[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tthe0:AAS80786.1

[Show Plain Result]


## Summary of Sequence Search
    1::177
    8::171     2e-36  48%  195 aa  SCPB_MOOTA RecName: Full=Segregation and condensation protein B;
   26::169     1e-35  51%  219 aa  SCPB_SYMTH RecName: Full=Segregation and condensation protein B;
    9::171     1e-32  46%  200 aa  SCPB_PELCD RecName: Full=Segregation and condensation protein B;
   10::171     7e-28  37%  181 aa  SCPB_DESRM RecName: Full=Segregation and condensation protein B;
    7::171     8e-28  39%  209 aa  SCPBL_COXBU RecName: Full=Segregation and condensation protein B
    9::170     2e-27  42%  196 aa  SCPB_PEDPA RecName: Full=Segregation and condensation protein B;
    7::171     7e-27  36%  190 aa  SCPB_BACHK RecName: Full=Segregation and condensation protein B;
    7::171     7e-27  36%  190 aa  SCPB_BACC3 RecName: Full=Segregation and condensation protein B;
    7::171     7e-27  36%  190 aa  SCPB_BACC0 RecName: Full=Segregation and condensation protein B;
    7::171     7e-27  36%  190 aa  SCPB_BACAN RecName: Full=Segregation and condensation protein B;
    7::171     7e-27  36%  190 aa  SCPB_BACAH RecName: Full=Segregation and condensation protein B;
    7::171     7e-27  36%  190 aa  SCPB_BACAC RecName: Full=Segregation and condensation protein B;
    7::171     7e-27  36%  190 aa  SCPB_BACAA RecName: Full=Segregation and condensation protein B;
    7::171     9e-27  36%  190 aa  SCPB_BACCQ RecName: Full=Segregation and condensation protein B;
    7::171     9e-27  36%  190 aa  SCPB_BACC7 RecName: Full=Segregation and condensation protein B;
    7::171     1e-26  36%  190 aa  SCPB_BACCZ RecName: Full=Segregation and condensation protein B;
    7::171     2e-26  36%  190 aa  SCPB_BACC1 RecName: Full=Segregation and condensation protein B;
    8::164     3e-26  42%  185 aa  SCPB_CARHZ RecName: Full=Segregation and condensation protein B;
    9::172     4e-26  40%  197 aa  SCPB_BACP2 RecName: Full=Segregation and condensation protein B;
    7::171     6e-26  36%  190 aa  SCPB_BACC2 RecName: Full=Segregation and condensation protein B;
    7::171     2e-25  35%  190 aa  SCPB_BACCR RecName: Full=Segregation and condensation protein B;
    7::171     2e-25  35%  190 aa  SCPB_BACC4 RecName: Full=Segregation and condensation protein B;
    7::171     7e-25  35%  190 aa  SCPB_BACWK RecName: Full=Segregation and condensation protein B;
    9::172     3e-24  40%  197 aa  SCPB_BACSU RecName: Full=Segregation and condensation protein B;
    8::165     6e-24  42%  200 aa  SCPB_LACDA RecName: Full=Segregation and condensation protein B;
   19::173     6e-24  39%  209 aa  SCPB_GEOTN RecName: Full=Segregation and condensation protein B;
   14::171     7e-24  41%  193 aa  SCPB_BACSK RecName: Full=Segregation and condensation protein B;
   55::171     1e-23  44%  190 aa  SCPB_BACCN RecName: Full=Segregation and condensation protein B;
    9::171     2e-23  41%  198 aa  SCPB_LISMO RecName: Full=Segregation and condensation protein B;
   21::183     2e-23  34%  193 aa  SCPB_CLOB6 RecName: Full=Segregation and condensation protein B;
   21::183     2e-23  34%  193 aa  SCPB_CLOBM RecName: Full=Segregation and condensation protein B;
   21::183     2e-23  34%  193 aa  SCPB_CLOBL RecName: Full=Segregation and condensation protein B;
   21::183     2e-23  34%  193 aa  SCPB_CLOBK RecName: Full=Segregation and condensation protein B;
   21::183     2e-23  34%  193 aa  SCPB_CLOBJ RecName: Full=Segregation and condensation protein B;
   21::183     2e-23  34%  193 aa  SCPB_CLOBH RecName: Full=Segregation and condensation protein B;
   21::183     2e-23  34%  193 aa  SCPB_CLOB1 RecName: Full=Segregation and condensation protein B;
   16::172     4e-23  38%  217 aa  SCPB_GEOKA RecName: Full=Segregation and condensation protein B;
    4::165     8e-23  36%  187 aa  SCPB_EUBR3 RecName: Full=Segregation and condensation protein B;
    9::171     2e-22  41%  198 aa  SCPB_LISW6 RecName: Full=Segregation and condensation protein B;
    9::171     2e-22  40%  198 aa  SCPB_LISMH RecName: Full=Segregation and condensation protein B;
    9::168     2e-22  39%  189 aa  SCPB_STRZT RecName: Full=Segregation and condensation protein B;
    9::168     2e-22  39%  189 aa  SCPB_STRZP RecName: Full=Segregation and condensation protein B;
    9::168     2e-22  39%  189 aa  SCPB_STRZJ RecName: Full=Segregation and condensation protein B;
    9::168     2e-22  39%  189 aa  SCPB_STRR6 RecName: Full=Segregation and condensation protein B;
    9::168     2e-22  39%  189 aa  SCPB_STRPS RecName: Full=Segregation and condensation protein B;
    9::168     2e-22  39%  189 aa  SCPB_STRPN RecName: Full=Segregation and condensation protein B;
    9::168     2e-22  39%  189 aa  SCPB_STRPJ RecName: Full=Segregation and condensation protein B;
    9::168     2e-22  39%  189 aa  SCPB_STRPI RecName: Full=Segregation and condensation protein B;
    9::168     2e-22  39%  189 aa  SCPB_STRP7 RecName: Full=Segregation and condensation protein B;
    9::168     2e-22  39%  189 aa  SCPB_STRP4 RecName: Full=Segregation and condensation protein B;
    9::168     2e-22  39%  189 aa  SCPB_STRP2 RecName: Full=Segregation and condensation protein B;
