[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tthe0:AAS80739.1

[Show Plain Result]


## Summary of Sequence Search
    1::342
   58::342     3e-17  30%  349 aa  Y087_METJA RecName: Full=Putative ABC transporter permease protein
   54::329     5e-14  45%  334 aa  HMUU_YERPE RecName: Full=Hemin transport system permease protein
  216::330     4e-11  42%  333 aa  YFMD_BACSU RecName: Full=Fe(3+)-citrate import system permease
   55::330     5e-11  33%  331 aa  BTUC_KLEP7 RecName: Full=Vitamin B12 import system permease protein
   56::326     1e-10  38%  333 aa  YFME_BACSU RecName: Full=Fe(3+)-citrate import system permease
  236::381     3e-09  25%  384 aa  FHUB_BACSU RecName: Full=Iron(3+)-hydroxamate import system
   60::112     3e-09  33%  343 aa  YFHA_BACSU RecName: Full=Probable siderophore transport system
   54::333     6e-09  29%  337 aa  Y1471_HAEIN RecName: Full=Probable ABC transporter permease protein
  215::333     6e-09  39%  335 aa  BTUC_YERPY RecName: Full=Vitamin B12 import system permease protein
  215::333     6e-09  39%  335 aa  BTUC_YERPS RecName: Full=Vitamin B12 import system permease protein
  215::333     6e-09  39%  335 aa  BTUC_YERPG RecName: Full=Vitamin B12 import system permease protein
  215::333     6e-09  39%  335 aa  BTUC_YERPE RecName: Full=Vitamin B12 import system permease protein
  215::333     6e-09  39%  335 aa  BTUC_YERPB RecName: Full=Vitamin B12 import system permease protein
  215::333     6e-09  39%  335 aa  BTUC_YERP3 RecName: Full=Vitamin B12 import system permease protein
   50::326     6e-09  27%  331 aa  BTUC_VIBVY RecName: Full=Vitamin B12 import system permease protein
   50::326     6e-09  27%  331 aa  BTUC_VIBVU RecName: Full=Vitamin B12 import system permease protein
   48::111     2e-08  47%  334 aa  FEUB_BACSU RecName: Full=Iron-uptake system permease protein feuB;
  215::330     2e-07  46%  335 aa  BTUC_SERP5 RecName: Full=Vitamin B12 import system permease protein
  186::331     4e-07  20%  336 aa  FEUC_BACSU RecName: Full=Iron-uptake system permease protein feuC;
   52::108     4e-07  58%  326 aa  BTUC_SALTY RecName: Full=Vitamin B12 import system permease protein
   52::108     4e-07  65%  326 aa  BTUC_SALTI RecName: Full=Vitamin B12 import system permease protein
   52::108     4e-07  58%  326 aa  BTUC_SALSV RecName: Full=Vitamin B12 import system permease protein
  211::321     4e-07  53%  326 aa  BTUC_SALPK RecName: Full=Vitamin B12 import system permease protein
   52::108     4e-07  58%  326 aa  BTUC_SALPB RecName: Full=Vitamin B12 import system permease protein
  211::321     4e-07  53%  326 aa  BTUC_SALPA RecName: Full=Vitamin B12 import system permease protein
   52::108     4e-07  58%  326 aa  BTUC_SALNS RecName: Full=Vitamin B12 import system permease protein
   52::108     4e-07  58%  326 aa  BTUC_SALHS RecName: Full=Vitamin B12 import system permease protein
   52::108     4e-07  58%  326 aa  BTUC_SALG2 RecName: Full=Vitamin B12 import system permease protein
   52::108     4e-07  58%  326 aa  BTUC_SALEP RecName: Full=Vitamin B12 import system permease protein
   52::108     4e-07  58%  326 aa  BTUC_SALDC RecName: Full=Vitamin B12 import system permease protein
  211::321     4e-07  53%  326 aa  BTUC_SALCH RecName: Full=Vitamin B12 import system permease protein
   52::108     4e-07  58%  326 aa  BTUC_SALA4 RecName: Full=Vitamin B12 import system permease protein
   55::111     4e-07  55%  329 aa  BTUC_CITK8 RecName: Full=Vitamin B12 import system permease protein
   52::108     5e-07  48%  326 aa  BTUC_SHIDS RecName: Full=Vitamin B12 import system permease protein
   58::119     5e-07  49%  335 aa  BTUC_PHOLL RecName: Full=Vitamin B12 import system permease protein
   59::106     9e-07  60%  326 aa  Y889_HELPY RecName: Full=Probable iron chelatin transport system
   54::106     9e-07  59%  326 aa  Y889_HELPJ RecName: Full=Probable iron chelatin transport system
   55::119     9e-07  61%  329 aa  BTUC_SALAR RecName: Full=Vitamin B12 import system permease protein
  244::318     1e-06  53%  318 aa  FECD_ECOLI RecName: Full=Fe(3+) dicitrate transport system permease
  254::324     1e-06  34%  331 aa  BTUC_VIBPA RecName: Full=Vitamin B12 import system permease protein
   55::113     2e-06  69%  334 aa  FEPD_ECOLI RecName: Full=Ferric enterobactin transport system
   52::108     4e-06  52%  326 aa  BTUC_SHIB3 RecName: Full=Vitamin B12 import system permease protein
  209::325     4e-06  49%  326 aa  BTUC_ESCF3 RecName: Full=Vitamin B12 import system permease protein
   52::108     4e-06  52%  326 aa  BTUC_ECOLC RecName: Full=Vitamin B12 import system permease protein
   52::108     4e-06  52%  326 aa  BTUC_ECOHS RecName: Full=Vitamin B12 import system permease protein
   52::108     4e-06  52%  326 aa  BTUC_ECO55 RecName: Full=Vitamin B12 import system permease protein
  191::294     6e-06  26%  353 aa  YVRB_BACSU RecName: Full=Uncharacterized ABC transporter permease
   52::108     1e-05  46%  326 aa  BTUC_SHISS RecName: Full=Vitamin B12 import system permease protein
   52::108     1e-05  53%  326 aa  BTUC_SHIFL RecName: Full=Vitamin B12 import system permease protein
   52::108     1e-05  53%  326 aa  BTUC_SHIF8 RecName: Full=Vitamin B12 import system permease protein
   52::108     1e-05  53%  326 aa  BTUC_ECOUT RecName: Full=Vitamin B12 import system permease protein
   52::108     1e-05  53%  326 aa  BTUC_ECOSM RecName: Full=Vitamin B12 import system permease protein
   52::108     1e-05  53%  326 aa  BTUC_ECOSE RecName: Full=Vitamin B12 import system permease protein
   52::108     1e-05  53%  326 aa  BTUC_ECOLU RecName: Full=Vitamin B12 import system permease protein
   52::108     1e-05  53%  326 aa  BTUC_ECOLI RecName: Full=Vitamin B12 import system permease protein
   52::108     1e-05  53%  326 aa  BTUC_ECOL6 RecName: Full=Vitamin B12 import system permease protein
