATPLLENEAVFD-----PYQMGNYQLYRLFG
HISZ_CLOAB      -------GSRDILFEECTIKNNIENILRNSYINVGYEEVRSPTLEFYDVYNL---ENQPISQEKMYKLFD
HISZ_LACLA      ---------------QVKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKTFNQEKMFQFIK
HISZ_PROM3      MALQPAAGARDLNPQQVELNQKLSQRLAEVYRLWGYDEVSPPRVERLETLKAGGAIASDIVRLV------
HISZ_PROMA      -------GNKDLNPQEVRKNQLISSRLSSIYERWGYEEVSPPKVERLETLT----ACGGISNKEIVKLV-
HISZ_LACLS      -----------------KMEQKL----RNLFESQNYQEVMPPNFESVELY---TGLDAGFEQEKMFQFIN
HISZ_PELCD      ------RGVKDFLPNKAAKLEYLKQSLKDVFHRWAFRPIMPPTLEYLDVLERGLGAG---LRDKTFRFDD
HISZ_STRTD      -------GMHDKLFKRARTMYQIEHCICDLLMTKGFLRIETPTLEHFEVF-------SDVVDNGNYNFFD
SYHC_MESAU      ------KGTRDYSPRQMAVREKVFDVIICCFKRHGAEVIDTPVFELKETLMGKYGQDCKLI----YDLKD
HISZ_LACC3      -------GTRDEFGPRAIRKENLIQTISQQFIQAGFERVKTPLLEYRDVFKP-----LAVSGEQPYQMLD
HISZ_SYNY3      -------GARDLLPLEVAQKARINDQLQQTFHRWGYQRIVTSTLEWLDTLVAG-GA---ISANNVIQLQD
HISZ_SYNR3      MALQPASGARDLLPRDVGVNRWIAEQLAAVYQRWGYEEVTPPSLERIDTLEAGGAIQSHQV------VQV
HISZ_RHORT      --ARALNGLRDVLPPDAAFEVATVERLVSVFAANGYERVKTPLIE----FEEGLGASRATAGQTFRVMDP
HISZ_LACCB      -------GTRDEFGPRAIRKENLIQTISQQFIQAGFERVKTPLLEYRDVFKP-----LAVSGEQPYQMLD
HISZ_STRSV      -------GMHDKLFKRARVTYEIERDISDFLMAQGFNRIDTPTLEHFEVF-------SDYVEPHHYHLFD
HISZ_LACLM      --------------------RKIEQKLRNLFESQNYQEVMPPNFEYVELY---TGLDAGFEQEKMFQFIN
HISZ_VEREI      --------------------------------------VMPPLMEHLESLLTGTGEALDL---QTFKLVD
HISZ_LISMF      -------GTRDKLFREAQAAYKIEQQVNHYFEKRGFKRIETPVIEFEDVFSSEHQADA-----KLYRFFD
HISZ_LISMC      -------GTRDKLFREAQAAYKIEQQVNHYFEKRGFKRIETPVIEFEDVFSSEHQADA-----KLYRFFD
SYH_LEIXX       ------RGMRDFLPAEKARREHALGVIRRSFSAHGFDEIETPVAEDVARLHAGLGGDNE---KLAFSVLK
HISZ_LISMO      -------GTRDKLFREARAAYKIEQQVNHYFEKRGFKRIETPVIEFEDVFSSEHQADA-----KLYRFFD
HISZ_RHOFD      ----------DVLPSEARHIEELRRSLLDTARCYGYELVMPPLLEHLESLLTGAGAALDL---QTFKLVD
HISZ_AZOVD      ---------------------RIEVVRRQMLDLFGYAFVVTPHIEFLESLLTGAGQDLDL--RTLKVTDP
HISZ_LISMH      -------GTRDKLFREAQAAYKIEQQVNHYFEKRGFKRIETPVIEFEDVFSSEHQADA-----KLYRFFD
HISZ_SYNS9      MALQPAAGARDLNPHQVETNRNITERLARVFRLWGYDEVSPPRVERMKTLMAGGAIASDIVRLV------
HISZ_STRGC      -------GMHDKLFKRARVTYEIERDISDFLMAQGFNRIDTPTLEHFEVF-------SDHVEPHHYHLFD
HISZ_NITEU      ---------EDVLPRDAYRIEKIRRLIMDMLFAHGYQFVMPPLLEYVESLLAGSGSGMNL---RMFKVVD
HISZ_LISW6      -------GTRDKLFREAQAAYKIEQQVNHYFEKRGFKRIETPVIEFEDVFSSEHQADA-----KLYRFFD
HISZ_PSEMY      --------------------------------------VVTPHIEYLESLLTGAGQDLDL---RTFKVTD
HISZ_OCHA4      ---------------------------RATLDMREAELVEIPLIQPADPF---LDMAGEDLRRRIFLTEN
HISZ_LISIN      -------GTRDKLFREARASYQIEQQVNHYFAKRGFKRIETPVIEFEDVFSSEHQADA-----KLYRFFD
HISZ_POLNS      -------------------------------------ELVAPILEFLDSLLTGTGSDLNL---QTFKLVD
HISZ_AGRT5      ----------------------------------------------------------------------
HISZ_DELAS      --------------------------------------VMPPMLEYLESLLTGTGEALDLQTCKLI--DQ
HISZ_SINMW      ----------------------------------------------------------------------
HISZ_RHILO      ----------------------------------------------------------------------
HISZ_ANASK      -------GLRDLLPDHSAHLAELSSKLHDVFSRFGYRRVFLPTLERLDVVERGLSPAA---LADVMKFVE
HISZ_ANADE      -------GLRDLLPDHSAHLAELSSKLHDVFSRFGYRRVFLPTLERLDVVERGLSPAA---LADVMKFVE
HISZ_ANAD2      -------GLRDLLPDHSAHLAELSSKLHDVFSRFGYRRVFLPTLERLDVVERGLSPAA---LADVMKFVE
HISZ_RHIE6      ----------------------------------------------------------------------
HISZ_MESSB      ----------------------------------------------------------------------
HISZ_DESHY      ---RIPEGMHDLLPDELALQEQAETSALDLFKAWAYQKVATPTLE--------YGACIQPVEEEFFKLFD
HISZ_RHIEC      ----------------------------------------------------------------------
