[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tthe0:AAS80787.1

[Show Plain Result]


## Summary of Sequence Search
    1::195
   21::212     4e-25  42%  346 aa  YWLC_BACSU RecName: Full=Uncharacterized protein ywlC;
    7::187     2e-24  37%  187 aa  RIMN_XANCP RecName: Full=Putative ribosome maturation factor rimN;
    7::187     2e-24  37%  187 aa  RIMN_XANCB RecName: Full=Putative ribosome maturation factor rimN;
    7::187     2e-24  37%  187 aa  RIMN_XANC8 RecName: Full=Putative ribosome maturation factor rimN;
    7::184     4e-23  35%  186 aa  RIMN_AERS4 RecName: Full=Putative ribosome maturation factor rimN;
    7::187     2e-22  35%  187 aa  RIMN_XANC5 RecName: Full=Putative ribosome maturation factor rimN;
    8::190     4e-22  37%  190 aa  RIMN_SHISS RecName: Full=Putative ribosome maturation factor rimN;
    8::190     4e-22  37%  190 aa  RIMN_SHIF8 RecName: Full=Putative ribosome maturation factor rimN;
    8::190     4e-22  37%  190 aa  RIMN_SHIB3 RecName: Full=Putative ribosome maturation factor rimN;
    8::190     4e-22  37%  190 aa  RIMN_ECOUT RecName: Full=Putative ribosome maturation factor rimN;
    8::190     4e-22  37%  190 aa  RIMN_ECOSM RecName: Full=Putative ribosome maturation factor rimN;
    7::190     4e-22  37%  190 aa  RIMN_ECOLI RecName: Full=Putative ribosome maturation factor rimN;
    7::190     4e-22  37%  190 aa  RIMN_ECOLC RecName: Full=Putative ribosome maturation factor rimN;
    8::190     4e-22  37%  190 aa  RIMN_ECOL6 RecName: Full=Putative ribosome maturation factor rimN;
    8::190     4e-22  37%  190 aa  RIMN_ECOL5 RecName: Full=Putative ribosome maturation factor rimN;
    8::190     4e-22  37%  190 aa  RIMN_ECOK1 RecName: Full=Putative ribosome maturation factor rimN;
    7::190     4e-22  37%  190 aa  RIMN_ECOHS RecName: Full=Putative ribosome maturation factor rimN;
    7::190     4e-22  37%  190 aa  RIMN_ECODH RecName: Full=Putative ribosome maturation factor rimN;
    8::190     4e-22  37%  190 aa  RIMN_ECO24 RecName: Full=Putative ribosome maturation factor rimN;
    8::190     6e-22  37%  190 aa  RIMN_ECO57 RecName: Full=Putative ribosome maturation factor rimN;
    8::190     6e-22  37%  190 aa  RIMN_CITK8 RecName: Full=Putative ribosome maturation factor rimN;
    8::190     8e-22  37%  190 aa  RIMN_SHIDS RecName: Full=Putative ribosome maturation factor rimN;
    7::187     1e-21  35%  187 aa  RIMN_XANOR RecName: Full=Putative ribosome maturation factor rimN;
    7::187     1e-21  35%  187 aa  RIMN_XANOP RecName: Full=Putative ribosome maturation factor rimN;
    7::187     1e-21  35%  187 aa  RIMN_XANOM RecName: Full=Putative ribosome maturation factor rimN;
   12::190     2e-21  34%  190 aa  RIMN_MARAV RecName: Full=Putative ribosome maturation factor rimN;
    8::190     2e-21  36%  190 aa  RIMN_KLEP7 RecName: Full=Putative ribosome maturation factor rimN;
    8::190     4e-21  37%  190 aa  RIMN_SHIFL RecName: Full=Putative ribosome maturation factor rimN;
    7::187     6e-21  33%  187 aa  RIMN_XANAC RecName: Full=Putative ribosome maturation factor rimN;
    8::190     6e-21  37%  190 aa  RIMN_SHIBS RecName: Full=Putative ribosome maturation factor rimN;
   13::187     6e-21  38%  189 aa  RIMN_CELJU RecName: Full=Putative ribosome maturation factor rimN;
    9::190     1e-20  36%  190 aa  RIMN_SALAR RecName: Full=Putative ribosome maturation factor rimN;
   16::190     1e-20  35%  191 aa  RIMN_HALHL RecName: Full=Putative ribosome maturation factor rimN;