   52::108     1e-05  53%  326 aa  BTUC_ECOL5 RecName: Full=Vitamin B12 import system permease protein
   52::108     1e-05  53%  326 aa  BTUC_ECOK1 RecName: Full=Vitamin B12 import system permease protein
   52::108     1e-05  53%  326 aa  BTUC_ECODH RecName: Full=Vitamin B12 import system permease protein
   52::108     1e-05  53%  326 aa  BTUC_ECOBW RecName: Full=Vitamin B12 import system permease protein
   52::108     1e-05  53%  326 aa  BTUC_ECO8A RecName: Full=Vitamin B12 import system permease protein
   52::108     1e-05  53%  326 aa  BTUC_ECO81 RecName: Full=Vitamin B12 import system permease protein
   52::108     1e-05  53%  326 aa  BTUC_ECO7I RecName: Full=Vitamin B12 import system permease protein
   52::108     1e-05  54%  326 aa  BTUC_ECO5E RecName: Full=Vitamin B12 import system permease protein
   52::108     1e-05  54%  326 aa  BTUC_ECO57 RecName: Full=Vitamin B12 import system permease protein
   52::108     1e-05  53%  326 aa  BTUC_ECO45 RecName: Full=Vitamin B12 import system permease protein
   52::108     1e-05  53%  326 aa  BTUC_ECO27 RecName: Full=Vitamin B12 import system permease protein
   52::108     1e-05  53%  326 aa  BTUC_ECO24 RecName: Full=Vitamin B12 import system permease protein
   72::129     2e-05  44%  349 aa  CBRC_DICD3 RecName: Full=Achromobactin transport system permease
  215::330     2e-05  54%  335 aa  BTUC_YERE8 RecName: Full=Vitamin B12 import system permease protein
   52::108     3e-05  52%  326 aa  BTUC_SHIBS RecName: Full=Vitamin B12 import system permease protein
  265::338     1e-04  66%  340 aa  CBRB_DICD3 RecName: Full=Achromobactin transport system permease
  244::314     1e-04  23%  322 aa  ISDF_STAAW RecName: Full=Probable heme-iron transport system
  244::314     1e-04  23%  322 aa  ISDF_STAAS RecName: Full=Probable heme-iron transport system
  244::314     1e-04  23%  322 aa  ISDF_STAAR RecName: Full=Probable heme-iron transport system
  244::314     1e-04  23%  322 aa  ISDF_STAAN RecName: Full=Probable heme-iron transport system
  244::314     1e-04  23%  322 aa  ISDF_STAAM RecName: Full=Probable heme-iron transport system
  244::314     1e-04  23%  322 aa  ISDF_STAAE RecName: Full=Probable heme-iron transport system
  244::314     1e-04  23%  322 aa  ISDF_STAAC RecName: Full=Probable heme-iron transport system
  244::314     1e-04  23%  322 aa  ISDF_STAAB RecName: Full=Probable heme-iron transport system
  244::314     1e-04  23%  322 aa  ISDF_STAA3 RecName: Full=Probable heme-iron transport system
  244::314     1e-04  23%  322 aa  ISDF_STAA1 RecName: Full=Probable heme-iron transport system
  258::332     3e-04  31%  332 aa  FECC_ECOLI RecName: Full=Fe(3+) dicitrate transport system permease
   54::112     3e-04  37%  330 aa  FEPG_ECOLI RecName: Full=Ferric enterobactin transport system
  264::326     0.001  54%  331 aa  BTUC_VIBCH RecName: Full=Vitamin B12 import system permease protein
  264::326     0.001  62%  330 aa  BTUC_PHOPR RecName: Full=Vitamin B12 import system permease protein
    1::342

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGLEENPIVTELRLPRXXXXXXXX
Y087_METJA      ---------------------------------------------------NLVIWNIRLPRIFAAIISG
HMUU_YERPE      ---------------------------------------------------------IRLPRXXXXXXXX
YFMD_BACSU      ----------------------------------------------------------------------
BTUC_KLEP7      ------------------------------------------------------IWQIRLPRTXXXXXXX
YFME_BACSU      -----------------------------------------------------IIQQYRLPRXXXXXXXX
FHUB_BACSU      ----------------------------------------------------------------------
YFHA_BACSU      -----------------------------------------------------MIMSFRMPRILTXXXXX
Y1471_HAEIN     --------------------------------------------------QQQVIFQVRLPRILTALCVG
BTUC_YERPY      ----------------------------------------------------------------------
BTUC_YERPS      ----------------------------------------------------------------------
BTUC_YERPG      ----------------------------------------------------------------------
BTUC_YERPE      ----------------------------------------------------------------------
BTUC_YERPB      ----------------------------------------------------------------------
BTUC_YERP3      ----------------------------------------------------------------------
BTUC_VIBVY      --------------------------------------------------EHKLLVDLRLPRLMAAMVIG
BTUC_VIBVU      --------------------------------------------------EHKLLVDLRLPRLVAAMVIG
FEUB_BACSU      -----------------------------------------------GNTDHQIIWHSRIPRXXXXXXXX
BTUC_SERP5      ----------------------------------------------------------------------
FEUC_BACSU      ----------------------------------------------------------------------
BTUC_SALTY      ------------------------------------------------------VWQIRLPRTXXXXXXX
BTUC_SALTI      ------------------------------------------------------VWQIRLPRTXXXXXXX
BTUC_SALSV      ------------------------------------------------------VWQIRLPRTXXXXXXX
BTUC_SALPK      ----------------------------------------------------------------------
BTUC_SALPB      ------------------------------------------------------VWQIRLPRTXXXXXXX
BTUC_SALPA      ----------------------------------------------------------------------
BTUC_SALNS      ------------------------------------------------------VWQIRLPRTXXXXXXX
BTUC_SALHS      ------------------------------------------------------VWQIRLPRTXXXXXXX
BTUC_SALG2      ------------------------------------------------------VWQIRLPRTXXXXXXX
BTUC_SALEP      ------------------------------------------------------VWQIRLPRTXXXXXXX
BTUC_SALDC      ------------------------------------------------------VWQIRLPRTXXXXXXX
BTUC_SALCH      ----------------------------------------------------------------------