    9::171     2e-22  40%  198 aa  SCPB_LISMF RecName: Full=Segregation and condensation protein B;
    9::171     2e-22  40%  198 aa  SCPB_LISMC RecName: Full=Segregation and condensation protein B;
    9::168     2e-22  41%  207 aa  SCPB_LACSS RecName: Full=Segregation and condensation protein B;
    7::174     3e-22  36%  192 aa  SCPB_OCEIH RecName: Full=Segregation and condensation protein B;
    6::165     3e-22  33%  185 aa  SCPB_ALKOO RecName: Full=Segregation and condensation protein B;
   63::166     4e-22  48%  199 aa  SCPB_LEUMM RecName: Full=Segregation and condensation protein B;
    2::165     4e-22  33%  189 aa  SCPB_CLOPH RecName: Full=Segregation and condensation protein B;
   45::166     4e-22  44%  194 aa  SCPB_BREBN RecName: Full=Segregation and condensation protein B;
   54::169     5e-22  41%  196 aa  SCPB_LACJO RecName: Full=Segregation and condensation protein B;
    6::166     7e-22  31%  198 aa  SCPB_CLOTH RecName: Full=Segregation and condensation protein B;
    9::171     9e-22  40%  198 aa  SCPB_LISIN RecName: Full=Segregation and condensation protein B;
    9::162     1e-21  38%  197 aa  SCPB_BACLD RecName: Full=Segregation and condensation protein B;
    9::168     2e-21  40%  189 aa  SCPB_STRMT RecName: Full=Segregation and condensation protein B;
  103::273     3e-21  33%  291 aa  SCPB_MYCGA RecName: Full=Segregation and condensation protein B;
   18::167     3e-21  36%  189 aa  SCPB_CLOTE RecName: Full=Segregation and condensation protein B;
   60::168     5e-21  45%  188 aa  SCPB_LACLS RecName: Full=Segregation and condensation protein B;
   60::168     5e-21  45%  188 aa  SCPB_LACLM RecName: Full=Segregation and condensation protein B;
   91::172     5e-21  50%  199 aa  SCPB_LACGA RecName: Full=Segregation and condensation protein B;
   21::183     5e-21  34%  202 aa  SCPB_CLOAB RecName: Full=Segregation and condensation protein B;
    6::169     5e-21  32%  190 aa  SCPB_ALKMQ RecName: Full=Segregation and condensation protein B;
    9::164     1e-20  40%  188 aa  SCPB_STRGC RecName: Full=Segregation and condensation protein B;
   10::168     1e-20  37%  188 aa  SCPB_LACLA RecName: Full=Segregation and condensation protein B;
    9::168     2e-20  38%  189 aa  SCPB_STRSV RecName: Full=Segregation and condensation protein B;
    2::161     2e-20  30%  190 aa  SCPB_CLOCE RecName: Full=Segregation and condensation protein B;
  185::352     2e-20  32%  364 aa  SCPB_UREPA RecName: Full=Segregation and condensation protein B;
    9::163     2e-20  39%  183 aa  SCPB_STRPZ RecName: Full=Segregation and condensation protein B;
    9::163     2e-20  39%  183 aa  SCPB_STRPM RecName: Full=Segregation and condensation protein B;
    9::163     2e-20  39%  183 aa  SCPB_STRPG RecName: Full=Segregation and condensation protein B;
    9::163     2e-20  39%  183 aa  SCPB_STRPF RecName: Full=Segregation and condensation protein B;
    9::163     2e-20  39%  183 aa  SCPB_STRPD RecName: Full=Segregation and condensation protein B;
    9::163     2e-20  39%  183 aa  SCPB_STRP8 RecName: Full=Segregation and condensation protein B;
    9::163     2e-20  39%  183 aa  SCPB_STRP6 RecName: Full=Segregation and condensation protein B;
    9::163     2e-20  39%  183 aa  SCPB_STRP3 RecName: Full=Segregation and condensation protein B;
    9::163     2e-20  39%  183 aa  SCPB_STRP1 RecName: Full=Segregation and condensation protein B;
    8::164     3e-20  38%  193 aa  SCPB_STRT2 RecName: Full=Segregation and condensation protein B;
    9::162     3e-20  37%  197 aa  SCPB_BACA2 RecName: Full=Segregation and condensation protein B;
   18::180     7e-20  32%  195 aa  SCPB_CLOPE RecName: Full=Segregation and condensation protein B;
   18::180     7e-20  32%  195 aa  SCPB_CLOP1 RecName: Full=Segregation and condensation protein B;
    8::164     9e-20  37%  193 aa  SCPB_STRT1 RecName: Full=Segregation and condensation protein B;
   18::180     9e-20  32%  195 aa  SCPB_CLOPS RecName: Full=Segregation and condensation protein B;
   85::164     1e-19  51%  168 aa  SCPB_THETN RecName: Full=Segregation and condensation protein B;
    9::163     1e-19  38%  183 aa  SCPB_STRPC RecName: Full=Segregation and condensation protein B;
    9::163     1e-19  38%  183 aa  SCPB_STRPB RecName: Full=Segregation and condensation protein B;
    6::158     7e-19  37%  197 aa  SCPB_BACHD RecName: Full=Segregation and condensation protein B;
    6::169     9e-19  30%  179 aa  SCPB_CLOD6 RecName: Full=Segregation and condensation protein B;
   82::163     2e-18  50%  179 aa  SCPB_STRS7 RecName: Full=Segregation and condensation protein B;
    9::164     2e-18  36%  198 aa  SCPB_STRMU RecName: Full=Segregation and condensation protein B;
   82::163     2e-18  50%  179 aa  SCPB_STREM RecName: Full=Segregation and condensation protein B;
   82::163     2e-18  50%  179 aa  SCPB_STRE4 RecName: Full=Segregation and condensation protein B;
   36::184     4e-18  37%  208 aa  SCPB_MYCPN RecName: Full=Segregation and condensation protein B;
   82::168     4e-18  43%  201 aa  SCPB_ENTFA RecName: Full=Segregation and condensation protein B;
    9::163     6e-18  34%  194 aa  SCPB_STRA5 RecName: Full=Segregation and condensation protein B;
    9::163     6e-18  34%  194 aa  SCPB_STRA3 RecName: Full=Segregation and condensation protein B;