    9::190     2e-20  35%  190 aa  RIMN_ENT38 RecName: Full=Putative ribosome maturation factor rimN;
   11::185     2e-20  35%  185 aa  RIMN_NITOC RecName: Full=Putative ribosome maturation factor rimN;
    6::184     2e-20  36%  184 aa  RIMN_HAHCH RecName: Full=Putative ribosome maturation factor rimN;
    4::185     4e-20  32%  185 aa  RIMN_VIBF1 RecName: Full=Putative ribosome maturation factor rimN;
    9::190     9e-20  35%  190 aa  RIMN_SALTY RecName: Full=Putative ribosome maturation factor rimN;
    9::190     9e-20  35%  190 aa  RIMN_SALPB RecName: Full=Putative ribosome maturation factor rimN;
    9::190     9e-20  35%  190 aa  RIMN_SALCH RecName: Full=Putative ribosome maturation factor rimN;
   17::204     1e-19  40%  217 aa  Y1301_MYCTU RecName: Full=Uncharacterized protein Rv1301/MT1340;
   16::187     2e-19  34%  188 aa  RIMN_SHESW RecName: Full=Putative ribosome maturation factor rimN;
   16::187     2e-19  34%  188 aa  RIMN_SHEPC RecName: Full=Putative ribosome maturation factor rimN;
   16::187     2e-19  34%  188 aa  RIMN_SHEB8 RecName: Full=Putative ribosome maturation factor rimN;
   16::187     2e-19  34%  188 aa  RIMN_SHEB5 RecName: Full=Putative ribosome maturation factor rimN;
    7::187     3e-19  33%  187 aa  RIMN_SHEPA RecName: Full=Putative ribosome maturation factor rimN;
    9::190     3e-19  35%  190 aa  RIMN_SALPA RecName: Full=Putative ribosome maturation factor rimN;
   16::187     4e-19  34%  188 aa  RIMN_SHEB9 RecName: Full=Putative ribosome maturation factor rimN;
    5::185     5e-19  32%  185 aa  RIMN_VIBHB RecName: Full=Putative ribosome maturation factor rimN;
    8::190     5e-19  34%  190 aa  RIMN_ENTS8 RecName: Full=Putative ribosome maturation factor rimN;
   11::190     6e-19  35%  190 aa  RIMN_SALTI RecName: Full=Putative ribosome maturation factor rimN;
    9::183     6e-19  38%  185 aa  RIMN_PSEMY RecName: Full=Putative ribosome maturation factor rimN;
    7::186     1e-18  32%  187 aa  RIMN_XYLFA RecName: Full=Putative ribosome maturation factor rimN;
    6::185     1e-18  34%  186 aa  RIMN_STRMK RecName: Full=Putative ribosome maturation factor rimN;
   20::183     1e-18  38%  185 aa  RIMN_PSEU5 RecName: Full=Putative ribosome maturation factor rimN;
    7::183     1e-18  33%  183 aa  RIMN_HAEIN RecName: Full=Putative ribosome maturation factor rimN;
   10::188     1e-18  34%  188 aa  RIMN_SHEFN RecName: Full=Putative ribosome maturation factor rimN;
    9::185     1e-18  36%  185 aa  RIMN_PSEPK RecName: Full=Putative ribosome maturation factor rimN;
    7::186     2e-18  32%  187 aa  RIMN_XYLFT RecName: Full=Putative ribosome maturation factor rimN;
    7::186     2e-18  32%  187 aa  RIMN_XYLF2 RecName: Full=Putative ribosome maturation factor rimN;
    5::186     2e-18  32%  186 aa  RIMN_VIBVY RecName: Full=Putative ribosome maturation factor rimN;
    5::186     2e-18  32%  186 aa  RIMN_VIBVU RecName: Full=Putative ribosome maturation factor rimN;
   11::185     2e-18  32%  185 aa  RIMN_VIBPA RecName: Full=Putative ribosome maturation factor rimN;
   16::187     2e-18  34%  188 aa  RIMN_SHEDO RecName: Full=Putative ribosome maturation factor rimN;
    9::185     2e-18  35%  185 aa  RIMN_PSEE4 RecName: Full=Putative ribosome maturation factor rimN;
    7::186     3e-18  32%  187 aa  RIMN_XYLFM RecName: Full=Putative ribosome maturation factor rimN;
    9::185     4e-18  36%  185 aa  RIMN_PSEPG RecName: Full=Putative ribosome maturation factor rimN;