BTUC_SALA4      ------------------------------------------------------VWQIRLPRTXXXXXXX
BTUC_CITK8      ------------------------------------------------------VWQIRLPRTXXXXXXX
BTUC_SHIDS      ------------------------------------------------------VWQIRLPRTXXXXXXX
BTUC_PHOLL      ------------------------------------------------------VWQLRFPRVLAVVAVG
Y889_HELPY      ----------------------------------------------------------RLPRVIXXXXXX
Y889_HELPJ      -----------------------------------------------------IILEIRLPRVIXXXXXX
BTUC_SALAR      ------------------------------------------------------VWQIRLPRTXXXXXXX
FECD_ECOLI      ----------------------------------------------------------------------
BTUC_VIBPA      ----------------------------------------------------------------------
FEPD_ECOLI      -----------------------------------------------------IVLDARLPRTXXXXXXX
BTUC_SHIB3      ------------------------------------------------------VWQIRLPRTXXXXXXX
BTUC_ESCF3      ----------------------------------------------------------------------
BTUC_ECOLC      ------------------------------------------------------VWQIRLPRTXXXXXXX
BTUC_ECOHS      ------------------------------------------------------VWQIRLPRTXXXXXXX
BTUC_ECO55      ------------------------------------------------------VWQIRLPRTXXXXXXX
YVRB_BACSU      ----------------------------------------------------------------------
BTUC_SHISS      ------------------------------------------------------VWQIRLPRTXXXXXXX
BTUC_SHIFL      ------------------------------------------------------VWQIRLPRTXXXXXXX
BTUC_SHIF8      ------------------------------------------------------VWQIRLPRMXXXXXXX
BTUC_ECOUT      ------------------------------------------------------VWQIRLPRTXXXXXXX
BTUC_ECOSM      ------------------------------------------------------VWQIRLPRTXXXXXXX
BTUC_ECOSE      ------------------------------------------------------VWQIRLPRTXXXXXXX
BTUC_ECOLU      ------------------------------------------------------VWQIRLPRTXXXXXXX
BTUC_ECOLI      ------------------------------------------------------VWQIRLPRTXXXXXXX
BTUC_ECOL6      ------------------------------------------------------VWQIRLPRTXXXXXXX
BTUC_ECOL5      ------------------------------------------------------VWQIRLPRTXXXXXXX
BTUC_ECOK1      ------------------------------------------------------VWQIRLPRTXXXXXXX
BTUC_ECODH      ------------------------------------------------------VWQIRLPRTXXXXXXX
BTUC_ECOBW      ------------------------------------------------------VWQIRLPRTXXXXXXX
BTUC_ECO8A      ------------------------------------------------------VWQIRLPRTXXXXXXX
BTUC_ECO81      ------------------------------------------------------VWQIRLPRTXXXXXXX
BTUC_ECO7I      ------------------------------------------------------VWQIRLPRTXXXXXXX
BTUC_ECO5E      ------------------------------------------------------VWQIRLPRTXXXXXXX
BTUC_ECO57      ------------------------------------------------------VWQIRLPRTXXXXXXX
BTUC_ECO45      ------------------------------------------------------VWQIRLPRTXXXXXXX
BTUC_ECO27      ------------------------------------------------------VWQIRLPRTXXXXXXX
BTUC_ECO24      ------------------------------------------------------VWQIRLPRTXXXXXXX
CBRC_DICD3      -----------------------------------------------------IVQQLRLPRXXXXXXXX
BTUC_YERE8      ----------------------------------------------------------------------
BTUC_SHIBS      ------------------------------------------------------VWQIRLPRTXXXXXXX
CBRB_DICD3      ----------------------------------------------------------------------
ISDF_STAAW      ----------------------------------------------------------------------
ISDF_STAAS      ----------------------------------------------------------------------
ISDF_STAAR      ----------------------------------------------------------------------
ISDF_STAAN      ----------------------------------------------------------------------
ISDF_STAAM      ----------------------------------------------------------------------
ISDF_STAAE      ----------------------------------------------------------------------
ISDF_STAAC      ----------------------------------------------------------------------
ISDF_STAAB      ----------------------------------------------------------------------
ISDF_STAA3      ----------------------------------------------------------------------
ISDF_STAA1      ----------------------------------------------------------------------
FECC_ECOLI      ----------------------------------------------------------------------
FEPG_ECOLI      -----------------------------------------------------VVTEWRLPRVLMALLIG
BTUC_VIBCH      ----------------------------------------------------------------------
BTUC_PHOPR      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXFQGLFRNPLADPYLMGSASGAAFAVTLFASLLGGLSPAFSQHAVFQHLPLSATFFGFXXXX
Y087_METJA      MSLAVAGAVMQCILRNPLASPFTMGISHGAMFGAC-FAIIMFGFGGAESTGRIFINNPYMITIFAFXXXX
HMUU_YERPE      XXXXXSGTIMQGLFRNPLADPGLLGISSGAALCVGLIIVMPFSLPPLL---ALYSHM-VGAFIGSLAIST
YFMD_BACSU      ----------------------------------------------------------------------
BTUC_KLEP7      XXXXXXXXIMQALFENPLAEPGLLGISNGAGVGLIAAVLLGKGVLPGWA-------LGLCA-IFGALLIT
YFME_BACSU      XXXXXXXXXXQGVIRNPLASPDVVGISKGSGLAA-MAVILIFPESPVYV-------LPFSXXXXXXXXXX
FHUB_BACSU      ----------------------------------------------------------------------
YFHA_BACSU      XXXXXXXXILQGLVRNPLASPDIIGITGGAAVAVVL----------------------------------
Y1471_HAEIN     AGLALSGVVLQGIFRNPLVNPHIIGVTSGSAFGGTL-AIFFG-----FSLYGLF----TSTILFGFGTLA
BTUC_YERPY      ----------------------------------------------------------------------
BTUC_YERPS      ----------------------------------------------------------------------
BTUC_YERPG      ----------------------------------------------------------------------