    9::163     6e-18  34%  194 aa  SCPB_STRA1 RecName: Full=Segregation and condensation protein B;
   10::159     1e-17  37%  199 aa  SCPB_LACPL RecName: Full=Segregation and condensation protein B;
    4::168     4e-17  34%  197 aa  SCPB_MYCPE RecName: Full=Segregation and condensation protein B;
   85::167     5e-17  43%  192 aa  SCPB_MYCMO RecName: Full=Segregation and condensation protein B;
   96::178     2e-16  42%  207 aa  SCPB_MYCPU RecName: Full=Segregation and condensation protein B;
   46::160     7e-16  35%  180 aa  SCPB_STAES RecName: Full=Segregation and condensation protein B;
   46::160     7e-16  35%  180 aa  SCPB_STAEQ RecName: Full=Segregation and condensation protein B;
   64::160     1e-15  42%  196 aa  SCPB_LACS1 RecName: Full=Segregation and condensation protein B;
   72::185     6e-15  34%  207 aa  SCPB_MYCGE RecName: Full=Segregation and condensation protein B;
   48::150     7e-14  35%  182 aa  SCPB_STAS1 RecName: Full=Segregation and condensation protein B;
   46::151     1e-12  35%  180 aa  SCPB_STAAW RecName: Full=Segregation and condensation protein B;
   46::151     1e-12  35%  180 aa  SCPB_STAAS RecName: Full=Segregation and condensation protein B;
   46::151     1e-12  35%  180 aa  SCPB_STAAN RecName: Full=Segregation and condensation protein B;
   46::151     1e-12  35%  180 aa  SCPB_STAAM RecName: Full=Segregation and condensation protein B;
   46::151     1e-12  35%  180 aa  SCPB_STAA9 RecName: Full=Segregation and condensation protein B;
   46::151     1e-12  35%  180 aa  SCPB_STAA2 RecName: Full=Segregation and condensation protein B;
   46::151     1e-12  35%  180 aa  SCPB_STAA1 RecName: Full=Segregation and condensation protein B;
   46::151     2e-12  31%  179 aa  SCPB_STAHJ RecName: Full=Segregation and condensation protein B;
   46::151     2e-12  35%  180 aa  SCPB_STAAE RecName: Full=Segregation and condensation protein B;
   46::151     2e-12  35%  180 aa  SCPB_STAAC RecName: Full=Segregation and condensation protein B;
   46::151     2e-12  35%  180 aa  SCPB_STAA8 RecName: Full=Segregation and condensation protein B;
   46::151     2e-12  35%  180 aa  SCPB_STAA3 RecName: Full=Segregation and condensation protein B;
   46::151     2e-12  35%  180 aa  SCPB_STAAR RecName: Full=Segregation and condensation protein B;
    1::177

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxEAPSLKTLLLAVLFAAGRPVALKELRALGHPEEAVLRALKALERDLEAGHLGVALERVAGGWRLVVHP
SCPB_MOOTA      -----NLRAALECLLFVAGGPVSVDSLAACLGVKPGDVDELAAELQELYARERGLQIRAVAGGYQMCTRP
SCPB_SYMTH      -----------------------IAEVIGLDERDAALLMA--DLQKDYEAPHRGLAIREMAGGYVLTTRP
SCPB_PELCD      ------LKAIIEALLFAAPGPVRLEQXXXXXXXXXXXXXXXXXLETEYLRAGRGFVLVELAEGYQLRTRP
SCPB_DESRM      -------KSALEALLFVASEPLTVQALARIVEIDVAXXXXXXXXXKEYQDRPGGLKIVQVSDTWQICTRP
SCPBL_COXBU     -------KIVIEAALFASAEPLTPERLQQLFDEQNPILSEIKNLLSELKEDYRGVDLQEVASGYRFQARP
SCPB_PEDPA      ------------ALLFVAGAEISVEELSNFGYAKPAILTMLDNLEKNYEVNSTALKLIQTGGTYKLVTKP
SCPB_BACHK      -------KSIIEGLLFVSGDEGIYPEAKVLEIEGNEVIDILEEMQKECEGAHRGLQIVQYAKVYRFATKK
SCPB_BACC3      -------KSIIEGLLFVSGDEGIYPEAKVLEIEGNEVIDILEEMQKECEGAHRGLQIVQYAKVYRFATKK
SCPB_BACC0      -------KSIIEGLLFVSGDEGIYPEAKVLEIEGNEVIDILEEMQKECEGAHRGLQIVQYAKVYRFATKK
SCPB_BACAN      -------KSIIEGLLFVSGDEGIYPEAKVLEIEGNEVIDILEEMQKECEGAHRGLQIVQYAKVYRFATKK
SCPB_BACAH      -------KSIIEGLLFVSGDEGIYPEAKVLEIEGNEVIDILEEMQKECEGAHRGLQIVQYAKVYRFATKK
SCPB_BACAC      -------KSIIEGLLFVSGDEGIYPEAKVLEIEGNEVIDILEEMQKECEGAHRGLQIVQYAKVYRFATKK
SCPB_BACAA      -------KSIIEGLLFVSGDEGIYPEAKVLEIEGNEVIDILEEMQKECEGAHRGLQIVQYAKVYRFATKK
SCPB_BACCQ      -------KSIIEGLLFVSGDEGISPEAKVLEIEGNEVINILEEMQKECEGAHRGLQIVQYAKVYRFATKK
SCPB_BACC7      -------KSIIEGLLFVSGDEGISPEAKVLEIEGNEVINILEEMQKECEGAHRGLQIVQYAKVYRFATKK
SCPB_BACCZ      -------KSIIEGLLFVSGDEGIYPEAKVLEIEGNEVIDILEEMQKECEGAHRGLQIVQYAKVYRFATKK
SCPB_BACC1      -------KSIIEGLLFVSGDEGISPEAKVLEIEGNEVIDILEEMQKECEGAHRGLQIVQYAKVYRFATKK
SCPB_CARHZ      -----NLEGALEALLFVSPEPLSLKKIASVEEAKEIVLRLQEKLEQDQRGIMLHFSGEEV---W-LTTRP
SCPB_BACP2      -------KAIIEALLYAAGEGLTKKQLMSVLEVEEALLDMMSAVKEEYQKQERGIELIEYADSYMLLTKK
SCPB_BACC2      -------KSIIEGLLFVSGDEGIYPEAKVLEIEMNEVMNILEEMQQECEGANRGLQIVQYAKVYRFATKK
SCPB_BACCR      -------KSIIEGLLFVSGDEGIYPEAKVLEIEMNEAINILEEMQQECEGANRGLQIVQYAKVYRFATKK
SCPB_BACC4      -------KSIIEGLLFVSGDEGIYPEAKVLEIEMNEAINILEEMQQECEGANRGLQIVQYAKVYRFATKK
SCPB_BACWK      -------KAIIEGLLFVAGDEGIYPEAKXXXXXXXXXXNSIEEMQKECEGSNRGLQIVQYAKVYRFATKK
SCPB_BACSU      -------KAIVEALLYAAGEGLTKKQLLTVLEIEEPELNTIMADVADEYRGDTGIELIEYADTYMLSTKK
SCPB_LACDA      ----------LQALLYVAGKKEQLRDLLQLADPEIESLRLQEKLASDLDCG---LQLLEINDEYKLTTSG
SCPB_GEOTN      -------KAIVEALLFAAGEGLSLAQIAAVLDVDESEAKAIAALQEDYSREERGIQLMELAGVFLLATKK
SCPB_BACSK      -------------LLFVTGSPTEMAELVEIS--EDEVIQLLEVLSEQMAKEERGIRLARLANRYRLTTKV
SCPB_BACCN      -----------------------------------------------------GLQIVQFAKAYRLATKK
SCPB_LISMO      ---------VLESLLFAAGSTEQLTEVMEITHIEALNLLELLS-ERYNESADRGLILLELAGTFQLATKK
SCPB_CLOB6      -------KSIIESLLFMSGEPINIKDLATLNCKQDKVSSLLNEMKNSYVGKDRGIKILIHNRAVQLVTKP
SCPB_CLOBM      -------KSIIESLLFMSGEPINIKDLATLNCKQDKVSSLLNEMNNSYVGKDRGIKILIHNRAVQLVTKP
SCPB_CLOBL      -------KSIIESLLFMSGEPINIKDLATLNCKQDKVSSLLNEMNNSYVGKDRGIKILIHNRAVQLVTKP
SCPB_CLOBK      -------KSIIESLLFMSGEPINIKDLATLNCKQDKVSSLLNEMNNSYVGKDRGIKILIHNRAVQLVTKP