    9::185     4e-18  35%  185 aa  RIMN_PSE14 RecName: Full=Putative ribosome maturation factor rimN;
    7::183     4e-18  32%  183 aa  RIMN_HAEIG RecName: Full=Putative ribosome maturation factor rimN;
    7::183     4e-18  32%  183 aa  RIMN_HAEIE RecName: Full=Putative ribosome maturation factor rimN;
    8::184     4e-18  31%  186 aa  RIMN_AERHH RecName: Full=Putative ribosome maturation factor rimN;
   19::193     5e-18  32%  193 aa  RIMN_CHRVO RecName: Full=Putative ribosome maturation factor rimN;
   13::182     7e-18  33%  191 aa  RIMN_SACD2 RecName: Full=Putative ribosome maturation factor rimN;
    9::185     7e-18  35%  185 aa  RIMN_PSEP1 RecName: Full=Putative ribosome maturation factor rimN;
   10::183     7e-18  35%  185 aa  RIMN_PSEAE RecName: Full=Putative ribosome maturation factor rimN;
   10::183     7e-18  35%  185 aa  RIMN_PSEAB RecName: Full=Putative ribosome maturation factor rimN;
    7::183     7e-18  33%  183 aa  RIMN_HAEI8 RecName: Full=Putative ribosome maturation factor rimN;
   10::183     1e-17  35%  185 aa  RIMN_PSEA7 RecName: Full=Putative ribosome maturation factor rimN;
    9::183     1e-17  35%  185 aa  RIMN_PSEF5 RecName: Full=Putative ribosome maturation factor rimN;
    3::185     3e-17  29%  185 aa  RIMN_SHEWM RecName: Full=Putative ribosome maturation factor rimN;
   11::187     3e-17  32%  188 aa  RIMN_SHEON RecName: Full=Putative ribosome maturation factor rimN;
    9::185     3e-17  35%  185 aa  RIMN_PSEU2 RecName: Full=Putative ribosome maturation factor rimN;
    9::185     3e-17  35%  185 aa  RIMN_PSESM RecName: Full=Putative ribosome maturation factor rimN;
   13::187     3e-17  30%  187 aa  RIMN_SHEAM RecName: Full=Putative ribosome maturation factor rimN;
    9::186     3e-17  36%  186 aa  RIMN_METCA RecName: Full=Putative ribosome maturation factor rimN;
    7::187     6e-17  31%  187 aa  RIMN_SHEHH RecName: Full=Putative ribosome maturation factor rimN;
    9::185     6e-17  35%  185 aa  RIMN_PSEPW RecName: Full=Putative ribosome maturation factor rimN;
   16::187     7e-17  32%  188 aa  RIMN_SHESR RecName: Full=Putative ribosome maturation factor rimN;
   16::187     7e-17  32%  188 aa  RIMN_SHESM RecName: Full=Putative ribosome maturation factor rimN;
    3::185     7e-17  31%  185 aa  RIMN_SHESH RecName: Full=Putative ribosome maturation factor rimN;
   16::187     1e-16  32%  188 aa  RIMN_SHESA RecName: Full=Putative ribosome maturation factor rimN;
    9::183     1e-16  35%  185 aa  RIMN_PSEPF RecName: Full=Putative ribosome maturation factor rimN;
    5::181     1e-16  34%  182 aa  RIMN_ALCBS RecName: Full=Putative ribosome maturation factor rimN;
    5::188     2e-16  31%  188 aa  RIMN_VIBCH RecName: Full=Putative ribosome maturation factor rimN;
    5::188     2e-16  31%  188 aa  RIMN_VIBC3 RecName: Full=Putative ribosome maturation factor rimN;
   14::189     3e-16  31%  189 aa  RIMN_SERP5 RecName: Full=Putative ribosome maturation factor rimN;
   20::202     4e-16  39%  220 aa  Y1136_MYCLE RecName: Full=Uncharacterized protein ML1136;
    9::190     6e-16  32%  190 aa  RIMN_YERE8 RecName: Full=Putative ribosome maturation factor rimN;
    4::185     8e-16  30%  185 aa  RIMN_PHOPR RecName: Full=Putative ribosome maturation factor rimN;
    8::189     8e-16  31%  189 aa  RIMN_PHOLL RecName: Full=Putative ribosome maturation factor rimN;
    3::185     1e-15  30%  185 aa  RIMN_SHELP RecName: Full=Putative ribosome maturation factor rimN;