BTUC_YERPE      ----------------------------------------------------------------------
BTUC_YERPB      ----------------------------------------------------------------------
BTUC_YERP3      ----------------------------------------------------------------------
BTUC_VIBVY      AALAVSGATLQVLLGNVLAEPGVLGISGGASLAMVIALFLL----PVMPTPTVFM---LAAIIGALVFTL
BTUC_VIBVU      AALAVSGATLQVLLGNVLAEPGVLGISGGASLAMVIALFLL----PVMPTPTVFM---LAAIIGALVFTL
FEUB_BACSU      XXXXXXXXXMQGITRNYLASPSIMGVSDGSAFIITLCMVLL-----------------------------
BTUC_SERP5      ----------------------------------------------------------------------
FEUC_BACSU      ----------------------------------------------------------------------
BTUC_SALTY      XXXXXXXXXMQALFENPLAEPGLLGVSNGA--GVGLIAAVLLG---------------------------
BTUC_SALTI      XXXXXXXXXMQALFENPLAEPGLLGVSNGA--GVGLIAAVLLG---------------------------
BTUC_SALSV      XXXXXXXXXMQALFENPLAEPGLLGVSNGA--GVGLIAAVLLG---------------------------
BTUC_SALPK      ----------------------------------------------------------------------
BTUC_SALPB      XXXXXXXXXMQALFENPLAEPGLLGVSNGA--GVGLIAAVLLG---------------------------
BTUC_SALPA      ----------------------------------------------------------------------
BTUC_SALNS      XXXXXXXXXMQALFENPLAEPGLLGVSNGA--GVGLIAAVLLG---------------------------
BTUC_SALHS      XXXXXXXXXMQALFENPLAEPGLLGVSNGA--GVGLIAAVLLG---------------------------
BTUC_SALG2      XXXXXXXXXMQALFENPLAEPGLLGVSNGA--GVGLIAAVLLG---------------------------
BTUC_SALEP      XXXXXXXXXMQALFENPLAEPGLLGVSNGA--GVGLIAAVLLG---------------------------
BTUC_SALDC      XXXXXXXXXMQALFENPLAEPGLLGVSNGA--GVGLIAAVLLG---------------------------
BTUC_SALCH      ----------------------------------------------------------------------
BTUC_SALA4      XXXXXXXXXMQALFENPLAEPGLLGVSNGA--GVGLIAAVLLG---------------------------
BTUC_CITK8      XXXXXXXXXMQALFENPLAEPGLLGVSNGA--GVGLIAAVLLG---------------------------
BTUC_SHIDS      XXXXISGAVMQALFENPLAEPGLLGVSNGA--GVGLIAAVLLG---------------------------
BTUC_PHOLL      ASLTVAGAVMQALFENPLAEPGLLGVSNGAGVVVVFLVLMFHGIAP------------------------
Y889_HELPY      XXXXXXXXXMQTIFRNPLVDPFLLGISSGAMLGVAM----------------------------------
Y889_HELPJ      XXXXXXXXXMQTILRNPLVDPFLLGISSGAMLGVAM----------------------------------
BTUC_SALAR      XXXXXXXXXMQALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPGWS---------------------
FECD_ECOLI      ----------------------------------------------------------------------
BTUC_VIBPA      ----------------------------------------------------------------------
FEPD_ECOLI      XXXXXXXXXMQTLTRNPLADPGLLGVNAGASFAIVLGAALFG----------------------------
BTUC_SHIB3      XXXXISGAVMQALFENPLAEPGLLGVSNGA--GVGLIAAVLLG---------------------------
BTUC_ESCF3      ----------------------------------------------------------------------
BTUC_ECOLC      XXXXISGAVMQALFENPLAEPGLLGVSNGA--GVGLIAAVLLG---------------------------
BTUC_ECOHS      XXXXISGAVMQALFENPLAEPGLLGVSNGA--GVGLIAAVLLG---------------------------
BTUC_ECO55      XXXXISGAVMQALFENPLAEPGLLGVSNGA--GVGLIAAVLLG---------------------------
YVRB_BACSU      ----------------------------------------------------------------------
BTUC_SHISS      XXXXISGAVMQALFENPLAEPGLLGVSNGA--GVGLIAAVLLG---------------------------
BTUC_SHIFL      XXXXISGAVMQALFENPLAEPGLLGVSNGA--GVGLIAAVLLG---------------------------
BTUC_SHIF8      XXXXISGAVMQALFENPLAEPGLLGVSNGA--GVGLIAAVLLG---------------------------
BTUC_ECOUT      XXXXISGAVMQALFENPLAEPGLLGVSNGA--GVGLIAAVLLG---------------------------
BTUC_ECOSM      XXXXISGAVMQALFENPLAEPGLLGVSNGA--GVGLIAAVLLG---------------------------
BTUC_ECOSE      XXXXISGAVMQALFENPLAEPGLLGVSNGA--GVGLIAAVLLG---------------------------
BTUC_ECOLU      XXXXISGAVMQALFENPLAEPGLLGVSNGA--GVGLIAAVLLG---------------------------
BTUC_ECOLI      XXXXISGAVMQALFENPLAEPGLLGVSNGA--GVGLIAAVLLG---------------------------
BTUC_ECOL6      XXXXISGAVMQALFENPLAEPGLLGVSNGA--GVGLIAAVLLG---------------------------
BTUC_ECOL5      XXXXISGAVMQALFENPLAEPGLLGVSNGA--GVGLIAAVLLG---------------------------
BTUC_ECOK1      XXXXISGAVMQALFENPLAEPGLLGVSNGA--GVGLIAAVLLG---------------------------
BTUC_ECODH      XXXXISGAVMQALFENPLAEPGLLGVSNGA--GVGLIAAVLLG---------------------------
BTUC_ECOBW      XXXXISGAVMQALFENPLAEPGLLGVSNGA--GVGLIAAVLLG---------------------------
BTUC_ECO8A      XXXXISGAVMQALFENPLAEPGLLGVSNGA--GVGLIAAVLLG---------------------------
BTUC_ECO81      XXXXISGAVMQALFENPLAEPGLLGVSNGA--GVGLIAAVLLG---------------------------
BTUC_ECO7I      XXXXISGAVMQALFENPLAEPGLLGVSNGA--GVGLIAAVLLG---------------------------
BTUC_ECO5E      XXXXISGAVMQALFENPLAEPGLLGVSNGA--GVGLIAAVLLG---------------------------
BTUC_ECO57      XXXXISGAVMQALFENPLAEPGLLGVSNGA--GVGLIAAVLLG---------------------------
BTUC_ECO45      XXXXISGAVMQALFENPLAEPGLLGVSNGA--GVGLIAAVLLG---------------------------
BTUC_ECO27      XXXXISGAVMQALFENPLAEPGLLGVSNGA--GVGLIAAVLLG---------------------------
BTUC_ECO24      XXXXISGAVMQALFENPLAEPGLLGVSNGA--GVGLIAAVLLG---------------------------
CBRC_DICD3      XXXXXXXXILQAMIRNPLASPDILGITSGASAAAVFYLSFL-----------------------------
BTUC_YERE8      ----------------------------------------------------------------------
BTUC_SHIBS      XXXXISGAVMQALFENPLAEPGLLGVSNGA--GVGLIAAVLLG---------------------------
CBRB_DICD3      ----------------------------------------------------------------------
ISDF_STAAW      ----------------------------------------------------------------------
ISDF_STAAS      ----------------------------------------------------------------------
ISDF_STAAR      ----------------------------------------------------------------------
ISDF_STAAN      ----------------------------------------------------------------------
ISDF_STAAM      ----------------------------------------------------------------------
ISDF_STAAE      ----------------------------------------------------------------------