SCPB_CLOBJ      -------KSIIESLLFMSGEPINIKDLATLNCKQDKVSSLLNEMKNSYVGKDRGIKILIHNRAVQLVTKP
SCPB_CLOBH      -------KSIIESLLFMSGEPINIKDLATLNCKQDKVSSLLNEMNNSYVGKDRGIKILIHNRAVQLVTKP
SCPB_CLOB1      -------KSIIESLLFMSGEPINIKDLATLNCKQDKVSSLLNEMNNSYVGKDRGIKILIHNRAVQLVTKP
SCPB_GEOKA      -----SAKAIVEALLFAAGEGLSLSQIAAVLEVSELEAKAIEELQQDCRREERGIQLVELGGVFLLATKK
SCPB_EUBR3      -------KAAIEAILFTMGESVELGRIAAIQLNEKETKKLLDELIKEYRSSNIGMNIIELDGAYQMCTKP
SCPB_LISW6      ---------ILESLLFAAGSTEQLTEVMEITHIEALNLLELLS-ERYNGNADRGLILLELAGTFQLATKK
SCPB_LISMH      ---------ILESLLFAAGSTEQLTEVMEITHIEALNLLELLS-ERYNGSADRGLILLELAGTFQLATKK
SCPB_STRZT      ------------ALLFVAGEDIRVRQLELLSLPPTGIQQSLGKLAQKYEKDDSSLALIETSGAYRLVTKP
SCPB_STRZP      ------------ALLFVAGEDIRVRQLELLSLPPTGIQQSLGKLAQKYEKDDSSLALIETSGAYRLVTKP
SCPB_STRZJ      ------------ALLFVAGEDIRVRQLELLSLPPTGIQQSLGKLAQKYEKDDSSLALIETSGAYRLVTKP
SCPB_STRR6      ------------ALLFVAGEDIRVRQLELLSLPPTGIQQSLGKLAQKYEKDDSSLALIETSGAYRLVTKP
SCPB_STRPS      ------------ALLFVAGEDIRVRQLELLSLPPTGIQQSLGKLAQKYEKDDSSLALIETSGAYRLVTKP
SCPB_STRPN      ------------ALLFVAGEDIRVRQLELLSLPPTGIQQSLGKLAQKYEKDDSSLALIETSGAYRLVTKP
SCPB_STRPJ      ------------ALLFVAGEDIRVRQLELLSLPPTGIQQSLGKLAQKYEKDDSSLALIETSGAYRLVTKP
SCPB_STRPI      ------------ALLFVAGEDIRVRQLELLSLPPTGIQQSLGKLAQKYEKDDSSLALIETSGAYRLVTKP
SCPB_STRP7      ------------ALLFVAGEDIRVRQLELLSLPPTGIQQSLGKLAQKYEKDDSSLALIETSGAYRLVTKP
SCPB_STRP4      ------------ALLFVAGEDIRVRQLELLSLPPTGIQQSLGKLAQKYEKDDSSLALIETSGAYRLVTKP
SCPB_STRP2      ------------ALLFVAGEDIRVRQLELLSLPPTGIQQSLGKLAQKYEKDDSSLALIETSGAYRLVTKP
SCPB_LISMF      ---------VLESLLFAAGSTEQLTEVMEITHIEALNLLELLS-DRYNGSADRGLILLELAGTFQLATKK
SCPB_LISMC      ---------VLESLLFAAGSTEQLTEVMEITHIEALNLLELLS-DRYNGSADRGLILLELAGTFQLATKK
SCPB_LACSS      ------------SLLYVAGEGITLQHIARLIMLDEAAVRQLKLAKRYQEDEQSGLNLIQAADCYKLVTK-
SCPB_OCEIH      -------KGVIEGLLFASGEGVTAKQLKILDIGLDTVEHILEELRFEYEREDRGLMIIQSNNIFHLATKP
SCPB_ALKOO      ------IKSAIEAILFAWSDPLSIKDLEVLDIGTKEIEGVLAEMINEFNYSKRGIQIIKMNDYYQLSTRP
SCPB_LEUMM      ---------------------------------------------------------------YRLVTKP
SCPB_CLOPH      --EIKKLEAMIEAILFTMGEAVEVERIAALDHDVDTIRKIIHNMMDRYEGDERGIKIIELDNSFQMCTKA
SCPB_BREBN      -------------------------------------------MKADFRRAGRGIQIVEVAKAYQLTTLP
SCPB_LACJO      -----------------------------------------------------GLQLICINQTYKLTTSP
SCPB_CLOTH      ------LEGIFEGMLFASGDKVSIEKLSSITGIDKKTVKLVNMIVKYNNDPSRGITIREINNGYQLCSKP
SCPB_LISIN      ---------VLESLLFAAGSTEQLTEVMEITHIEALNLLELLS-ERYNGNEDRGLILLELAGTFQLATKK
SCPB_BACLD      -------KAIVEALLYAAGDEGLTKKLSVLEVDEAELLDIMLDVKETYEKEDRGIELVEYADTYMLSTKK
SCPB_STRMT      ------------ALLFVRGEDIRVRQLELLSLPPTGIQQSLEKLEKDLDSS---LDLIETGGAYRLVTKP
SCPB_MYCGA      -----SAKAIIQAALYVAGRNMTLQELNKI-LPKIHQDQLFKELEEMIYSYNFGLTIKNYGGRYKILTKA
SCPB_CLOTE      --------SIIESLLFASGEPLGLKDISEIIELNTLDTKELQKMIREYEIEKRGIKLIEIEKKYQLVTKE
SCPB_LACLS      ------------------------------------------------------------AGKYRMATKE
SCPB_LACLM      ------------------------------------------------------------AGKYRMATKE
SCPB_LACGA      ----------------------------------------------------------------------
SCPB_CLOAB      -------ESIIESLLFVSGEPLKLKQISAI--LECTTKRAQEVLNNMMNDNCRGVKLININDSYQLVTKN
SCPB_ALKMQ      ------IKAAIEAILFAWSDPISSSELNILDIKVTETKEIMKEMIDEFNFHKRGIQIIQMNDHYQMSTRA
SCPB_STRGC      ------------ALLFVAGEDLKVRQIEILSIPPTGVSQSLEKLTAKYEAADCSLALLETSNTYKLVTKQ
SCPB_LACLA      -------------LLFVSGEALTLAELSALTESKQACQQQIDYLKEKYHSDESALTIIETAGKYRMATKE
SCPB_STRSV      ------------ALLFVAGEDLKVHQLEILSLPPTGVIQSLEKLAEQYEVNDSSLTLLETSKTYKLVTKP
SCPB_CLOCE      --EISTIECVIESLIFSYGDPLPLDKICEILELDKKTARSLKNMMDSYNNSNRGIIIREINEKYQMCSKP
SCPB_UREPA      -----NIKSIIDSTLFLAGEEVSLQDLRTTGLNESSQLKTLNQLQKDYDVDDSGLVLVQFGEKFKLLTQS
SCPB_STRPZ      ------------ALLFVAGEELSLRHLASLSLTPTALQQQLEKLSQKYEKDHSSLCLIETANTYRLVTKE
SCPB_STRPM      ------------ALLFVAGEELSLRHLASLSLTPTALQQQLEKLSQKYEKDHSSLCLIETANTYRLVTKE
SCPB_STRPG      ------------ALLFVAGEELSLRHLASLSLTPTALQQQLEKLSQKYEKDHSSLCLIETANTYRLVTKE
SCPB_STRPF      ------------ALLFVAGEELSLRHLASLSLTPTALQQQLEKLSQKYEKDHSSLCLIETANTYRLVTKE
SCPB_STRPD      ------------ALLFVAGEELSLRHLASLSLTPTALQQQLEKLSQKYEKDHSSLCLIETANTYRLVTKE
SCPB_STRP8      ------------ALLFVAGEELSLRHLASLSLTPTALQQQLEKLSQKYEKDHSSLCLIETANTYRLVTKE
SCPB_STRP6      ------------ALLFVAGEELSLRHLASLSLTPTALQQQLEKLSQKYEKDHSSLCLIETANTYRLVTKE
SCPB_STRP3      ------------ALLFVAGEELSLRHLASLSLTPTALQQQLEKLSQKYEKDHSSLCLIETANTYRLVTKE
SCPB_STRP1      ------------ALLFVAGEELSLRHLASLSLTPTALQQQLEKLSQKYEKDHSSLCLIETANTYRLVTKE
SCPB_STRT2      ----------LEALLFVAGEDLSLRTMQLLEIPVTGLTQSLEKLQAKYEADETALCLLESSNTYKIVTKP
SCPB_BACA2      -------KAIVEALLYAAGEGLTKKQLVTVLEIEEAELAGIEEVAAQYKEDDRGIELTEYADTYMLGTKK
SCPB_CLOPE      ------LKSIIESLLFVSGEPLALKDICRIVEEDFKYVEDLMRELMNIYNGDSGIKIISLNGTYQLVTKT
SCPB_CLOP1      ------LKSIIESLLFVSGEPLALKDICRIVEEDFKYVEDLMRELMNIYNGDSGIKIISLNGTYQLVTKT
SCPB_STRT1      ----------LEALLFVAGEDLSLRTMQLLEIPVTGLTQSLEKLQAKYKADETALCLLESSNTYKIVTKP
SCPB_CLOPS      ------LKSIIESLLFVSGEPLALKDICRIVEEDFKYVEDLMRELMNIYNGDSGIKIISLNGTYQLVTKT
SCPB_THETN      ----------------------------------------------------------------------
SCPB_STRPC      ------------ALLFVAGEELSLRHLASLSLTPTALQQQLEKLSQKYEKDHSSLCLIETANTYRLVTKE
SCPB_STRPB      ------------ALLFVAGEELSLRHLASLSLTPTALQQQLEKLSQKYEKDHSSLCLIETANTYRLVTKE