    6::186     1e-15  28%  186 aa  RIMN_IDILO RecName: Full=Putative ribosome maturation factor rimN;
    4::185     4e-15  29%  186 aa  RIMN_COXBU RecName: Full=Putative ribosome maturation factor rimN;
   10::179     5e-15  32%  180 aa  RIMN_METFK RecName: Full=Putative ribosome maturation factor rimN;
   23::184     5e-15  37%  185 aa  RIMN_CHRSD RecName: Full=Putative ribosome maturation factor rimN;
    4::185     9e-15  29%  186 aa  RIMN_COXBR RecName: Full=Putative ribosome maturation factor rimN;
    7::183     2e-14  31%  183 aa  RIMN_ACTSZ RecName: Full=Putative ribosome maturation factor rimN;
   10::190     3e-14  31%  190 aa  RIMN_YERPY RecName: Full=Putative ribosome maturation factor rimN;
   10::190     3e-14  31%  190 aa  RIMN_YERPS RecName: Full=Putative ribosome maturation factor rimN;
   10::190     3e-14  31%  190 aa  RIMN_YERPP RecName: Full=Putative ribosome maturation factor rimN;
   10::190     3e-14  31%  190 aa  RIMN_YERPN RecName: Full=Putative ribosome maturation factor rimN;
   10::190     3e-14  31%  190 aa  RIMN_YERPG RecName: Full=Putative ribosome maturation factor rimN;
   10::190     3e-14  31%  190 aa  RIMN_YERPE RecName: Full=Putative ribosome maturation factor rimN;
   10::190     3e-14  31%  190 aa  RIMN_YERPB RecName: Full=Putative ribosome maturation factor rimN;
   10::190     3e-14  31%  190 aa  RIMN_YERPA RecName: Full=Putative ribosome maturation factor rimN;
   10::190     3e-14  31%  190 aa  RIMN_YERP3 RecName: Full=Putative ribosome maturation factor rimN;
    4::185     3e-14  28%  186 aa  RIMN_COXBN RecName: Full=Putative ribosome maturation factor rimN;
    4::184     6e-14  30%  184 aa  RIMN_ACTPJ RecName: Full=Putative ribosome maturation factor rimN;
    4::184     6e-14  30%  184 aa  RIMN_ACTP7 RecName: Full=Putative ribosome maturation factor rimN;
   11::172     1e-13  31%  190 aa  RIMN_ALHEH RecName: Full=Putative ribosome maturation factor rimN;
    4::184     1e-13  29%  184 aa  RIMN_ACTP2 RecName: Full=Putative ribosome maturation factor rimN;
    3::183     2e-13  28%  183 aa  RIMN_HAES1 RecName: Full=Putative ribosome maturation factor rimN;
    4::186     2e-13  27%  187 aa  RIMN_PSEHT RecName: Full=Putative ribosome maturation factor rimN;
    3::183     2e-13  30%  183 aa  RIMN_MANSM RecName: Full=Putative ribosome maturation factor rimN;
    3::183     2e-13  27%  183 aa  RIMN_HAES2 RecName: Full=Putative ribosome maturation factor rimN;
    6::184     9e-13  30%  185 aa  RIMN_MARMS RecName: Full=Putative ribosome maturation factor rimN;
    8::182     1e-12  29%  183 aa  RIMN_COLP3 RecName: Full=Putative ribosome maturation factor rimN;
    1::189     1e-12  30%  189 aa  RIMN_BLOFL RecName: Full=Putative ribosome maturation factor rimN;
   15::134     2e-12  36%  207 aa  Y062_METJA RecName: Full=Uncharacterized protein MJ0062;
    7::127     3e-12  34%  191 aa  RIMN_PSYIN RecName: Full=Putative ribosome maturation factor rimN;
    7::192     6e-12  30%  192 aa  RIMN_ACIAD RecName: Full=Putative ribosome maturation factor rimN;
   10::190     7e-12  28%  190 aa  RIMN_SODGM RecName: Full=Putative ribosome maturation factor rimN;
   10::214     7e-12  32%  214 aa  RIMN_PSYCK RecName: Full=Putative ribosome maturation factor rimN;
   17::171     7e-12  28%  187 aa  RIMN_PSEA6 RecName: Full=Putative ribosome maturation factor rimN;
   14::198     2e-11  27%  206 aa  YCIO_SHIFL RecName: Full=Uncharacterized protein yciO;
   14::198     2e-11  27%  206 aa  YCIO_ECOLI RecName: Full=Uncharacterized protein yciO;