ISDF_STAAC      ----------------------------------------------------------------------
ISDF_STAAB      ----------------------------------------------------------------------
ISDF_STAA3      ----------------------------------------------------------------------
ISDF_STAA1      ----------------------------------------------------------------------
FECC_ECOLI      ----------------------------------------------------------------------
FEPG_ECOLI      AALGVSGAIFQSLMRNPLGSPDVMGFNTGAWSGVLVAMVLFG----------------------------
BTUC_VIBCH      ----------------------------------------------------------------------
BTUC_PHOPR      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           XXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXXXXXYLMMQDADRVRAVFAYTLGNLAFAGWEGVRVXXXX
Y087_METJA      XXXXXXXXXXKLRGLTPEAMILAGVAMSSLFTAGTMLIQYFADQLAAMVYWTFGDLGRAIWTEIYIMAAV
HMUU_YERPE      IIFTLSRWGHGNLARLLLAGIAINALCGAAVGVLTYI--SDDQQLRQFSLWSMGSLGQAQWSTLLVASSL
YFMD_BACSU      ----------------------------------------------------------------------
BTUC_KLEP7      FILLRFARRHLSTSRLLLAGVALGIICSALMTWAVYF--STSFDLRQLMYWMMGGFGGVDWQQLWLMIAL
YFME_BACSU      XXXXXXRKKSI---QPSSLALSGIALGAVCHAGMQYMMVKFPGDVNAALIWLTGSLWGRNWEEVKLLAPW
FHUB_BACSU      -----------------------------------------------------GGVAGVKWSGVQLLLIA
YFHA_BACSU      --------------------------------------------------YITGSVYGSNWQHVKIAIIL
Y1471_HAEIN     LVFLFSFKFNQRXXXXXXXXXXXXXXXFSALVSLLQYISDTEEKLPSIVFWLMGSFATSNWEKLLFFFVP
BTUC_YERPY      ----------------------------------------------------------------------
BTUC_YERPS      ----------------------------------------------------------------------
BTUC_YERPG      ----------------------------------------------------------------------
BTUC_YERPE      ----------------------------------------------------------------------
BTUC_YERPB      ----------------------------------------------------------------------
BTUC_YERP3      ----------------------------------------------------------------------
BTUC_VIBVY      ILVGMARAMHLSTSRMLLVGVALGILSGAFVTWAFYF--SDDLSLRQLMYWLMGSIGGASWHH-HMXXXX
BTUC_VIBVU      ILVGMARAMHLSTSRMLLVGVALGILSGAFVTWAFYF--SDDLSLRQLMYWLMGSIGGASWHH-HXXXXX
FEUB_BACSU      ----------------------------------------------------------------------
BTUC_SERP5      ----------------------------------------------------------------------
FEUC_BACSU      -----------------------------------------------------GSIWSANWTYITAVLPW
BTUC_SALTY      ----------------------------------------------------------------------
BTUC_SALTI      ----------------------------------------------------------------------
BTUC_SALSV      ----------------------------------------------------------------------
BTUC_SALPK      ----------------------------------------------------------------------
BTUC_SALPB      ----------------------------------------------------------------------
BTUC_SALPA      ----------------------------------------------------------------------
BTUC_SALNS      ----------------------------------------------------------------------
BTUC_SALHS      ----------------------------------------------------------------------
BTUC_SALG2      ----------------------------------------------------------------------
BTUC_SALEP      ----------------------------------------------------------------------
BTUC_SALDC      ----------------------------------------------------------------------
BTUC_SALCH      ----------------------------------------------------------------------
BTUC_SALA4      ----------------------------------------------------------------------
BTUC_CITK8      ----------------------------------------------------------------------
BTUC_SHIDS      ----------------------------------------------------------------------
BTUC_PHOLL      ----------------------------------------------------------------------
Y889_HELPY      ----------------------------------------------------------------------
Y889_HELPJ      ----------------------------------------------------------------------
BTUC_SALAR      ----------------------------------------------------------------------
FECD_ECOLI      ----------------------------------------------------------------------
BTUC_VIBPA      ----------------------------------------------------------------------
FEPD_ECOLI      ----------------------------------------------------------------------
BTUC_SHIB3      ----------------------------------------------------------------------
BTUC_ESCF3      ----------------------------------------------------------------------
BTUC_ECOLC      ----------------------------------------------------------------------
BTUC_ECOHS      ----------------------------------------------------------------------
BTUC_ECO55      ----------------------------------------------------------------------
YVRB_BACSU      ------------------------------------------DNLLPIVHWLLGSVSMRGWSYVILFLPF
BTUC_SHISS      ----------------------------------------------------------------------
BTUC_SHIFL      ----------------------------------------------------------------------
BTUC_SHIF8      ----------------------------------------------------------------------
BTUC_ECOUT      ----------------------------------------------------------------------
BTUC_ECOSM      ----------------------------------------------------------------------
BTUC_ECOSE      ----------------------------------------------------------------------
BTUC_ECOLU      ----------------------------------------------------------------------
BTUC_ECOLI      ----------------------------------------------------------------------
BTUC_ECOL6      ----------------------------------------------------------------------
BTUC_ECOL5      ----------------------------------------------------------------------
BTUC_ECOK1      ----------------------------------------------------------------------