HISZ_MAGSA      -------GLRDMLPPDAEFEASVVHSLMSMFARHGYDRVKPPLIEFEESLLDGAGGGTS---SQTFRVMD
HISZ_RHILW      ----------------------------------------------------------------------
HISZ_RHIL3      ----------------------------------------------------------------------
HISZ_SYNSC      MALQPAAGAKDLNPRQVETNRQLTERLASVYRLWGYDEVSPPRVERLATLMAG-GASSDIVRLV------
HISZ_GLUOX      -------GFADLLPGEAEAEARGIASVMEAFSRHGYQRVRPPLLEETSL----LGGSGESLAPQTFRLMD
HISZ_ALHEH      ---------------------------RQLLDQFGAYELVMPPFEYLDSLLTGTGHDLDV---QTFKLTD
HISZ_RHIME      ----------------------------------------------------------------------
HISZ_AGRRK      ----------------------------------------------------------------------
HISZ_NITEC      --------------------------------------VMPPLLEYVESLLAGSGSGMNL---RMFKVVD
PYLS_METBU      ----------------------------------GFLEIKSPIMIPFEYIERMGIDKDDHLNKQIF----
HISZ_METFK      ---------EDVLPAEAARVEQLRRSLLDLFKVHGYLYVIPPMMEYMESLTTGIGHDLDIATFKVV--DQ
HISZ_LACF3      -------GLRDNFGPQATQKESVRHYLTGLFQRHHYTLIETSLLEYRDVF-----GPYELQAESLYRILE
HISZ_BRUSU      ----------------------------------------------------------------------
HISZ_BRUSI      ----------------------------------------------------------------------
HISZ_BRUO2      ----------------------------------------------------------------------
HISZ_BRUME      ----------------------------------------------------------------------
HISZ_BRUMB      ----------------------------------------------------------------------
HISZ_BRUC2      ----------------------------------------------------------------------
HISZ_BRUAB      ----------------------------------------------------------------------
HISZ_BRUA2      ----------------------------------------------------------------------
HISZ_BRUA1      ----------------------------------------------------------------------
HISZ_AGRVS      ----------------------------------------------------------------------
HISZ_NITOC      -------------GELLPIEAEQMERARRVLHSWGYDLVVPPLIEYLESLLTGVG--TDLELQTFKLTDQ
SYP_PERMH       -----------------RVLKKIEGIIRKYMDDAGALEVLLPILAPAELWQE--TGRWDVYGKELFRVED
HISZ_THIDA      ---------------------RLEAMRRALLDLRGYQLVIPPLIEYVESLLTGVGADLDL---KTFKLVD
HISZ_STRMU      -------GMHDKLFKRARVMYEIERDISNLLIKQGFNRIETPTLEHFEVF-------ADDVSSEHYHLFD
HISZ_RHISN      ----------------------------------------------------------------------
HISZ_PROM1      MTLQPASGARDLNPQQVRKNHLIASKLSSLYQLWGYERISPPHIERLDTLTAAGGISNNEILKIV-----
SYP_DESVM       ----------------LKAIEKTAAIVREEMNRAGALELSMPMVQPADLWQES--GRWEFYGKELLRFQD
PYLS_METBA      ----------------------------------GFLEIKSPILIPAEYVERGINNDTEL-SKQIF----
HISZ_BURM1      ------------------------------------------------------------LRLRTFKLVD
HISZ_BURA4      ------------------------------------------------------------LRLRTFKLVD
HISZ_PROMT      MTLQPASGARDLNPQQVRKNHLIASKLSSLYQLWGYERISPPHIERLDTLTAAGGISNNEILKIV-----
SYT_WOLPP       ---------------------------RKKLMNNGYFEVKTPILVSKELWEKS--GHWDKFRENMFIIDE
PYLS_METAC      ----------------------------------GFLEIKSPILIPAEYVERGINSDTEL-SKQVF----
HISZ_HAHCH      -------GVEELLPPEATRIEELRRQLLDLYHSWGYEMIVPPLLEFLDSLLIGVGRDLEL---EMFKVTD
PYLS_METBF      ------------------------------------LEIKSPILIPAEYVERGINNDTEL-SKQIF----
SYP_FUSNN       -----------------RTIKKIENIVREEMDRAGALELLMPVVQPAELWQE--SGRWDVMGPEMLRLKD
HISZ_BURCM      ------------------------------------------------------------LRLRTFKLVD
SYP_VEREI       ----------------LRVLRKIEAIVREEMNRAGAVELTMPVVQPAELWQET--GRFDKMGPELLRIQD
HISZ_SYNPX      MALQPAAGARDLNPRQVESNRALSERLASVFRLWGYDEVSPPRVERLDTLMAGGAIASDVVRLV------
HISZ_PROM4      MAKQSTLGSKELNPRQVEENNLLATKLSEIYKKWGYQEVAPPQVEGLKTLMAGGGIDSKEILKLVID---