SCPB_BACHD      ------LQAAIEGILFVRGEGVTLEELDLLELSTDVVYAALEELRLSYTDEARGLRIEEVAHAFRLSTKP
SCPB_CLOD6      ------IKYIIESVMFAYGEPISIKELNYIINKEKXXXXXXXXXXXXYREQNRGIQIIKLENKYQMCTNK
SCPB_STRS7      ----------------------------------------------------------------------
SCPB_STRMU      ------------ALLFVAGEDLSLRQLATLDIPVTALLQQLEKMAQKYERDNSALSLLESSKTYKLVTKK
SCPB_STREM      ----------------------------------------------------------------------
SCPB_STRE4      ----------------------------------------------------------------------
SCPB_MYCPN      -------KGLTLAELNRVLRKVGLEKIKA----------ALVQLERKLSLDESGIEIKKFGHSFRLVTKM
SCPB_ENTFA      ----------------------------------------------------------------------
SCPB_STRA5      ------------ALLFVAGEDLSLRQMAELLSPSALIQQLEKLAKRYXXXXXXXXXXXXTAQTYKLVTKD
SCPB_STRA3      ------------ALLFVAGEDLSLRQMAELLSPSALIQQLEKLAKRYXXXXXXXXXXXXTAQTYKLVTKD
SCPB_STRA1      ------------ALLFVAGEDLSLRQMAELLSPSALIQQLEKLAKRYXXXXXXXXXXXXTAQTYKLVTKD
SCPB_LACPL      -------------LLFVAGEGITVAEIEATGFAKPAITTMLTQLATKYQADDSALMILSTANTYRLATKA
SCPB_MYCPE      -----NVKSVIEAALFIAGNEGVLKSISRLSVQDEAVMEEMIEYEKDPQRG---LVVRKVGENYKLFTKP
SCPB_MYCMO      ----------------------------------------------------------------------
SCPB_MYCPU      ----------------------------------------------------------------------
SCPB_STAES      -----------------------------------------------------GLTIQRYGSTYVLTTKK
SCPB_STAEQ      -----------------------------------------------------GLTIQRYGSTYVLTTKK
SCPB_LACS1      ---------------------------------------------------------------YKLVTKP
SCPB_MYCGE      -----------------------------------------------------GVELKKFGNSFSLVTKP
SCPB_STAS1      -----------------------------------------------------GLTIQHYGNTYVLTTKK
SCPB_STAAW      -----------------------------------------------------GLMIQRFGTTYVLTTKK
SCPB_STAAS      -----------------------------------------------------GLMIQRFGTTYVLTTKK
SCPB_STAAN      -----------------------------------------------------GLMIQRFGTTYVLTTKK
SCPB_STAAM      -----------------------------------------------------GLMIQRFGTTYVLTTKK
SCPB_STAA9      -----------------------------------------------------GLMIQRFGTTYVLTTKK
SCPB_STAA2      -----------------------------------------------------GLMIQRFGTTYVLTTKK
SCPB_STAA1      -----------------------------------------------------GLMIQRFGTTYVLTTKK
SCPB_STAHJ      -----------------------------------------------------GLIIQKFGSTYILTSKK
SCPB_STAAE      -----------------------------------------------------GLMIQRFGMTYVLTTKK
SCPB_STAAC      -----------------------------------------------------GLMIQRFGMTYVLTTKK
SCPB_STAA8      -----------------------------------------------------GLMIQRFGMTYVLTTKK
SCPB_STAA3      -----------------------------------------------------GLMIQRFGMTYVLTTKK
SCPB_STAAR      -----------------------------------------------------GLIIQRFGTTYVLTTKK


                         .         .         *         .         .         .         .:140
query           KALEAVERVLKPSPPRLSRAALEVLALVAYHQPVTRAELEAMRGKGVEGVLESLLERGLVRVVGEKEAPG
SCPB_MOOTA      EFASYCEALLRPELPALSRAALETLAIIAYRQPVTRTEMEYIRGVKVDGVLNTLISRGLVQEVGRKEAPG
SCPB_SYMTH      EAAEYVERLLQPKSRGLSHAALETLAIIAYRQPITKAEIENVRGVKVDRALETLLERGLIEDKGRKEAPG
SCPB_PELCD      EHAEWVRRLHSSRPTRLSRAALEALAIIAYQQPVTRADIDYLRGVDSGGVVKSLLDKRLVRIVGKKDVPG
SCPB_DESRM      ECAPYIERLYRKSGTGLSKAAIETLAIIAYRQPITRSEVEMIRGVKVDSPINTLLERNLIEEKGRREGPG
SCPBL_COXBU     DFSPWLQRLWEKKPARYSRALLETLALIVYRQPISRGEIEEVRGVAVSSIIKKLLDREWISVVAHRDVPG
SCPB_PEDPA      ELASILEKYFRNSRSGLSPAALEILSIVAYRQPITRIEIDQIRGVQSGTTLQNLVLRNLVKVVGRLEEPG
SCPB_BACHK      EHASYYQKLIEPTAASLSQAALETLAIVAYRQPITRTEMEEIRGVKTDKALQTLVSHLLIKEMGRAEGPG
SCPB_BACC3      EHASYYQKLIEPTAASLSQAALETLAIVAYRQPITRTEMEEIRGVKTDKALQTLVSHLLIKEMGRAEGPG
SCPB_BACC0      EHASYYQKLIEPTAASLSQAALETLAIVAYRQPITRTEMEEIRGVKTDKALQTLVSHLLIKEMGRAEGPG
SCPB_BACAN      EHASYYQKLIEPTAASLSQAALETLAIVAYRQPITRTEMEEIRGVKTDKALQTLVSHLLIKEMGRAEGPG
SCPB_BACAH      EHASYYQKLIEPTAASLSQAALETLAIVAYRQPITRTEMEEIRGVKTDKALQTLVSHLLIKEMGRAEGPG
SCPB_BACAC      EHASYYQKLIEPTAASLSQAALETLAIVAYRQPITRTEMEEIRGVKTDKALQTLVSHLLIKEMGRAEGPG
SCPB_BACAA      EHASYYQKLIEPTAASLSQAALETLAIVAYRQPITRTEMEEIRGVKTDKALQTLVSHLLIKEMGRAEGPG
SCPB_BACCQ      EHASYYQKLIDPTAASLSQAALETLAIVAYRQPITRTEMEEIRGVKTDKALQTLVSHLLIKEMGRAEGPG
SCPB_BACC7      EHASYYQKLIDPTAASLSQAALETLAIVAYRQPITRTEMEEIRGVKTDKALQTLVSHLLIKEMGRAEGPG
SCPB_BACCZ      EHASYYQKLIDPTAASLSQAALETLAIVAYRQPITRTEMEEIRGVKTDKALQTLVSHLLIKEMGRAEGPG
SCPB_BACC1      EHASYYQKLIDPTAASLSQAALETLAIVAYRQPITRTEMEEIRGVKTDKALQTLVSHLLIKEMGRAEGPG
SCPB_CARHZ      DFSVYIERLFKPPAQHLTQATLETLAIIAYKQPVTKTEIELIRGVKADSSIATLLEKGLIEEAGRKDAPG
SCPB_BACP2      EYSIYLKKLVETPSKGLSQAALEVLAIVSYKQPITRSEVEEIRGVKSERVLHSLVAKALLCEVGRADGPG
SCPB_BACC2      EHASYYQKLIDPTAASLSQAALETLAIVAYRQPITRTEMEEIRGVKTDKALQTLVSHLLIKEMGRAEGPG
SCPB_BACCR      EHASYYQKLIDPTAASLSQAALETLAIVAYRQPITRTEMEEIRGVKTDKALQTLVSHLLIKEMGRAEGPG
SCPB_BACC4      EHASYYQKLIDPTAASLSQAALETLAIVAYRQPITRTEMEEIRGVKTDKALQTLVSHLLIKEMGRAEGPG
SCPB_BACWK      EHASYYQKLIDPTAASLSQAALETLAIVAYRQPITRTEMEEIRGVKTDKALQTLVSHLLIKETGRAEGPG
SCPB_BACSU      DFAPYLKKLIEVPSKGLSQASLEVLAIVSYKQPITRAEIEEIRGVKSERILHSLVAKALLCEVGRADGPG
SCPB_LACDA      EVSDLVEAYFKDLTKNISQSALEILAIVAYRQPITRIEIDEIRGVNSSGALQTLVWRGLVKAQGVKDAPG