BTUC_ECODH      ----------------------------------------------------------------------
BTUC_ECOBW      ----------------------------------------------------------------------
BTUC_ECO8A      ----------------------------------------------------------------------
BTUC_ECO81      ----------------------------------------------------------------------
BTUC_ECO7I      ----------------------------------------------------------------------
BTUC_ECO5E      ----------------------------------------------------------------------
BTUC_ECO57      ----------------------------------------------------------------------
BTUC_ECO45      ----------------------------------------------------------------------
BTUC_ECO27      ----------------------------------------------------------------------
BTUC_ECO24      ----------------------------------------------------------------------
CBRC_DICD3      ----------------------------------------------------------------------
BTUC_YERE8      ----------------------------------------------------------------------
BTUC_SHIBS      ----------------------------------------------------------------------
CBRB_DICD3      ----------------------------------------------------------------------
ISDF_STAAW      ----------------------------------------------------------------------
ISDF_STAAS      ----------------------------------------------------------------------
ISDF_STAAR      ----------------------------------------------------------------------
ISDF_STAAN      ----------------------------------------------------------------------
ISDF_STAAM      ----------------------------------------------------------------------
ISDF_STAAE      ----------------------------------------------------------------------
ISDF_STAAC      ----------------------------------------------------------------------
ISDF_STAAB      ----------------------------------------------------------------------
ISDF_STAA3      ----------------------------------------------------------------------
ISDF_STAA1      ----------------------------------------------------------------------
FECC_ECOLI      ----------------------------------------------------------------------
FEPG_ECOLI      ----------------------------------------------------------------------
BTUC_VIBCH      ----------------------------------------------------------------------
BTUC_PHOPR      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           XXXXXXXXXXXGRVLNALGLGEETARXXXXXXXXXXXXXXXXXXXXXXXXXXXXGIIGFVGLVTPHLLRR
Y087_METJA      MIPSLIYFMYKRWDYNALEAGEETAKSLGVNTERTRLIGMLVASLLTSVNVAFLGIIGFVGLICPHIVRI
HMUU_YERPE      ILPTCIXXXXXXXXXXXXXXGDEEAHYLGVNVRQAKLRXXXXXXXXXXXXXXXXXXXXFIGLVVPHLIRM
YFMD_BACSU      --------------VSVLGLGDETAKGLGQNMNGIRXXXXXXXXXXXGASVAVAGPIGFVGLLVPHIVRK
BTUC_KLEP7      LPVLCWVCLQ-SQPLNLLALGEVSARQXXXXXXXXXXXXVVATGWMVGVSVALAGAIGFIGLVIPHILRL
YFME_BACSU      LLILFPIVCILIPKLDLMSLGDELAQGLGENANRLRFILIFTAVALAGSCVAVVGSIGFIGLLAPHIARR
FHUB_BACSU      GAVGLTLAFFIARSVTVLSLGDDLAKGLGQYTSAVKLVGMLIVVILTGAAVSIAGTIAFIGLIIPHITRF
YFHA_BACSU      SVILLFICFVALKNMNIQVLGEDIAAGAGSAVQRNRFFLLLLSTALTGCAVSVAGTIGFVGLMAPHIARR
Y1471_HAEIN     FXXXXXXXXXXXXXXXXXXXDEKEAKALGVKMAPLRWLVIFLSGSLVACQVAISGSIGWVGLIIPHLSRM
BTUC_YERPY      -----------GRVLNFMSLGEQQARQLGVSLHLWRNXXXXXXXXXXXXSVALAGVISFIGLVIPHILRL
BTUC_YERPS      -----------GRVLNFMSLGEQQARQLGVSLHLWRNXXXXXXXXXXXXSVALAGVISFIGLVIPHILRL
BTUC_YERPG      -----------GRVLNFMSLGEQQARQLGVSLHLWRNXXXXXXXXXXXXSVALAGVISFIGLVIPHILRL
BTUC_YERPE      -----------GRVLNFMSLGEQQARQLGVSLHLWRNXXXXXXXXXXXXSVALAGVISFIGLVIPHILRL
BTUC_YERPB      -----------GRVLNFMSLGEQQARQLGVSLHLWRNXXXXXXXXXXXXSVALAGVISFIGLVIPHILRL
BTUC_YERP3      -----------GRVLNFMSLGEQQARQLGVSLHLWRNXXXXXXXXXXXXSVALAGVISFIGLVIPHILRL
BTUC_VIBVY      XXXXXXXXXXQGQTLDKLMLGETHAVQLGVDVHKVRWRLILAVSILIGCAVALGGIISFVGLVVPHLLRM
BTUC_VIBVU      XXXXXXXXXXQGQTLDKLMLGETHAAQLGVDVHKVRWRLILAISILIGCAVALGGIISFVGLVVPHLLRM
FEUB_BACSU      ------------------------------------------------------GKIAFVGLVVPHITRF
BTUC_SERP5      -----------GKALNFMALGEVQARQLGLSLHLWRNLLVLAIGWLVGVSVALAGVIGFVGLVIPHMLRL
FEUC_BACSU      MLLFIPILIGKSRLLDTIRFDEDTVRSLGISSNKEKTILLVACVAIISACVSVAGSMAFVGLIAPHISRR
BTUC_SALTY      --------------LNMLALGETSARQLGLPLWFWRNLLVVATGWMVGVSVAMAGAIGFIGLVIPHILRL
BTUC_SALTI      --------------LNMLALGETSARQXXXXXXXXXXXXVIATGWMVGVSVAMAGAIGFIGLVIPHILRL
BTUC_SALSV      --------------LNMLALGETSARQLGLPLWFWRNLLVVATGWMVGVSVAMAGAIGFIGLVIPHILRL
BTUC_SALPK      --------------LNMLALGETSARQLGLPLWFWRNLLVVATGWMVGVSVAMAGAIGFIGLVIPHILRL
BTUC_SALPB      --------------LNMLALGETSARQLGLPLWFWRNLLVVATGWMVGVSVAMAGAIGFIGLVIPHILRL
BTUC_SALPA      --------------LNMLALGETSARQLGLPLWFWRNLLVVATGWMVGVSVAMAGAIGFIGLVIPHILRL
BTUC_SALNS      --------------LNMLALGETSARQLGLPLWFWRNLLVIATGWMVGVSVAMAGAIGFIGLVIPHILRL
BTUC_SALHS      --------------LNMLALGETSARQLGLPLWFWRNLLVVATGWMVGVSVAMAGAIGFIGLVIPHILRL
BTUC_SALG2      --------------LNMLALGETSARQLGLPLWFWRNLLVIATGWMVGVSVAMAGAIGFIGLVIPHILRL
BTUC_SALEP      --------------LNMLALGETSARQLGLPLWFWRNLLVIATGWMVGVSVAMAGAIGFIGLVIPHILRL
BTUC_SALDC      --------------LNMLALGETSARQLGLPLWFWRNLLVVATGWMVGVSVAMAGAIGFIGLVIPHILRL
BTUC_SALCH      --------------LNMLALGETSARQLGLPLWFWRNLLVIATGWMVGVSVAMAGAIGFIGLVIPHILRL
BTUC_SALA4      --------------LNMLALGETSARQLGLPLWFWRNLLVVATGWMVGVSVAMAGAIGFIGLVIPHILRL
BTUC_CITK8      --------------MNILALGETSARQLGLPLWFWRNLLVVATGWMVGVSVALAGSIGFIGLVIPHILRL
BTUC_SHIDS      ------------RPMNMLALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRL
BTUC_PHOLL      -----------GKVLNFLSLGETQAQQLGISLYYWRNXXXXXXXXXXXXXXXXXXTISFIGLVIPHILRL
Y889_HELPY      ------------------------------------------------------GTIGWIGLVIPHVARL
Y889_HELPJ      ------------------------------------------------------GTIGWIGLVIPHVARL
BTUC_SALAR      --------------MNILALGETPARQXXXXXXXXXXXXVVATGWMVGVSVAMAGAIGFIGLVIPHILRL