SYT_WOLWR       ---------------------------RKKLINNGYFEVKTPILVSKELWEKS--GHWDKFRENMFIVDE
SYP_HAEIG       ----------------IRVLKKVEKIIREEMNKGGAIEVLMPVVQPAELWEES--GRWDQYGPELLRFED
SYP_DESDG       ----------------LRSIEKAASIVRQEMNSAGAQELLMPMVQPADLWQES--GRWDFYGKELLRISD
SYP_ANAPZ       IVSQTASGIYTLLPLGLMVLRKVENIIREEINAVGFSEILMPTMQPADLWKES--QRYDSYGQELIRIHD
SYP_ANAMM       --------------KVLRTIERIV---REEMDSSGFLEILMPSVQPADLWRESL--RYDSYGPEMLRMQD
PYLS_METMA      ----------------------------------GFLEIKSPILIPLEYIERGIDNDTEL-SKQIF----
HISZ_RHOCS      -------GLRDLLPPDAEHEARVVGRLMKEFTRHGYERVKPPLIEFEEGLLSGPGRA---LAKQTFRLMD
SYT_WOLPM       ---------------------------RKKLINNGYFEVKTPILVSKELWERS--GHWDKFRENMFIVDE
SYP_DESMR       ----------------LKALNNVAKIVREEMDRAGALEILMPAVQPADLWKE--SGRWDFYGRELLRFVD
SYP_SYNSC       -----------------RVLQKITAVVREEMNRAGAQETLLPQLHPAELWQKGYTAGEGI----MFHLED
SYP_SYNR3       -----------------RVLRKVSAIVRQEMDAAGALETLLPQLQPAELWQRGRWSGYTAGEGIMFHLQD
SYP_SYNPX       --------------------QRITTIIREEMNRAGALETLLPQLHPSELWQRGYTAGEGI----MFHLED
SYP_HAEIE       ----------------IRVLKKVEKIIREEMNKGGAIEVLMPVVQPAELWEES--GRWEQYGPELLRFED
PYLS_METTE      ----------------------------------GFLEIKSPILIPMEYIER-MGIDND---KELSKQIF
HISZ_DECAR      ----------------------------------------------------------------------
SYT_PROA2       ----------------------------------------------------------------------
SYP_SYNS9       --------------------QRITAIVRDELNTAGAQETLLPQLHPAELWQRGYTAGEGI----MFHLED
SYP_STAS1       -----------------RVLNNIEAIVREEMERIDAVEILMPALQQAELWEES--GRWSAYGPELMRLQD
SYP_HELMI       -----------------RVLQRIMAIVREEMNAAGGQELLMPIIQPAEIWLQ--SGRWHVYGDELFRLKD
SYP_AQUAE       -------GIYELLPPAYKVLKKVESIIRKEMDRSGAQELLLTVLNPKELWEET--GRWETYGEELFKLKD
SYT_BURTA       --------------------QRVEQYMRRRLDAAGYLEIKTPMIMDRSLWE--ASGHWQNYRENMFTTES
SYP_SYNS3       -----------------RVLQRVMRIVREEMNQIGALETLLPQLQPAELWEKGYTAGEGI----MFHLED
SYP_PSEF5       ----------------LRVMRKVEAIVREEMNAAGALEVLMPSTQPAELWQE--SGRWEEYGPELLRFKD
SYP_PSEA6       ----------------LRVLNKVAQIVREEMDRAGSLEILMPVVQPADLWQE--SGRWDEYGPELLRIKD
HISZ_ACIBY      -------GVADVLPEQAQVIEKLRREAIDFLAVRGYQLVYTPFIEYIXXXXXXXXXNQDLDLVTFKVIDQ
HISZ_ACIBS      -------GVADVLPEQAQVIEKLRREAIDFLAVRGYQLVYTPFIEYIXXXXXXXXXNQDLDLVTFKVIDQ
HISZ_ACIBC      -------GVADVLPEQAQVIEKLRREAIDFLAVRGYQLVYTPFIEYIXXXXXXXXXNQDLDLVTFKVIDQ
HISZ_ACIB5      -------GVADVLPEQAQVIEKLRREAIDFLAVRGYQLVYTPFIEYIXXXXXXXXXNQDLDLVTFKVIDQ
HISZ_ACIB3      -------GVADVLPEQAQVIEKLRREAIDFLAVRGYQLVYTPFIEYIXXXXXXXXXNQDLDLVTFKVIDQ
ATKB1_ANASP     ----------------------------------------------------------------------
SYT_WOLTR       ---------------------------RKKLINNGYAEVKTPILVSKELWEKS--GHWDKFRENMFIVDE
SYSM_MOUSE      ------------------------------LVSRGFTPMTVPDLLRGAVFE-GCGMTPNANPSQIYNIDP
SYP_RHOFD       -------GIYSLMPMGLRVVRKVEQIVREEMNRAGAVELVMPVVQPAELWQE--TGRFESNGPELLRIKD
SYP_PROM4       -----------------RVIQKINCIIREELNAKGCLEALLPQLHPSDLWKKGYTAGEGI----MFNLKD
HISZ_BURCJ      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           RGGRSLTLRPEGTAAMVRAYLEHGMKVWPQPVRLWMAGPMFRAERPQKGRYRQFHQVNYEALGSENPILD
SYH_THET8       RGGRSLTLRPEGTAAMVRAYLEHGMKVWPQPVRLWMAGPMFRAERPQKGRYRQFHQVNYEALGSENPILD
SYH_THET2       RGGRSLTLRPEGTAAMVRAYLEHGMKVWPQPVRLWMAGPMFRAERPQKGRYRQFHQVNYEALGSENPILD
SYH_DEIRA       HGG--YVLRPEGTASIVRAYLENGLKQLPAPLKLWTSGPMFRAERHQKGRYRQFTQVDYEVLGSADALVD
SYH_DEIDV       HGG--FILRPEGTAGLVRSYLQNGLKQLPAPLKLWTHGPMFRAENVQKGRLRQFHQVDYEVLGSADALVD
SYH_DEIGD       HGG--YVLRPEGTAGIVRAYLQNGLKQLPAPLKLWTHGPMFRAENVQKGRLRQFHQVDYEALGSADPLVD
SYH_HALOH       KGGRSITLRPEGTASVVRAFLEHKIYGQVQPTKYFYIGPMFRYERPQAGRFRQFHQLGVEAFGSNDPALD