SCPB_GEOTN      EHASYLKKLVEPGASSLSQAALETLAIIAYRQPITRAEIEEIRGVKSDKPLQTLMARALIKEVGRAEGTG
SCPB_BACSK      EHADMYKKLASPIHGGLSRAALETLAIVAYKQPITRAEIDEVRGVKSEKALQSLVSKLLIEECGRASGTG
SCPB_BACCN      EHAPYYQKLMDPTAASLSQAALETLAIVAYRQPITRMEMEEIRGVKTERALQTLVSHLLIKEVGRAEGPG
SCPB_LISMO      AHAEFLRKLVEPSNTVLSQASLETLAIIAYRQPVTRMEVDEVRGVQTDGPIRTLVAKGLVTDKGRVDGAG
SCPB_CLOB6      ENSIYVEKLLKTNVRQLSQAALETLSIIAYKQPITRVAIDEIRGVKSDRAIYTLLEKNIIKECGRLDVPG
SCPB_CLOBM      ENSIYVEKLLKTNVRQLSQAALETLSIIAYKQPITRVAIDEIRGVKSDRAIYTLLEKNIIKECGRLDVPG
SCPB_CLOBL      ENSIYVEKLLKTNVRQLSQAALETLSIIAYKQPITRVAIDEIRGVKSDRAIYTLLEKNIIKECGRLDVPG
SCPB_CLOBK      ENSIYVEKLLKTNVRQLSQAALETLSIIAYKQPITRVAIDEIRGVKSDRAIYTLLEKNIIKECGRLDVPG
SCPB_CLOBJ      ENSIYVEKLLKTNIRQLSQAALETLSIIAYKQPITRVAIDEIRGVKSDRAIYTLLEKNIIKECGRLDVPG
SCPB_CLOBH      ENSIYVEKLLKTNVRQLSQAALETLSIIAYKQPITRVAIDEIRGVKSDRAIYTLLEKNIIKECGRLDVPG
SCPB_CLOB1      ENSIYVEKLLKTNVRQLSQAALETLSIIAYKQPITRVAIDEIRGVKSDRAIYTLLEKNIIKECGRLDVPG
SCPB_GEOKA      EHAPYLKKLVEPGASPLSQAALETLAIIAYRQPITRAEIEEIRGVKSDKPLQTLMARALIKEVGRAEGTG
SCPB_EUBR3      QMYEYLIRIAKQPKKRLTDVLLETLSIIAYKQPVTKAEIEKIRGVSSEHAVSKLVEYNLVQELGRLDAPG
SCPB_LISW6      AHAEYLRKLVEPSNTVLSQASLETLAIIAYRQPVTRMEVDEVRGVQTDGPIRTLVAKGLVTDKGRVDGAG
SCPB_LISMH      AHADYLRKLVEPSNTVLSQASLETLAIIAYRQPVTRMEVDEVRGVQTDGPIRTLVAKGLVTDKGRVDGAG
SCPB_STRZT      QFAEILKEYSKPINQSLSRAALETLSIIAYKQPITRIEIDAIRGVNSSGALAKLQAFDLIKEDGKKEVLG
SCPB_STRZP      QFAEILKEYSKPINQSLSRAALETLSIIAYKQPITRIEIDAIRGVNSSGALAKLQAFDLIKEDGKKEVLG
SCPB_STRZJ      QFAEILKEYSKPINQSLSRAALETLSIIAYKQPITRIEIDAIRGVNSSGALAKLQAFDLIKEDGKKEVLG
SCPB_STRR6      QFAEILKEYSKPINQSLSRAALETLSIIAYKQPITRIEIDAIRGVNSSGALAKLQAFDLIKEDGKKEVLG
SCPB_STRPS      QFAEILKEYSKPINQSLSRAALETLSIIAYKQPITRIEIDAIRGVNSSGALAKLQAFDLIKEDGKKEVLG
SCPB_STRPN      QFAEILKEYSKPINQSLSRAALETLSIIAYKQPITRIEIDAIRGVNSSGALAKLQAFDLIKEDGKKEVLG
SCPB_STRPJ      QFAEILKEYSKPINQSLSRAALETLSIIAYKQPITRIEIDAIRGVNSSGALAKLQAFDLIKEDGKKEVLG
SCPB_STRPI      QFAEILKEYSKPINQSLSRAALETLSIIAYKQPITRIEIDAIRGVNSSGALAKLQAFDLIKEDGKKEVLG
SCPB_STRP7      QFAEILKEYSKPINQSLSRAALETLSIIAYKQPITRIEIDAIRGVNSSGALAKLQAFDLIKEDGKKEVLG
SCPB_STRP4      QFAEILKEYSKPINQSLSRAALETLSIIAYKQPITRIEIDAIRGVNSSGALAKLQAFDLIKEDGKKEVLG
SCPB_STRP2      QFAEILKEYSKPINQSLSRAALETLSIIAYKQPITRIEIDAIRGVNSSGALAKLQAFDLIKEDGKKEVLG
SCPB_LISMF      AHAEFLRKLVEPSNTVLSQASLETLAIIAYRQPVTRMEVDEVRGVQTDGPIRTLVAKGLVTDKGRVDGAG
SCPB_LISMC      AHAEFLRKLVEPSNTVLSQASLETLAIIAYRQPVTRMEVDEVRGVQTDGPIRTLVAKGLVTDKGRVDGAG
SCPB_LACSS      ---KAYAGLLKPVSTSISQAALEVLAIIVYRQPLTRIEIDEVRGVQSSGAIQTLLARQLIVEKGRKDAPG
SCPB_OCEIH      EHSSYFKRLISPRTSKMSQAALETLAIIAYRQPITRAEIDEIRGVRSERPVQTLITRNLIEETGRKDTVG
SCPB_ALKOO      EHYEYLQKLFAPKQNRITQAALETLAIIAYKQPITKTEIEEIRGVKCDKAISTLLEKELIEEQGRLEKTG
SCPB_LEUMM      ELGGTVKQYFSPVNATLSQAQLETLVIVAYKQPITRVEIDTIRGVQSSGTLQKLALRQLVHEVGRKDEPG
SCPB_CLOPH      QMYEAIVKIAHPKKHILTDVLLESLSIIAYKQPITKQQIESIRGVKSDHAVNKLVEYNLVCEVGRMDAPG
SCPB_BREBN      EHVPYFERLASPGQSTLSQAALETLAIVAYKQPLTRSEIEEIRGVKCEKALNTLLSKQLIREAGRAEGIG
SCPB_LACJO      KCGDIISKFFKDLSKNLSQSALEILSIIAYRQPITRVEIDDLRGVNSAGALQTLVWRGLIKVDGKKDVPG
SCPB_CLOTH      EYYDYIKQLFEPKQRSLSQAALETLAIIAYNRPITKAKIEQIRGVNSDSAITKLLEKNLIREAGRLDAPG
SCPB_LISIN      AHAEFLRKLVEPSNTVLSQASLETLAIIAYRQPVTRMEVDEVRGVQTDGPIRTLVAKGLVTDKGRVDGAG
SCPB_BACLD      EFAVYLKKLIEAPSKGLSQAALEVLAIVSYKQPITRAEVEEIRGVKSERILQSLVAKALLCEVGRADGPG
SCPB_STRMT      QFSEILKEYSKPINQSLSRPALETLSIIAYKQPITRIEIDAIRGVNSSGALAKLQAFDLIREDGKKEVLG
SCPB_MYCGA      AVKKDMQRVSERFKNPLNKSLMEVLAIVAYNQPCTRVRINEIRGVDSLSLVDNLLEKGLIVEVGRADTPG
SCPB_CLOTE      ENSCFIEQLLKTSSQSLSQAALETLSIVAYKQPVTRVDVDEIRGVKSDRALQTLLQKSLIKETGRLDVPG
SCPB_LACLS      DFSEILKNYAKPLNQSLSKSALEVLSIIAYKQPLTRIEIDQLRGVNSSGVLSTLRAFDLVEKVGQVEAPG
SCPB_LACLM      DFSEILKNYAKPLNQSLSKSALEVLSIIAYKQPLTRIEIDQLRGVNSSGVLSTLRAFDLVEKVGQVEAPG
SCPB_LACGA      ----------------LSQSALEILSIIAYRQPITRVEIDDLRGVNSSGALQTLVWRGLIKVNGKKDVPG
SCPB_CLOAB      ENSDYVRKLLKTNTRQLSQAALETLAIIAYKQPITRIDVDEIRGVKSDRAILTLQEKKLIQECGRLDVPG
SCPB_ALKMQ      EYHEILQKLFEPKQNKLTQASLETLAIIAYRQPITKTEIESVRGVKCDKAISTLFEKNLIEDRGRLEKTG
SCPB_STRGC      AFAELLRAYSKPINQSLSRAALETLSIIAYKQPITRVEIDDIRGVNSSGALAKLLAFELVREDGKKEVLG
SCPB_LACLA      EFAEILKNYAKPLNQSLSKSALEVLSIIAYKQPLTRLEIDHLRGVNSSGVLSTLRAFDLVEKVGQVEAPG
SCPB_STRSV      EFAEILRAYSRPINQSLSRAALETLSIIAYKQPITRVEIDDIRGVNSSGALAKLLAFELVREDGKKEVIG
SCPB_CLOCE      EYFDYVSKLYQIRQKQLSQAAYEVLAIIAYNQPITRAKIEQIRGVNSDSAVTRLTERNLIKEAGKLDVPG
SCPB_UREPA      KNKDALSKFVTTSRTPLSQRNLETLAIIAYNQPTTRAKIQAIRDRDPKPAIDALLKLNLIIEAGRQDTPG
SCPB_STRPZ      GFAELLRAYAKPMNQSLSRASLEVLSIVAYKQPITRIEIDDIRGVNSSGALSKLLAFDLIREAGKKDVVG
SCPB_STRPM      GFAELLRAYAKPMNQSLSRASLEVLSIVAYKQPITRIEIDDIRGVNSSGALSKLLAFDLIREAGKKDVVG
SCPB_STRPG      GFAELLRAYAKPMNQSLSRASLEVLSIVAYKQPITRIEIDDIRGVNSSGALSKLLAFDLIREAGKKDVVG
SCPB_STRPF      GFAELLRAYAKPMNQSLSRASLEVLSIVAYKQPITRIEIDDIRGVNSSGALSKLLAFDLIREAGKKDVVG
SCPB_STRPD      GFAELLRAYAKPMNQSLSRASLEVLSIVAYKQPITRIEIDDIRGVNSSGALSKLLAFDLIREAGKKDVVG
SCPB_STRP8      GFAELLRAYAKPMNQSLSRASLEVLSIVAYKQPITRIEIDDIRGVNSSGALSKLLAFDLIREAGKKDVVG
SCPB_STRP6      GFAELLRAYAKPMNQSLSRASLEVLSIVAYKQPITRIEIDDIRGVNSSGALSKLLAFDLIREAGKKDVVG
SCPB_STRP3      GFAELLRAYAKPMNQSLSRASLEVLSIVAYKQPITRIEIDDIRGVNSSGALSKLLAFDLIREAGKKDVVG
SCPB_STRP1      GFAELLRAYAKPMNQSLSRASLEVLSIVAYKQPITRIEIDDIRGVNSSGALSKLLAFDLIREAGKKDVVG
SCPB_STRT2      DFACLLRDYSKPINQSLSRASLEVLSIVAYKQPITRAEVDDIRGVNSSGAIAKLQAFGLIREAGKKDAVG