FECD_ECOLI      ------------------------------------------------------GPISFIGLVVPHMMRS
BTUC_VIBPA      ------------------------------------------------------GIISFVGLVVPHLLRL
FEPD_ECOLI      ----------------------------------------------------------------------
BTUC_SHIB3      ------------RPMNMLALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRL
BTUC_ESCF3      ------------QAMNMLALGETSARQLGLPLWFWRNVLVVATGWMVGVSVALAGAIGFIGLVIPHILRL
BTUC_ECOLC      ------------RPMNMLALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRL
BTUC_ECOHS      ------------RPMNMLALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRL
BTUC_ECO55      ------------RPMNMLALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRL
YVRB_BACSU      FLLGTILLIINGRELNVMTYGEDKAKLLGVSVQQRKMMILIAGSLLTGSAVAVSGTIGFVGLVIPHITRL
BTUC_SHISS      ------------RPMNMLALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRL
BTUC_SHIFL      ------------RPMNMLALGEISARQLGLPMWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRL
BTUC_SHIF8      ------------RPMNMLALGEISARQLGLPMWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRL
BTUC_ECOUT      ------------RPMNMLALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRL
BTUC_ECOSM      ------------RPMNMLALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRL
BTUC_ECOSE      ------------RPMNMLALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRL
BTUC_ECOLU      ------------RPMNMLALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRL
BTUC_ECOLI      ------------RPMNMLALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRL
BTUC_ECOL6      ------------RPMNMLALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRL
BTUC_ECOL5      ------------RPMNMLALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRL
BTUC_ECOK1      ------------RPMNMLALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRL
BTUC_ECODH      ------------RPMNMLALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRL
BTUC_ECOBW      ------------RPMNMLALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRL
BTUC_ECO8A      ------------RPMNMLALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRL
BTUC_ECO81      ------------RPMNMLALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRL
BTUC_ECO7I      ------------RPMNMLALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRL
BTUC_ECO5E      ------------RPMNMLALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRL
BTUC_ECO57      ------------RPMNMLALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRL
BTUC_ECO45      ------------RPMNMLALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRL
BTUC_ECO27      ------------RPMNILALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRL
BTUC_ECO24      ------------RPMNMLALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRL
CBRC_DICD3      ----------------------------------------------------------FVGLIAPHIRKR
BTUC_YERE8      -----------GHVLNFMSLGEQQAQQLGVSLHLWRNXXXXXXXXXXXXXXXXXXXXXFIGLVIPHILRL
BTUC_SHIBS      ------------RPMNMLALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRL
CBRB_DICD3      --------------------------------------------------------IGFVGLIVPHMARK
ISDF_STAAW      ------------------------------------------------------GQLAFLGIIVPHVVRK
ISDF_STAAS      ------------------------------------------------------GQLAFLGIIVPHVVRK
ISDF_STAAR      ------------------------------------------------------GQLAFLGIIVPHVVRK
ISDF_STAAN      ------------------------------------------------------GQLAFLGIIVPHVVRK
ISDF_STAAM      ------------------------------------------------------GQLAFLGIIVPHVVRK
ISDF_STAAE      ------------------------------------------------------GQLAFLGIIVPHVVRK
ISDF_STAAC      ------------------------------------------------------GQLAFLGIIVPHVVRK
ISDF_STAAB      ------------------------------------------------------GQLAFLGIIVPHVVRK
ISDF_STAA3      ------------------------------------------------------GQLAFLGIIVPHVVRK
ISDF_STAA1      ------------------------------------------------------GQLAFLGIIVPHVVRK
FECC_ECOLI      ------------------------------------------------------GPVAFIGLLVPHLARF
FEPG_ECOLI      ----------------------------------------------------------------------
BTUC_VIBCH      ----------------------------------------------------------------PHLLRL
BTUC_PHOPR      ----------------------------------------------------------------PHLLRM


                         .         *         .         .         .         .         +:350
query           LLGEDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELPVGVVTTLLGGPFFLYLMWRRRGRx
Y087_METJA      CIGGDYRFLIPISALFGAVLLLIADTFARTIIAPIVLPVGILTSFLGAPMFLYLL-------
HMUU_YERPE      RIGADHRWXXXXXXXXXXXXXXXXXXXXXXXXXPAEMPVGLLTSLLGGPYFLWLILRQR---
YFMD_BACSU      LIGEHYQYVLPFSALFGAILLVYADVLARWIAFPYESPVGIVTAIIGTPFFLYL--ARKGR-
BTUC_KLEP7      CGLSDHRVLLPACMMAGASALLGADIIARLALSAAELPIGVVTATLGAPVFIWLLLRSRGR-
YFME_BACSU      LTGEKAKYXXXXXXXXXXXXXXXXDTLGRGIMPPVEIPAGILTAVIGAPYFLYLL-------
FHUB_BACSU      LVGVDYRWIIPCSAVLGAVLLVFADIAARLVNAPFETPVGALTSLIGVPFFFYLARRER---
YFHA_BACSU      LVGSSYGALLPASALIGALLVLTADIVGRTLFAPVEVPAGVFTAAIGAPYFIYLLYKTR---
Y1471_HAEIN     LVGANH-QSLLPCTMLVGATYMLLVDNVARSLSDAEIPISILTALIGAPLFGVLVYKKRG--
BTUC_YERPY      TGLTDQRRLLAGCAFAGGGVLLLADVVARTVLSSAELPIGVVTATLGSPLFIWLLIRVKG--
BTUC_YERPS      TGLTDQRRLLAGCAFAGGGVLLLADVVARTVLSSAELPIGVVTATLGSPLFIWLLIRVKG--
BTUC_YERPG      TGLTDQRRLLAGCAFAGGGVLLLADVVARTVLSSAELPIGVVTATLGSPLFIWLLIRVKG--
BTUC_YERPE      TGLTDQRRLLAGCAFAGGGVLLLADVVARTVLSSAELPIGVVTATLGSPLFIWLLIRVKG--
BTUC_YERPB      TGLTDQRRLLAGCAFAGGGVLLLADVVARTVLSSAELPIGVVTATLGSPLFIWLLIRVKG--
BTUC_YERP3      TGLTDQRRLLAGCAFAGGGVLLLADVVARTVLSSAELPIGVVTATLGSPLFIWLLIRVKG--
BTUC_VIBVY      AFGSENRFLLPLSAFAGATLLVFSDIWARTLLDSAELPLGVMTTTIGAPIFIWMLIR-----
BTUC_VIBVU      AFGSENRFLLPLSAFAGATLLVFSDIWARTLLDSAELPLGVMTTTIGAPIFIWMLIR-----
FEUB_BACSU      LVGSDYSRLIPCSCILGGIFLTLCDLASRFINYPFETPIEVVTSIIGVPFFLYLIKRKGG--