SYH_CYAP4       RGERSLTLRPEGTAGVVRALIEHKLFAQGGVQRLWYTGPMFRYERPQAGRQRQFHQLGVEVLGSADPRAD
SYH_SYNP2       RGDRPITLRPEGTAGAVRAYIERKLFAQGGVQRLWYTGPMFRYERPQAGRQRQFHQVGVEVLGSADPRAD
SYH_THESQ       KAGRSITLRPEGTAPVVRAFLENSLIDRGFQQRYYYIGPMFRYEKPQSGRLRQFHQVGFEIIGPESPKAD
SYH_THEMA       KAGRSITLRPEGTAPVVRAFLENSLIDRGFQQRYYYIGPMFRYEKPQSGRLRQFHQVGFEIIGPESPKAD
SYH_SYNJA       RGEQEVSLRPENTAGVVRAYIQHGLQVAGDVQRLWYCGPMFRYERPQAGRQRQFHQLGVELLGSRDPRAD
SYH_THEEB       RAQRSLTLRPEGTAGVVRAYIEHGLHSQGGVQRLWYLGPMFRYERPQSGRYRQFHQLGVEVLGSADPRAD
SYH_SOLUE       RDGSSLTLRPENTASVIRAYIEHRLDQRPGVQKLYYIGPMFRRERPQKGRYRQFFQIGAEAIGSESPVVD
SYH_GEOSW       RAGRSMTLRPEGTAPVVRSFVENKMYGNPQPIKLYYIGPMFRYERPQAGRFRQFVQFGVEAIGSNDPAID
SYH_RUBXD       KAGRELALRPEGTAGVVRAYVEHGLYKLAQPVKMWYFGPMFRHERQQKGRYRQHTQIGAEVLGSGDPLVD
SYH_DESHY       KGDRSITLRPEGTASVCRAYVENKLHGGPQPVKLYYIGPMFRYERPQSGRFRQFHQFGVEVLGVDKPMVD
SYH_DESHD       KGDRSITLRPEGTASVCRAYVENKLHGGPQPVKLYYIGPMFRYERPQSGRFRQFHQFGVEVLGVDKPMVD
SYH_ANOFW       RGGRSLTLRPEGTAAVVRSFVENKMYGDPQPVKLYYMGPMFRYERPQAGRFRQFVQFGVEALGSNDPAID
SYH_GEOKA       KGGRALTLRPEGTAPVVRAFVEHKLYGSPQPLKLYYSGPMFRYERPEAGRFRQFVQFGVEALGSSDPAID
SYH_DESRM       RGDRSITLRPEGTASTVRAYVENKLHALPQPVKLYYTGPMFRYDRPQAGRYRQFHQFGVEVFGSNDPAID
SYH_PELTS       RGGRSITLRPENTAPAVRAYLENRLYAGPQPVKLFYAGPMFRYDRPQAGRFRQFHQLGVEVFGSHDPXXX
SYH_MICAN       RRQRSLTLRPEGTAGVVRAYIEHKLQAAGGVQRLWYKGPMFRYERPQAGRQRQFHQIGVELLGSDDPRAD
SYH1_BACSK      RGGRSLTLRPEGTAAVVRSYVNHKLYASPQPTKLYYTGPMFRYERPQAGRMRQFVQFGVEALGSASPQLD
SYH_LISIN       KGGRSLTLRPEGTASVVRAFVEHKLYEVSQPIKMYYNEPMFRYERPQGGRQRQFTQMGIEALGSDDPSID
SYH_BACA2       RKGRSLTLRPEGTAAAVRAFNENKLFANPQPTKLYYVGPMFRYERPQTGRFRQFYQFGIEAIGSKDPAVD
SYH_SYNE7       RGDRSLTLRPEGTAGTVRAYIEHGLASQGGVQRLWYTGPMFRYERPQAGRQRQFHQLGLELLGTXXXXXX
SYH_BACSU       RKGRSLTLRPEGTAAAVRAFNENKLFANPQPTKLYYVGPMFRYERPQTGRYRQFYQFGIEAIGSKDPAID
SYH_BACCN       RGDRSLTLRPEGTAPVVRSYVENKMGDATQPTKLYYIGQMFRYERPQAGRYRQFVQFGIEAIGSNDPAID
SYH_LISMF       KGGRSLTLRPEGTASVVRAFVEHKLGEVSQPIKMYYNEPMFRYERPQGGRQRQFTQMGIEALGSDDPSID
SYH_LISMO       KGGRSLTLRPEGTASVVRAFVEHKLYEVSQPIKMYYNEPMFRYERPQGGRQRQFTQMGIEALGSDDPSID
SYH_CYAP7       RGDRSITLRPEGTAGVVRSFIEHNLYATGGVQRLWYTGPMFRYERPQAGRQRQFHQIGLELLGSGDYRAD
SYH_ACIBL       KASQQLTLRPENTAGVVRAYIEHQMAKSGGLQKLYYIGPQFRRERPQKGRYRQFFQIGAEVIGSESPARD
SYH_SYNY3       RGDRPITLRPEGTAGVVRAYIEQNLQAAGGVQRLWYTGPMFRYERPQAGRQRQFHQLGVEVLGSADPRAD
SYH_BACLD       KKGRSLTLRPEGTASAVRSFVENKLFANPQPTKLYYIGPMFRYERPQTGRYRQFYQFGIEAIGSNDPAID
SYH_FERNB       KGGRSITLRPEGTAPVVRAFVEDGMIAQGFPQKYFYIGPMFRYERPQSGRQRQFHQFGAEIFGSSSAIAD
SYH_SYNP6       RGDRSLTLRPEGTAGTVRAYIEHGLASQGGVQRLRYTGPMFRYERPQAGRQRQFHQLGLELLGTXXXXXX
SYH_ACAM1       RGDRSITLRPEGTAGAVRSFIENKLHAQGGVQRLWYIGPMFRYERPGAGRQRQFHQIGVEALGSQDPRAD
SYH_THEAB       KGQRSITLRPEGTAPTIRAFIENSMMATGLPKRLFYIGPMFRYERPQKGRQRQFHQFGVELIGSPSPLAD
SYH_THEP3       KGGRSITLKPEGTSPAVRAFIEHNLYAETQPTKLYYITPVYRYERPQSGRLREHHQFGVEIFGAKSASAD
SYH_MACCJ       KGDRSLTLRPEGTAAVVRSYIENKMNGDAQPVKLYYNGPMFRYERKQKGRYRQFVQFGVEAIGSENPAID
SYH_THEM4       KGDRSITLRPEGTAPTIRAFIENSMVATGLPKRLFYIGPMFRYERPQAGRQRQFHQFGIELIGSSSSLAD
SYH_CYAA5       RGDRSLTLRPEGTAGVVRAYLQNNLYAAGGVQRLWYCGPMFRYERPQAGRQRQFHQIGLELIGTADPRAD
SYH2_BACC1      RGERSLTLRPEGTAPVVRSYVENKMGDATQPTKLYYIGQMFRYERPQAGRYRQFVQFGIEAIGSNDPAID
SYH_THEPX       KGGRSITLKAEGTSPAVRAFIEHNLYAETQPTKLYYITPVYRYERPQSGRLREHHQFGVEIFGAKNASAD
SYH2_BACHK      RGERSLTLRPEGTAPVVRSYVENKMGDATQPTKLYYIGQMFRYERPQAGRYRQFVQFGIEAIGSNDPAID
SYH2_BACCZ      RGERSLTLRPEGTAPVVRSYVENKMGDATQPTKLYYIGQMFRYERPQAGRYRQFVQFGIEAIGSNDPAID
SYH2_BACCR      RGERSLTLRPEGTAPVVRSYVENKMGDATQPTKLYYIGQMFRYERPQAGRYRQFVQFGIEAIGSNDPAID
SYH2_BACAN      RGERSLTLRPEGTAPVVRSYVENKMGDATQPTKLYYIGQMFRYERPQAGRYRQFVQFGIEAIGSNDPAID