SCPB_BACA2      EFVPYLKKLIEVPSKGLSQASLEVLAIVSYKQPITRAEIEDIRGVKSERILHSLVSKALLCEVGRADGPG
SCPB_CLOPE      KNSEYVQKLLKKNVXXXXXXXXXXXXIICYKQPITRVEIDEIRGVKSESAIQRLVEKNLVEETGRLEVPG
SCPB_CLOP1      KNSEYVQKLLKKNVXXXXXXXXXXXXIICYKQPITRVEIDEIRGVKSESAIQRLVEKNLVEETGRLEVPG
SCPB_STRT1      DFACLLRDYSKPINQSLSRASLEVLSIVAYKQPITRAEVDDIRGVNSSGAIAKLQAFGLIREAGKKDAVG
SCPB_CLOPS      KNSEYIQKLLKKNVXXXXXXXXXXXXIICYKQPITRVEIDEIRGVKSESAIQRLVEKNLVEETGRLEVPG
SCPB_THETN      ----------------LSQAALEVLAIIAYNQPITKAEIERIRGVRSDKPINTLLEYNLIKESGRASSPG
SCPB_STRPC      GFAGLLRAYAKPMNQSLSRASLEVLSIVAYKQPITRIEIDDIRGVNSSGALSKLLAFDLIREAGKKDVVG
SCPB_STRPB      GFAGLLRAYAKPMNQSLSRASLEVLSIVAYKQPITRIEIDDIRGVNSSGALSKLLAFDLIREAGKKDVVG
SCPB_BACHD      ELAPYFKKLLSTLQSGLSQAALETLAIIAYRQPITRIEVDEVRGVKSEKAIQTLTSRLLIKEVGRAQGTG
SCPB_CLOD6      DYAEXXXXXXXXXXXSLSQATLETLTIIAYKQPITKVEIEDIRGVKCDKVLQTLFENELIREAGRLNKIG
SCPB_STRS7      -----------PINQTLSRASLEVLSIVAYKQPITRIEIDEIRGVNSSGALSKLVAFGLVQEAGKKEVIG
SCPB_STRMU      DYADLLRQYSKPINQSLSRASLEVLSIIAYKQPITRIEVDNIRGVNSSSAISKLQAFDLIQEAGKKEVLG
SCPB_STREM      -----------PINQTLSRASLEVLSIVAYKQPITRIEIDEIRGVNSSGALSKLVAFGLVQEAGKKEVIG
SCPB_STRE4      -----------PINQTLSRASLEVLSIVAYKQPITRIEIDEIRGVNSSGALSKLVAFGLVQEAGKKEVIG
SCPB_MYCPN      EIKDFIHRYLKIKNP-LNSKTMEVLAIIAYNQPCTRPRINEIRGADSFQIVDDLLEKELIVELGRKDTPG
SCPB_ENTFA      -----------PMSNALSQAALETLSIIAYKQPISRIEIDEIRGVQTSGSIQKLVARQLIEEKGRVDGPG
SCPB_STRA5      SYMTLLRDYAKPINQSLSRASLEVLSIIAYKQPITRIEIDDIRGVNSSGAITRLIAFGLIKEAGKKEVLG
SCPB_STRA3      SYMTLLRDYAKPINQSLSRASLEVLSIIAYKQPITRIEIDDIRGVNSSGAITRLIAFGLIKEAGKKEVLG
SCPB_STRA1      SYMTLLRDYAKPINQSLSRASLEVLSIIAYKQPITRIEIDDIRGVNSSGAITRLIAFGLIKEAGKKEVLG
SCPB_LACPL      AVAPVLKRYFEPLTTSLSQASLEVLAIIAYRQPLTRIEIDEIRGVHSGSTIQKLVLRQLVTETGRLSEPG
SCPB_MYCPE      DISKIVASGIKQKNP-LNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVG
SCPB_MYCMO      ---------------RLSNAAIEVAGIVAYKQPISKSQINKIRGVASEIVVNTLLIKGIIEEVGIAQTPG
SCPB_MYCPU      ---------------KLSKAAIEVAGIVAYKQPITKSMINEIRGVASDQVVNTLLVKNLIEEVGISPTPG
SCPB_STAES      ETSTYIEQLVKESKMKLSQAAMETLSIIAYNQPLTRGDIEMIRGINSDGAVKTLIARGLVEAKDVDHSRS
SCPB_STAEQ      ETSTYIEQLVKESKMKLSQAAMETLSIIAYNQPLTRGDIEMIRGINSDGAVKTLIARGLVEAKDVDHSRS
SCPB_LACS1      ALAELVKKYLNSNNTELTGAALETLAIIAYKQPITRIGVDEIRGVQSSSMIQRLQLLELIKENGRLDAPG
SCPB_MYCGE      IIKDYLHLLLKVKNP-LNSKAMEVLAIIAYNQPCTRPRINEIRGVDSFQIVDDLIAKELIVELGRTDKPG
SCPB_STAS1      EASDYIEQLIEQSKMKLSQAAMESLSIIAYNQPLSRSDIELIRGINSDGAVKTLIARGLVE--AKEEADS
SCPB_STAAW      EAATYIEQLIEQSQMKLSQAAMEVLSIIAYNQPLSRSDIELIRSINSDGAVKTLIAKGLVKVVNEQ----
SCPB_STAAS      EAATYIEQLIEQSQMKLSQAAMEVLSIIAYNQPLSRSDIELIRSINSDGAVKTLIAKGLVKVVNEQ----
SCPB_STAAN      EAATYIEQLIEQSQMKLSQAAMEVLSIIAYNQPLSRSDIELIRSINSDGAVKTLIAKGLVKVVNEQ----
SCPB_STAAM      EAATYIEQLIEQSQMKLSQAAMEVLSIIAYNQPLSRSDIELIRSINSDGAVKTLIAKGLVKVVNEQ----
SCPB_STAA9      EAATYIEQLIEQSQMKLSQAAMEVLSIIAYNQPLSRSDIELIRSINSDGAVKTLIAKGLVKVVNEQ----
SCPB_STAA2      EAATYIEQLIEQSQMKLSQAAMEVLSIIAYNQPLSRSDIELIRSINSDGAVKTLIAKGLVKVVNEQ----
SCPB_STAA1      EAATYIEQLIEQSQMKLSQAAMEVLSIIAYNQPLSRSDIELIRSINSDGAVKTLIAKGLVKVVNEQ----
SCPB_STAHJ      EASPYIEQLIEQSNMKLSQAAMETLSIIAYNQPLSRSDIELIRGINSDGAVRTLIARGLIEAKDVENS--
SCPB_STAAE      EAATYIEQLIEQSQMKLSQAAMEVLSIIAYNQPLSRSDIELIRSINSDGAVKTLIAKGLVKVVNEQ----
SCPB_STAAC      EAATYIEQLIEQSQMKLSQAAMEVLSIIAYNQPLSRSDIELIRSINSDGAVKTLIAKGLVKVVNEQ----
SCPB_STAA8      EAATYIEQLIEQSQMKLSQAAMEVLSIIAYNQPLSRSDIELIRSINSDGAVKTLIAKGLVKVVNEQ----
SCPB_STAA3      EAATYIEQLIEQSQMKLSQAAMEVLSIIAYNQPLSRSDIELIRSINSDGAVKTLIAKGLVKVVNEQ----
SCPB_STAAR      EASMYIEQLIEQSQMKLSQAAMEVLSIIAYNQPLSRSDIELIRSINSDGAVKTLIAKGLVKVVNEQ----


                         +         .         .         .         .         *         .:210
query           RPKLYGTTERFLEVFGLESLEDLPPLREDGPPxxxxx
SCPB_MOOTA      RPILYGTTPKFLEFFGLKDLKELPPLED---------
SCPB_SYMTH      RPILYGTTAEFLRYFGLRELSELPPVEID--------
SCPB_PELCD      RPLLYGTSREFLEFFGLRSLSDLPTLKE---------
SCPB_DESRM      RPVLYGTTLEFLKHFGLKDVSELPPLEE---------
SCPBL_COXBU     KPALFGTTKTFLDYFNLKSLEELPPLED---------
SCPB_PEDPA      RPKTYGTTDEFLDYFGLEDIKDLPKLEKVG-------
SCPB_BACHK      RPILYGTTKEFLDTFGLKTLDDLPPLSEE--------
SCPB_BACC3      RPILYGTTKEFLDTFGLKTLDDLPPLSEE--------
SCPB_BACC0      RPILYGTTKEFLDTFGLKTLDDLPPLSEE--------
SCPB_BACAN      RPILYGTTKEFLDTFGLKTLDDLPPLSEE--------
SCPB_BACAH      RPILYGTTKEFLDTFGLKTLDDLPPLSEE--------
SCPB_BACAC      RPILYGTTKEFLDTFGLKTLDDLPPLSEE--------
SCPB_BACAA      RPILYGTTKEFLDTFGLKTLDDLPPLSEE--------
SCPB_BACCQ      RPILYGTTKEFLDTFGLKTLDDLPPLSEE--------
SCPB_BACC7      RPILYGTTKEFLDTFGLKTLDDLPPLSEE--------
SCPB_BACCZ      RPILYGTTKEFLDTFGLKTLDDLPPLSEE--------
SCPB_BACC1      RPILYGTTKEFLDTFGLKTLDDLPPLSEE--------
SCPB_CARHZ      RPIIYRTTAKFLEFFGLKSLD----------------
SCPB_BACP2      RAILYGTTPTFLEQFGLKALDELPPLPEN--------
SCPB_BACC2      RPILYGTTKEFLDTFGLKTLDDLPPLSEE--------
SCPB_BACCR      RPILYGTTKEFLDTFGLKTLDDLPPLSEE--------
SCPB_BACC4      RPILYGTTKEFLDTFGLKTLDDLPPLSEE--------
SCPB_BACWK      RPILYGTTKEFLDTFGLKTLDDLPPLSEE--------
SCPB_BACSU      RAILYGTTPTFLEQFGLKTLDELPPLPEN--------
SCPB_LACDA      HPKLYVTTDYFLQYFGYKSLADLP-------------
SCPB_GEOTN      RPILYGTTAEFLDYFGLKT------------------
SCPB_BACSK      RAILYGTTPYFLDHFGLESLADLPDLKE---------
SCPB_BACCN      RPILYGTTKEFLDTFGLQTLDDLPALSEE--------
SCPB_LISMO      RAKLYVTTSEFLDAFGLNSLEDLPKLAD---------