BTUC_SERP5      SGLTNQRYXXXXXXXXXXXXXXXXXXXXRITLLSAELPIGVVTATLGAPLFIWLLTR-----
FEUC_BACSU      LAGVEHRYILPLSGLIGMLLVISADFAGKLFFQPAEVPAGIILAILGVPYFLYLLFKQK---
BTUC_SALTY      CGLTDHRVXXXXXXXXXXXXXXXXXXXXXXXXXXXELPIGVVTATLGAPVFIWLL-------
BTUC_SALTI      CGLTDHRVXXXXXXXXXXXXXXXXXXXXXXXXXXXELPIGVVTATLGAPVFIWLL-------
BTUC_SALSV      CGLTDHRVXXXXXXXXXXXXXXXXXXXXXXXXXXXELPIGVVTATLGAPVFIWLL-------
BTUC_SALPK      CGLTDHRVXXXXXXXXXXXXXXXXXXXXXXXXXXXELPIGVVTATLGAPVFIWLL-------
BTUC_SALPB      CGLTDHRVXXXXXXXXXXXXXXXXXXXXXXXXXXXELPIGVVTATLGAPVFIWLL-------
BTUC_SALPA      CGLTDHRVXXXXXXXXXXXXXXXXXXXXXXXXXXXELPIGVVTATLGAPVFIWLL-------
BTUC_SALNS      CGLTDHRVXXXXXXXXXXXXXXXXXXXXXXXXXXXELPIGVVTATLGAPVFIWLL-------
BTUC_SALHS      CGLTDHRVXXXXXXXXXXXXXXXXXXXXXXXXXXXELPIGVVTATLGAPVFIWLL-------
BTUC_SALG2      CGLTDHRVXXXXXXXXXXXXXXXXXXXXXXXXXXXELPIGVVTATLGAPVFIWLL-------
BTUC_SALEP      CGLTDHRVXXXXXXXXXXXXXXXXXXXXXXXXXXXELPIGVVTATLGAPVFIWLL-------
BTUC_SALDC      CGLTDHRVXXXXXXXXXXXXXXXXXXXXXXXXXXXELPIGVVTATLGAPVFIWLL-------
BTUC_SALCH      CGLTDHRVXXXXXXXXXXXXXXXXXXXXXXXXXXXELPIGVVTATLGAPVFIWLL-------
BTUC_SALA4      CGLTDHRVXXXXXXXXXXXXXXXXXXXXXXXXXXXELPIGVVTATLGAPVFIWLL-------
BTUC_CITK8      CGLSDHRXXXXXXXXXXXXXXXXXXXXXXXXXXSAELPIGVVTATMGAPVFIWLLLKSR---
BTUC_SHIDS      CGLTDHRVXXXXXXXXXXXXXXXXDIVARLALAVAELPIGVVTATLGAPVFIWLL-------
BTUC_PHOLL      CGLTDYKTLLPACVXXXXXXXXXXXXXXXXXXNNAEVPIGVVTATLGAPVFIWLLLRVR---
Y889_HELPY      FFGANLQKXXXXXXXXXXXXXXXXDVVAKTITPY-DLPVGIATSVLGAPFFLWLLFRTRG--
Y889_HELPJ      FFGANLQKXXXXXXXXXXXXXXXXDVVAKTITPY-DLPVGIATSVLGAPFFLWLLFRTRG--
BTUC_SALAR      CGLTDHRVXXXXXXXXXXXXXXXXXXXXXXXXXXXELPIGVVTATLGAPIFIWLL-------
FECD_ECOLI      ITGGRHRRLLPXXXXXXXXXXXXXXXXXRIIHPPLELPVGVLTAIIGAPWFVWLLVRMR---
BTUC_VIBPA      AFGTENRYLLPLSAIFGAALLVFADIGARLLLDSAELPLGVMTTSIGAPIFIWML-------
FEPD_ECOLI      --------------------------------------------------------------
BTUC_SHIB3      CGLTDHRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPVFIWLLLKAR---
BTUC_ESCF3      CGLTDHRMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPVFIWLLLKSR---
BTUC_ECOLC      CGLTDHRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPVFIWLLLKAR---
BTUC_ECOHS      CGLTDHRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPVFIWLLLKAR---
BTUC_ECO55      CGLTDHRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPVFIWLLLKAR---
YVRB_BACSU      LWGTDH--------------------------------------------------------
BTUC_SHISS      CGLTDHRVLLPGCALAGASXXXXXXXXXXXXXXXXXXPIGVVTATLGAPVFIWLL-------
BTUC_SHIFL      CGLTDHRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPVFIWLL-------
BTUC_SHIF8      CGLTDHRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPVFIWLL-------
BTUC_ECOUT      CGLTDHRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPVFIWLL-------
BTUC_ECOSM      CGLTDHRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPVFIWLL-------
BTUC_ECOSE      CGLTDHRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPVFIWLL-------
BTUC_ECOLU      CGLTDHRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPVFIWLL-------
BTUC_ECOLI      CGLTDHRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPVFIWLL-------
BTUC_ECOL6      CGLTDHRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPVFIWLL-------
BTUC_ECOL5      CGLTDHRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPVFIWLL-------
BTUC_ECOK1      CGLTDHRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPVFIWLL-------
BTUC_ECODH      CGLTDHRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPVFIWLL-------
BTUC_ECOBW      CGLTDHRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPVFIWLL-------
BTUC_ECO8A      CGLTDHRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPVFIWLL-------
BTUC_ECO81      CGLTDHRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPVFIWLL-------
BTUC_ECO7I      CGLTDHRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPVFIWLL-------
BTUC_ECO5E      CGLTDHRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPVFIWLL-------
BTUC_ECO57      CGLTDHRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPVFIWLL-------
BTUC_ECO45      CGLTDHRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPVFIWLL-------
BTUC_ECO27      CGLTDHRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPVFIWLL-------
BTUC_ECO24      CGLTDHRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPIGVVTATLGAPVFIWLL-------
CBRC_DICD3      LVAPGFAGQAAMAFLSGAGLVMVADLCGRTLFLPLDLPAGIFVSALGAPFFLYLLIKQR---
BTUC_YERE8      TGLTDQRRXXXXXXXXXXXXXXXXDIVARIALFSAELPIGVVTATLGAPLFIWLLTR-----
BTUC_SHIBS      CGLTDHRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIGVVTATLGAPVFIWLLLKAR---
CBRB_DICD3      LLPADHRWXXXXXXXXXXXXXXXXXXXXRXXXXXXXXXXXXMTALFGAPFFIFLL-RRGGR-
ISDF_STAAW      LVGGNYRVLIPFSTVIGAWLLLVADLLGRVIQPPLEIPANAILMIVGGPMLIYLI-------
ISDF_STAAS      LVGGNYRVLIPFSTVIGAWLLLVADLLGRVIQPPLEIPANAILMIVGGPMLIYLI-------
ISDF_STAAR      LVGGNYRVLIPFSTVIGAWLLLVADLLGRVIQPPLEIPANAILMIVGGPMLIYLI-------
ISDF_STAAN      LVGGNYRVLIPFSTVIGAWLLLVADLLGRVIQPPLEIPANAILMIVGGPMLIYLI-------
ISDF_STAAM      LVGGNYRVLIPFSTVIGAWLLLVADLLGRVIQPPLEIPANAILMIVGGPMLIYLI-------
ISDF_STAAE      LVGGNYRVLIPFSTVIGAWLLLVADLLGRVIQPPLEIPANAILMIVGGPMLIYLI-------
ISDF_STAAC      LVGGNYRVLIPFSTVIGAWLLLVADLLGRVIQPPLEIPANAILMIVGGPMLIYLI-------
ISDF_STAAB      LVGGNYRVLIPFSTVIGAWLLLVADLLGRVIQPPLEIPANAILMIVGGPMLIYLI-------
ISDF_STAA3      LVGGNYRVLIPFSTVIGAWLLLVADLLGRVIQPPLEIPANAILMIVGGPMLIYLI-------
ISDF_STAA1      LVGGNYRVLIPFSTVIGAWLLLVADLLGRVIQPPLEIPANAILMIVGGPMLIYLI-------
FECC_ECOLI      WAGFDQRNVLPVSMLLGATLMLLADVLARALAFPGDLPAGAVLALIGSPCFVWLV-RRRG--
FEPG_ECOLI      --------------------------------------------------------------
BTUC_VIBCH      TLGSENRXXXXXXXXXXXXXXVSADLIARLALGSGELPLGVVTTTLGAPIFIWMLVR-----
BTUC_PHOPR      SLGAENRYXXXXXXXXXXXXXXXXXXXSRVILPSAELPVGVVTTTIGAPIFVWMLLR-----