SYH_ERWCT       RNGDSLTLRPEGTAGCVRAGIEHGI-LYNQEQRLWYVGPMFRYERPQKGRYRQFHQLGCEVFGLQGPDID
SYH_CORK4       RGGRSMTLRPEGTAGVMRAVIEHGLDRGQLPAKLVYAGPCFRYERPQAGRYRQFQQVGVEAIGVDDPALD
SYH_STAES       KGDRSLTLRPEGTAAVVRSYIEHKMQGEPQPIKLYYNGPMFRYERKQKGRYRQFNQFGVEAIGAENPSID
SYH_STAEQ       KGDRSLTLRPEGTAAVVRSYIEHKMQGEPQPIKLYYNGPMFRYERKQKGRYRQFNQFGVEAIGAENPSID
SYH_PECCP       RNGDSLTLRPEGTAGCVRAGIEHGI-LYNQEQRLWYVGPMFRYERPQKGRYRQFHQLGCEVFGLQGPDID
SYH_CYAP8       RGDRSVTLRPEGTAGVVRAYLQNNLYATGGVQRLWYQGPMFRYERPQAGRQRQFHQIGLELLGSGDPRAD
SYH_NATTJ       RGDRSLTLRPEGTAPAARLYVEHKLFNEPQPVKYYYIGPMFRYDRPQAGRYRQFHQFGVEVFGSLEPETD
SYH_CARHZ       KAGRSITLRPEGTAAVIRAYVEAKKYADPGPAKYFYIGPMFRYDKPQAGRLRQFHQLGVEILGSDEPMVD
SYH_ALKOO       RGGRSITLKPEGTAPAARSFIEHKLYADTQPTKMFYITPVFRYERPQAGRFREHHQFGVEAFGASSASVD
SYH_ENTFA       KGDRHVTLRPEGTAPIVRAFVENKLPEYTKPYKTYYMGPMFRYERPQAGRLRQFHQIGVEAFGSENPALD
SYH_DESDG       RKNRSLTMRPEATAGVMRAYIEGSLHSQEQVSKLFTFGPMFRYERPQKGRMRQFHQINCECLGPQEPYAD
SYH_THISH       RNGDSLTLRPEGTAGCVRAGIEHGL-LHNQQQRLWYMGPMFRHERPQKGRYRQFHQIGVETFGMDGPDID
SYH_STAS1       KGDRSITLRPEGTAAVVRSYIENKMQGLPQPIKLYYNGPMFRYERKQKGRYRQFTQFGVEAIGAENPGVD
SYH_LACPL       KGDRHITLRPEGTAGVVRAFVENKL-YGPQPYKVYYMGPMFRYERPQSGRLREFHQLGVEAFGSESAALD
SYH_SHEB8       NNGDSLTLRPEGTASTVRAGNENGL-LYNQEQRLWYMGPMFRHERPQKGRYRQFNQFGVEVYGIGTADID
SYH_SHEB5       NNGDSLTLRPEGTASTVRAGNENGL-LYNQEQRLWYMGPMFRHERPQKGRYRQFNQFGVEVYGIGTADID
SYH_SHEB2       NNGDSLTLRPEGTASTVRAGNENGL-LYNQEQRLWYMGPMFRHERPQKGRYRQFNQFGVEVYGIGTADID
SYH_PSEPF       RNGDSLTLRPEGTAACVRAVLEHGITGGGQVQKLWYIGPMFRHERPQKGRYRQFHQIGLEVFNLDGPDID
SYH_PARUW       KGGRSMSLRPEGTAPVMRSFIENQLHTIAPLQKLFYIAPMFRYERAQAGRYRQHHQFGAEAIGNSSPEQD
SYH_RHORT       RSGDSLTLRPENTAGVARAFISGGL-AQNVPVKLFYRGPMFRHERPQKGRLRQFHQVGVELIGAENPLAD
SYH_SHEB9       NNGDSLTLRPEGTASTVRAGNENGL-LYNQEQRLWYMGPMFRHERPQKGRYRQFNQFGVEVYGIGTADID
SYH_PSEPK       RNGDSLTLRPEGTAACVRAVLEHGITGNGQVQKLWYIGQMFRHERPQKGRYRQFHQIGVEVFNLDGPDID
SYH_PSEPG       RNGDSLTLRPEGTAACVRAVLEHGITGNGQVQKLWYIGQMFRHERPQKGRYRQFHQIGVEVFNLDGPDID
SYH_PSEP1       RNGDSLTLRPEGTAACVRAVLEHGITGNGQVQKLWYIGQMFRHERPQKGRYRQFHQIGVEVFNLDGPDID
SYH_ECOLU       RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDID
SYH_SHIB3       RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDID
SYH_SHEDO       RNSDSLTLRPEGTASTVRAGNEHGL-LYNQEQRLWYMGPMFRHERPQKGRYRQFHQFGVEVYGIGTADID
SYH_SERP5       RNGESLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYVGPMFRYERPQKGRYRQFHQLGAEVFGLQGPDID
SYH_SHISS       RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDID
SYH_SHIFL       RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDID
SYH_ECOUT       RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDID
SYH_ECOSM       RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDID
SYH_ECOLI       RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDID
SYH_ECOLC       RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDID
SYH_ECOL6       RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDID
SYH_ECOL5       RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDID
SYH_ECOK1       RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDID
SYH_ECOHS       RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDID
SYH_ECODH       RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDID
SYH_ECOBW       RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDID
SYH_ECO8A       RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDID
SYH_ECO81       RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDID
SYH_ECO7I       RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDID
SYH_ECO5E       RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDID
SYH_ECO57       RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDID
SYH_ECO55       RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDID
SYH_ECO45       RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDID
SYH_ECO24       RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDID
SYH_YERPY       RNGESLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRYERPQKGRYRQFHQLGAEVFGLPGPDID
SYH_YERPS       RNGESLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRYERPQKGRYRQFHQLGAEVFGLPGPDID
SYH_YERPP       RNGESLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRYERPQKGRYRQFHQLGAEVFGLPGPDID
SYH_YERPN       RNGESLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRYERPQKGRYRQFHQLGAEVFGLPGPDID
SYH_YERPG       RNGESLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRYERPQKGRYRQFHQLGAEVFGLPGPDID
SYH_YERPE       RNGESLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRYERPQKGRYRQFHQLGAEVFGLPGPDID
SYH_YERPB       RNGESLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRYERPQKGRYRQFHQLGAEVFGLPGPDID
SYH_YERPA       RNGESLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRYERPQKGRYRQFHQLGAEVFGLPGPDID
SYH_STRZT       KGDRHITLRPEGTAPVVRSYVENKLFAVQKPSKFYYMGPMFRYERPQAGRLRQFHQIGVECFGSSNPATD
SYH_STRPN       KGDRHITLRPEGTAPVVRSYVENKLFAVQKPSKFYYMGPMFRYERPQAGRLRQFHQIGVECFGSSNPATD
SYH_GEOTN       KGGRALTLRPEGTAPVVRAFVEHKLYGSPQPVKLYYAGPMFRYERPEAGRFRQFVQFGVEAIGSSDPAID
SYH_CHLP8       PNGRSLTLRPEMTAGVMRACLQKNLLSQSPVSKLYYISDLFRKERPQAGRQRQFTQFGAELLGVSNPAAV
SYH_KLEP3       RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYVGPMFRHERPQKGRYRQFHQIGAEVFGLQGPDID
SYH_ECO27       RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDID
SYH_YERP3       RNGESLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRYERPQKGRYRQFHQLGAEVFGLPGPDID
SYH_STRPI       KGDRHITLRPEGTAPVVRSYVENKLFAVQKPSKFYYMGPMFRYERPQAGRLRQFHQIGVECFGSSNPATD
SYH_SODGM       RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYVGPMFRYERPQKGRYRQFHQMGAEVFGQQGPDVD
SYH_SHIBS       LNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDID
SYH_VIBFM       RNGDSLTLRPEGTAGCVRAGIENGL-LYNQEQRLWYMGPMFRHERPQKGRYRQFHQVGVEVFGLNGPDVD
SYH_VIBF1       RNGDSLTLRPEGTAGCVRAGIENGL-LYNQEQRLWYMGPMFRHERPQKGRYRQFHQVGVEVFGLNGPDVD
SYH_STRPS       KGDRHITLRPEGTAPVVRSYVENKLFAVQKPSKFYYMGPMFRYERPQAGRLRQFHQIGVECFGSSNPATD
SYH_SHEAM       RNGDSLTLRPEGTASTVRAGNEHGL-LYNQEQRLWYTGPMFRHERPQKGRYRQFHQFGVEVYGIASADID
SYH_LACCB       KGDRMMALRPEGTAGVVRAYVENKLPEHAKPYKVYYLGPMFRYERPQSGRQRQFHQIGVEAFGSDSPVLD
SYH_LACC3       KGDRMMALRPEGTAGVVRAYVENKLPEHAKPYKVYYLGPMFRYERPQSGRQRQFHQIGVEAFGSDSPVLD
SYH_STRR6       KGDRHITLRPEGTAPVVRSYVENKLFAVQKPSKFYYMGPMFRYERPQAGRLRQFHQIGVECFGSSNPATD
SYH_STRPJ       KGDRHITLRPEGTAPVVRSYVENKLFAVQKPSKFYYMGPMFRYERPQAGRLRQFHQIGVECFGSSNPATD
SYH_STRP4       KGDRHITLRPEGTAPVVRSYVENKLFAVQKPSKFYYMGPMFRYERPQAGRLRQFHQIGVECFGSSNPATD
SYH_STRP2       KGDRHITLRPEGTAPVVRSYVENKLFAVQKPSKFYYMGPMFRYERPQAGRLRQFHQIGVECFGSSNPATD
SYH_PSEPW       RNGDSLTLRPEGTAACVRAVLEHGITGNGQVQKLWYIGQMFRHERPQKGRYRQFHQIGVEVFNLDGPDID
SYH_BURP8       ANGENLTMRPENTAAVVRASIEHNM-LYDGPKRLWYIGPMFRHERPQRGRYRQFHQVGVEALGFAGPDTD
SYH_SYNS3       RGDRSCTLRPEGTASVVRAALQHGL-LSQGAQRLWYGGPMFRYERPQAGRQRQFHQIGVEFLGASSPRSD
SYH_STRZP       KGDRHITLRPEGTAPVVRAYVENKLFAVQKPSKFYYMGPMFRYERPQAGRLRQFHQIGVECFGSSNPATD
SYH_SHIDS       RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQHLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDID
SYH_SALTI       RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGAEVFGLQGPDID
SYH_SALPK       RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGAEVFGLQGPDID
SYH_SALPA       RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGAEVFGLQGPDID
SYH_SALHS       RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGAEVFGLQGPDID
SYH_SALAR       RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGAEVFGLQGPDID
SYH_ECOSE       RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDID
SYH_SALCH       RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGAEVFGLQGPDID
SYH_STRZJ       KGDRHITLRPEGTAPVVRSYVENKLFAVQKPSKFYYMGPMFRYERPQAGRLRQFHQIGVECFGSSNPATD
SYH_STRP7       KGDRHITLRPEGTAPVVRSYVENKLFAVQKPSKFYYMGPMFRYERPQAGRLRQFHQIGVECFGSSNPATD
SYH_SALTY       RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGAEVFGLQGPDID
SYH_SALPC       RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGAEVFGLQGPDID
SYH_SALPB       RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGAEVFGLQGPDID
SYH_SALNS       RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGAEVFGLQGPDID
SYH_SALEP       RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGAEVFGLQGPDID
SYH_SALDC       RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGAEVFGLQGPDID
SYH_CLOTH       KGQRSITLRPEGTAGVVRSYIENGMASLPQPVKLYYNITAYRYENVQKGRYREFHQFGVEAFGAPGPSID
SYH_THETN       RSGRSITLKAEGTSPAVRAFIEHGLYAETQPTKLYYITPVYRYEKPQAGRLREHHQFGVEIFGAKSASAD
SYH_SALSV       RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGAEVFGLQGPDID
SYH_SALA4       RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGAEVFGLQGPDID
SYH_HELMI       RGGRDLTLRPEGTAPTVRALLEHKLYAGSLPVKLYYTGPMFRFGRPQTVRLRQFHQFGIEVFGASGPRVD
SYH_AQUAE       RKGRKLALRPEGTAGTVRAFIQHKLYALRPYVKLFYEGPMFRYERPQAGRYRQFHQIGAEVFGVAEPHAD
SYH_VIBCM       RNGDSLTLRPEGTAGCVRSGIENGL-LYNQEQRLWYMGPMFRHERPQKGRYRQFHQCGVEVFGLDGPDVD
SYH_VIBCH       RNGDSLTLRPEGTAGCVRSGIENGL-LYNQEQRLWYMGPMFRHERPQKGRYRQFHQCGVEVFGLDGPDVD
SYH_VIBC3       RNGDSLTLRPEGTAGCVRSGIENGL-LYNQEQRLWYMGPMFRHERPQKGRYRQFHQCGVEVFGLDGPDVD
SYH_THEP1       KAGRSITLRPEGTAPVVRAFLENSLIDRGFQQRYYYIGPMFRYEKPQSGRLRQFHQVGFEIIGSESPKAD
SYH_SHEWM       RNGDSLTLRPEGTASTVRAGNEHGL-LYNQEQRLWYMGPMFRHERPQKGRYRQFNQFGVEVYGIGTADVD
SYH_SALG2       RNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGAEVFGLQGPDID
SYH_PROMH       RGAQSLTLRPENTAGCVRAGIEHGL-LYNQEQRLWYLGPMFRYERPQKGRYRQFHQLGAEVFGLQGPDID
SYH_HAEI8       ND-EQLTLRPEGTAGCVRAAIEHGW-IYNNEQRLWYIGPMFRHERPQKGRYRQFHQVGVEVFGIANPEID
SYH_PHOLL       RNGESVTLRPENTAGCVRAGIEHGL-LYNQEQRVWYLGPMFRYERPQKGRYRQFYQLGAEVFGLQGPDID
SYH_ALCBS       RNGDSLTLRPEGTASCVRACEQHGL-LYNQTQRLWYAGPMFRHERPQAGRYRQFHQIGVETFGMTGPDID
SYH_AERHH       RNGDSLSLRPEGTASCVRAGIEHGL-LYNQERRMWYMGPMFRHERPQKGRYRQFHQFGVELFGINGPDID
SYH_YERE8       RNGESLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRYERPQKGRYRQFHQLGAEVFGLQGPDID
SYH_MANSM       RDNESLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYMGPMFRYERPQKGRYRQFHQAGVEVFGIANAEID
SYH_HAEIN       ND-EQLTLRPEGTAGCVRAAIEHGW-IYNNEQRLWYIGPMFRHERPQKGRYRQFHQVGVEVFGIANPEID
SYH_PSEF5       RNGDSLTLRPEGTAACVRAVLEHGITGGGQVQKLWYIGPMFRHERPQKGRYRQFHQIGCEVFNLDGPDID
SYH_AERS4       RNGDSLSLRPEGTASCVRAGIEHGL-LYNQERRMWYMGPMFRHERPQKGRYRQFHQFGVELFGINGPDID
SYH_HAES2       ND-EQLTLRPEGTAGCVRAAIEHGW-IYNNEQRLWYMGPMFRHERPQKGRYRQFHQVGVEVFGIANPEID
SYH_STRSV       KGDRHITLRPEGTAPVVRSYVENKLFAVQKPVKVYYMGSMFRYERPQAGRLREFHQIGAECFGSSNPATD
SYH_PHOPR       RNGDSLTLRPEGTAGCVRAGIQNGL-LYNQEQRLWYIGPMFRYERPQKGRYRQFHQVGVEVFGLNGPDVD
SYH_SHELP       RNGDLLTLRPEGTASTVRAGNEHGL-LYNQEQRLWYMGPMFRHERPQKGRYRQFNQFGVEVYGIASADID
SYH_SHEHH       RNGDSLTLRPEGTASTVRAGNEHGL-LYNQEQRLWYMGPMFRHERPQKGRYRQFHQFGVEVYGIPTADID
SYH_SHESH       RNGDSLTLRPEGTASTVRAGNEHGL-LYNQEQRLWYMGPMFRHERPQKGRYRQFNQFGVEVYGIGSADVD
SYH_SHEFN       RNSDSLTLRPEGTASTVRAGNEHGL-LYNQEQRLWYMGPMFRHERPQKGRYRQFHQFGVEVYGIGSADID
SYH_PSE14       RNGDSLTLRPEGTAACVRAVLEHGITGGGQVQKLWYIGPMFRHERPQKGRYRQFHQIGVEVFNLDGPDID
SYH_LYSSC       RGGRSLTLRPENTAGVVRAYVEHKMFGAPQPVKLSYLGPMFRYERQQAGRYRQFVQFGVEAIGSADPAID