SCPB_CLOB6      KPILYGTTEEFLKFFGLDSIEAIPNLED---------
SCPB_CLOBM      KPILYGTTEEFLKFFGLDSIEAIPNLED---------
SCPB_CLOBL      KPILYGTTEEFLKFFGLDSIEAIPNLED---------
SCPB_CLOBK      KPILYGTTEEFLKFFGLDSIEAIPNLED---------
SCPB_CLOBJ      KPILYGTTEEFLKFFGLDSIEAIPNLED---------
SCPB_CLOBH      KPILYGTTEEFLKFFGLDSIEAIPNLED---------
SCPB_CLOB1      KPILYGTTEEFLKFFGLDSIEAIPNLED---------
SCPB_GEOKA      RPILYGTTPEFLDYFGLKT------------------
SCPB_EUBR3      RPLLFGTTEEFLRSFGVSSIDELPVL-----------
SCPB_LISW6      RAKLYVTTSEFLDAFGLNSLEDLPKLAD---------
SCPB_LISMH      RAKLYVTTSEFLDAFGLNSLEDLPKLAD---------
SCPB_STRZT      RPNLYVTTDYFLDYMGINHLEELPVIDE---------
SCPB_STRZP      RPNLYVTTDYFLDYMGINHLEELPVIDE---------
SCPB_STRZJ      RPNLYVTTDYFLDYMGINHLEELPVIDE---------
SCPB_STRR6      RPNLYVTTDYFLDYMGINHLEELPVIDE---------
SCPB_STRPS      RPNLYVTTDYFLDYMGINHLEELPVIDE---------
SCPB_STRPN      RPNLYVTTDYFLDYMGINHLEELPVIDE---------
SCPB_STRPJ      RPNLYVTTDYFLDYMGINHLEELPVIDE---------
SCPB_STRPI      RPNLYVTTDYFLDYMGINHLEELPVIDE---------
SCPB_STRP7      RPNLYVTTDYFLDYMGINHLEELPVIDE---------
SCPB_STRP4      RPNLYVTTDYFLDYMGINHLEELPVIDE---------
SCPB_STRP2      RPNLYVTTDYFLDYMGINHLEELPVIDE---------
SCPB_LISMF      RAKLYVTTSEFLDAFGLNSLEDLPKLAD---------
SCPB_LISMC      RAKLYVTTSEFLDAFGLNSLEDLPKLAD---------
SCPB_LACSS      RPILYGTSDYFLDYFGLGSLKELPELEQ---------
SCPB_OCEIH      RPVLFQTSKEFLTFFGLATLDDLPPLPENIDP-----
SCPB_ALKOO      RPIIYGTTINFLKVFSISSLDNLP-------------
SCPB_LEUMM      RPIMFGTTDEFLDYFGLKSIEELPPL-----------
SCPB_CLOPH      RPILFGTTEDFLRNFGIASLEDLP-------------
SCPB_BREBN      RPILYATTKEFLEHFGLRELGDLP-------------
SCPB_LACJO      HPNLYVTTDYFLQYFNYESLADLPVIEE---------
SCPB_CLOTH      KPVLYETTDEFFRSFGFKSDADLP-------------
SCPB_LISIN      RAKLYVTTSEFLDAFGLNSLDDLPKLAD---------
SCPB_BACLD      RAILYGTTETFLEQFGLKT------------------
SCPB_STRMT      RPNLYVTTDYFLDYMGINHLEELPVIDE---------
SCPB_MYCGA      RPFLYNVSEKFFDLFGIESIDDLPQIKHFDP------
SCPB_CLOTE      RPILYSTTEEFLKHFG---------------------
SCPB_LACLS      RPSLYATTEFFLDYIGINNLEELPEIDE---------
SCPB_LACLM      RPSLYATTEFFLDYIGINNLEELPEIDE---------
SCPB_LACGA      HPNLYVTTDYFLQYFNYESLADLPVIEE---------
SCPB_CLOAB      RPILYETTDEFLKNFNLGNIDELPPMEQ---------
SCPB_ALKMQ      RPILFGTTLHFLKNFGLKSLEDLPKITE---------
SCPB_STRGC      RPNLYVTTEYFLDYMGINHLEELP-------------
SCPB_LACLA      RPSLYATTDFFLDYIGINHLDELPEIDE---------
SCPB_STRSV      RPNLYVTTDYFLDYMGINHLDELPIVEE---------
SCPB_CLOCE      RPRLYETTDEFLRCFGFKSI-----------------
SCPB_UREPA      HPILYTVSQKFYDLFGIRNLTELPRLNKE--------
SCPB_STRPZ      RPHLYATTDYFLDYMGINHLDEL--------------
SCPB_STRPM      RPHLYATTDYFLDYMGINHLDEL--------------
SCPB_STRPG      RPHLYATTDYFLDYMGINHLDEL--------------
SCPB_STRPF      RPHLYATTDYFLDYMGINHLDEL--------------
SCPB_STRPD      RPHLYATTDYFLDYMGINHLDEL--------------
SCPB_STRP8      RPHLYATTDYFLDYMGINHLDEL--------------
SCPB_STRP6      RPHLYATTDYFLDYMGINHLDEL--------------
SCPB_STRP3      RPHLYATTDYFLDYMGINHLDEL--------------
SCPB_STRP1      RPHLYATTDYFLDYMGINHLDEL--------------
SCPB_STRT2      RPNLYATTDYFLDYIGINSLDEL--------------
SCPB_BACA2      RAILYGTTPVFLEQFGLKT------------------
SCPB_CLOPE      RPILYGTTDEFLRHFALNDLGDLPSI-----------
SCPB_CLOP1      RPILYGTTDEFLRHFALNDLGDLPSI-----------
SCPB_STRT1      RPNLYATTDYFLDYIGINSLDEL--------------
SCPB_CLOPS      RPILYGTTDEFLRHFALNDLGDLPSI-----------
SCPB_THETN      RPILYSTTEDFLKYFGISSLKELPEI-----------
SCPB_STRPC      RPHLYATTDYFLDYMGINHLDEL--------------
SCPB_STRPB      RPHLYATTDYFLDYMGINHLDEL--------------
SCPB_BACHD      RPILYGTTPQFLDHFG---------------------
SCPB_CLOD6      KPIIYKTTDEFLKLLNIESLEELPPI-----------
SCPB_STRS7      RPNLYATTDYFLDYMGINHLEEL--------------
SCPB_STRMU      RPNLYVTSDYFLDYMGINSLEELP-------------
SCPB_STREM      RPNLYATTDYFLDYMGINHLEEL--------------
SCPB_STRE4      RPNLYATTDYFLDYMGINHLEEL--------------
SCPB_MYCPN      RPFIYEVSPKFYDLFGINSLDELP-------------
SCPB_ENTFA      RAILYGTTKYFMDYFGLKSLDELPDIQQ---------
SCPB_STRA5      RPNLYETTNYFLDYMGINQLDDL--------------
SCPB_STRA3      RPNLYETTNYFLDYMGINQLDDL--------------
SCPB_STRA1      RPNLYETTNYFLDYMGINQLDDL--------------
SCPB_LACPL      RPILYGTTELFLDYFGLKS------------------
SCPB_MYCPE      KPYLYQVTPKFYDIFGLDSIKDLPEI-----------
SCPB_MYCMO      NPILYGVTAKFYDYFKIKSLHELPNLKE---------
SCPB_MYCPU      KPVLYGITNKFYDYFKIKSLQELPNLSE---------
SCPB_STAES      HHLI--TTDLFLNVFGIENLDALPTTEED--------
SCPB_STAEQ      HHLI--TTDLFLNVFGIENLDALPTTEED--------
SCPB_LACS1      RPILYVTTDKFLDYFGLES------------------
SCPB_MYCGE      RPFIYEVSAKFYDLFGIDSLDQLPKI-----------
SCPB_STAS1      RSHQLYTTELFLNVFGI--------------------
SCPB_STAAW      RSQQLITTDLFLNVFGISNI-----------------
SCPB_STAAS      RSQQLITTDLFLNVFGISNI-----------------
SCPB_STAAN      RSQQLITTDLFLNVFGISNI-----------------
SCPB_STAAM      RSQQLITTDLFLNVFGISNI-----------------
SCPB_STAA9      RSQQLITTDLFLNVFGISNI-----------------
SCPB_STAA2      RSQQLITTDLFLNVFGISNI-----------------
SCPB_STAA1      RSQQLITTDLFLNVFGISNI-----------------
SCPB_STAHJ      RSHALQTTDLFLNVFGIEKI-----------------
SCPB_STAAE      RSQQLITTDLFLNVFGISNI-----------------
SCPB_STAAC      RSQQLITTDLFLNVFGISNI-----------------
SCPB_STAA8      RSQQLITTDLFLNVFGISNI-----------------
SCPB_STAA3      RSQQLITTDLFLNVFGISNI-----------------
SCPB_STAAR      RSQQLITTDLFLNVFGISNI-----------------