SYH_GEOLS       KGGSSLTLRPEGTASVMRALIEHKLYALDSINKLYYMGPMFRHERPQKGRYRQFHQIGAEVTGAADPLID
SYH_PSESM       RNGDSLTLRPEGTAACVRAVLEHGITGGGQVQKLWYIGPMFRHERPQKGRYRQFHQIGVEVFNLDGPDID
SYH_HAES1       ND-EQLTLRPEGTAGCVRAAIEHGW-IYNNEQRLWYMGPMFRHERPQKGRYRQFHQAGVEVFGIANPEID
SYH_BURPP       ANGENLTMRPENTAAVVRAAIEHNM-LYDGPKRLWYIGPMFRHERPQRGRYRQFHQVGVEALGFAGPDAD
SYH_SHEPA       RNGDSLTLRPEGTASTVRAGNEHGL-LYNQEQRLWYMGPMFRHERPQKGRYRQFHQFGVEVYGIPTADID
SYH_LACLA       KGGRHIALRPEGTASAVRAYIENKLYAPEKPVKLWYDAPMFRYERPQSGRLRQFHQFGVECLGVKNPAVD
SYH_STRSY       KGERHITLRPEGTAPVVRSYVENKLFAVQKPAKFYYMGPMFRYERPQAGRLRQFHQIGVECFGSNNPATD
SYH_STRS2       KGERHITLRPEGTAPVVRSYVENKLFAVQKPAKFYYMGPMFRYERPQAGRLRQFHQIGVECFGSNNPATD
SYH_FUSNN       RGDRSITLRPENTASLVRCYLENAIYAKEEISRFYYNGSMFRYERPQAGRQREFNQIGLEVFGEKSPKVD
SYH_DESAD       RKGRSLTMRPEATAGIVRAYVENKIYQPGKVSKFFTFGPMFRYERPQAGRMRQFHQIDAEIFGAAEPQAD
SYH_PROMT       RGGRSCTLRPEGTASVARSIVQHGL-LNKGPQRLWYRGPMFRYERPQAGRQRQFHQIGVEFVGLASVISD
SYH_OCEIH       RGGRSLTLRPEGTASVARAYVENKLFGSPQPTKLFYFGSMFRYERPQKGRMRQLNQFGTEVIGSEDPAVD
SYH_PSEU2       RNGDSLTLRPEGTAACVRAVLEHGITGGGQVQKLWYIGPMFRHERPQKGRYRQFHQIGVEVFNLDGPDID
SYH_LACLM       KGGRHIALRPEGTASAVRAYIENKLYAPEKPVKLWYDAPMFRYERPQSGRLRQFHQFGVECLGLKNPAVD
SYH_EXISA       KGKDEYTLRPEGTASVVRAFVTNKLFGNPQPTKLYYMGPMFRYERPQKGRFRQLHQYGVEAIGSSDPAVD
SYH_ESCF3       RERDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYMGPMFRHERPQKGRYRQFHQIGLEVFGLQGPDID
SYH_BURXL       ANGENLTMRPENTAAVVRAAIEHNM-LYDGPKRLWYIGPMFRHERPQRGRYRQFHQVGVEALGFAGPDAD
SYH_HAEIG       ND-EQLTLRPEGTAGCVRAAIEHGW-IYNNEQRLWYIGPMFRHERPQKGRYRQFHQAGVEVFGIANPEID
SYH_PELPB       PKGRSLTLRPEMTAGVMRAALQNNLLSSAPVQKLYYIGELFRKERPQAGRQRQFSQFGAELLGVSSPAAV
SYH_VIBVY       RNGDSLTLRPEGTAGCVRAGIENGL-LYNQEQRVWYMGPMFRHERPQKGRYRQFHQCGVEVFGLNGPDVD
SYH_VIBVU       RNGDSLTLRPEGTAGCVRAGIENGL-LYNQEQRVWYMGPMFRHERPQKGRYRQFHQCGVEVFGLNGPDVD
SYH_SHESW       RNGDSLTLRPEGTASTVRAGNEHGL-LYNQEQRLWYMGPMFRHERPQKGRYRQFHQFGVEVYGIGSADID
SYH_SHEPC       RNGDSLTLRPEGTASTVRAGNEHGL-LYNQEQRLWYMGPMFRHERPQKGRYRQFHQFGVEVYGIGSADID
SYH_PSEFS       RNGDSLTLRPEGTAACVRAVLEHGLTGGGQPQKLWYIGPMFRHERPQKGRYRQFHQIGLEVFNLDGPDID
SYH_PELLD       PGGRSLTLRPEMTAGVMRAALQRNLLSQAPVHKLYYISELFRKERPQAGRQRQFSQFGAELLGVSSPAAV
SYH_ERWT9       RNGESLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRYERPQKGRYRQFHQIGAEVFGLQGPDID
SYH_CHRSD       RNGDSLTLRPEGTASCVRAALENGL-LYNQTQRLWYQGPMFRHERPQKGRYRQFHQVGVEAYGMLGPDID
SYH_BURVG       ANGENLTMRPENTAAVVRAAIEHNM-LYDGPKRLWYIGPMFRHERPQRGRYRQFHQVGVEALGFAGPDAD
SYH_GEOSL       KGENAVTMRPEGTASVMRSYIEHKLYAQDPVAKLYYMGPMFRYERPQKGRYRQFHQIGAEVTGVTDPKVD
SYH_BURP6       ANGENLTLRPENTAAVVRAAIEHNM-LYDGPKRLWYLGPMFRHERPQRGRYRQFHQVGVEALGFAGPDAD
SYH_BURCM       ANGENLTMRPENTAAVVRASIEHNM-LYDGPKRLWYIGPMFRHERPQRGRYRQFHQVGVEALGFAGPDAD
SYH_BURCJ       ANGENLTMRPENTAAVVRASIEHNM-LYDGPKRLWYIGPMFRHERPQRGRYRQFHQVGVEALGFAGPDAD
SYH_BURCC       ANGENLTMRPENTAAVVRASIEHNM-LYDGPKRLWYIGPMFRHERPQRGRYRQFHQVGVEALGFAGPDAD
SYH_BURA4       ANGENLTMRPENTAAVVRASIEHNM-LYDGPKRLWYIGPMFRHERPQRGRYRQFHQVGVEALGFAGPDAD
SYH_VIBPA       RNGDSLTLRPEGTAGCVRSCIQNSL-INRDEQRLWYMGPMFRHERPQKGRYRQFHQCGVEVFGLNGPDVD
SYH_PSEA6       RNDDSLTLRPEGTASVVRAGNEHGL-LYNQQQRLWYLGPMFRHERPQKGRYRQFHQFGVEVFGLAGPDID
SYH_HAEIE       ND-EQLTLRPEGTAGCVRAAIEHGW-IYNNEQRLWYIGPMFRHERPQKGRYRQFHQAGVEVFGIANPKID
SYH_BURS3       ANGENLTMRPENTAAVVRASIEHNM-LYDGPKRLWYIGPMFRHERPQRGRYRQFHQVGVEALGFAGPDAD
SYH_BURM1       ANGEHLTMRPENTAAVVRAAIEHNM-LYDGPKRLWYIGPMFRHERPQRGRYRQFHQVGVEALGFAGPDAD
SYH_PSEE4       NKD-SLTLRPEGTAACVRAVLEHGIIGNGQVQKLWYVGPMFRHERPQLGRYRQFHQIGVEVFNLAGPDID
SYH_PSEAE       RNGESLTMRPEGTAGCVRAVLEHGLSGGGQVQKLWYTGPMFRYEKPQKGRYRQFHQIGVEVFNLPGPDID
SYH_PSEAB       RNGESLTMRPEGTAGCVRAVLEHGLSGGGQVQKLWYTGPMFRYEKPQKGRY