   14::198     2e-11  27%  206 aa  YCIO_ECOL6 RecName: Full=Uncharacterized protein yciO;
   39::200     2e-11  39%  408 aa  SUA5_SCHPO RecName: Full=Protein sua5;
   10::214     4e-11  32%  214 aa  RIMN_PSYA2 RecName: Full=Putative ribosome maturation factor rimN;
   19::200     8e-11  30%  207 aa  Y1198_HAEIN RecName: Full=Uncharacterized protein HI1198;
    3::183     1e-10  28%  183 aa  RIMN_PASMU RecName: Full=Putative ribosome maturation factor rimN;
    4::184     2e-10  27%  184 aa  RIMN_HAEDU RecName: Full=Putative ribosome maturation factor rimN;
    5::188     3e-10  29%  189 aa  RIMN_ACIBY RecName: Full=Putative ribosome maturation factor rimN;
    5::188     3e-10  29%  189 aa  RIMN_ACIBT RecName: Full=Putative ribosome maturation factor rimN;
    5::188     3e-10  29%  189 aa  RIMN_ACIBS RecName: Full=Putative ribosome maturation factor rimN;
    5::188     3e-10  29%  189 aa  RIMN_ACIBC RecName: Full=Putative ribosome maturation factor rimN;
    6::188     7e-10  24%  190 aa  RIMN_BUCAP RecName: Full=Putative ribosome maturation factor rimN;
   30::198     7e-10  28%  198 aa  RIMN_BAUCH RecName: Full=Putative ribosome maturation factor rimN;
   11::189     1e-09  30%  189 aa  RIMN_NEIG1 RecName: Full=Putative ribosome maturation factor rimN;
   11::189     2e-09  31%  189 aa  RIMN_NEIMF RecName: Full=Putative ribosome maturation factor rimN;
   11::189     2e-09  31%  189 aa  RIMN_NEIMB RecName: Full=Putative ribosome maturation factor rimN;
   11::189     2e-09  31%  189 aa  RIMN_NEIMA RecName: Full=Putative ribosome maturation factor rimN;
   11::189     2e-09  31%  189 aa  RIMN_NEIM0 RecName: Full=Putative ribosome maturation factor rimN;
   18::187     2e-09  30%  188 aa  RIMN_THIDA RecName: Full=Putative ribosome maturation factor rimN;
   22::194     2e-09  26%  194 aa  RIMN_BLOPB RecName: Full=Putative ribosome maturation factor rimN;
   14::159     3e-09  25%  194 aa  RIMN_WIGBR RecName: Full=Putative ribosome maturation factor rimN;
   84::187     6e-09  35%  276 aa  YRDC_BOVIN RecName: Full=YrdC domain-containing protein,
   49::203     2e-08  33%  426 aa  SUA5_YEAST RecName: Full=Protein SUA5;
   11::186     3e-08  28%  186 aa  RIMN_THICR RecName: Full=Putative ribosome maturation factor rimN;
   87::190     2e-07  35%  280 aa  YRDC_RAT RecName: Full=YrdC domain-containing protein,
   87::190     2e-07  35%  280 aa  YRDC_MOUSE RecName: Full=YrdC domain-containing protein,
   86::189     4e-07  32%  279 aa  YRDC_HUMAN RecName: Full=YrdC domain-containing protein,
    2::173     4e-07  25%  175 aa  RIMN_BUCAI RecName: Full=Putative ribosome maturation factor rimN;
    5::186     1e-06  23%  186 aa  RIMN_BUCBP RecName: Full=Putative ribosome maturation factor rimN;
  206::345     1e-04  30%  759 aa  HYPF_RHILV RecName: Full=Carbamoyltransferase hypF;       
  218::286     7e-04  39%  312 aa  MRAW_BACLD RecName: Full=S-adenosyl-L-methionine-dependent
    1::195

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MERVYQEALAKAAETLKGGGLVAFPTDTVWGVLALMEDEAACKRIYEVKGRPEDKPLQVLVADLESALEL
YWLC_BACSU      --------IAQAAALLRENEVVAFPTETVYGLGANAKNTDAVKKIYEAKGRPSDNPLIVHIADISQLEDL
RIMN_XANCP      --------LDAAVATLARGGVIAYPTEAVWGLGCDPRQEDAVLRLLEIKRRPVDKGVIVVASGLDVLQDW
RIMN_XANCB      --------LDAAVATLARGGVIAYPTEAVWGLGCDPRQEDAVLRLLEIKRRPVDKGVIVVASGLDVLQDW
RIMN_XANC8      --------LDAAVATLARGGVIAYPTEAVWGLGCDPRQEDAVLRLLEIKRRPVDKGVIVVASGLDVLQDW
RIMN_AERS4      ----------QAVAALHGEGVIAYATEAVFGLGCDPDSELAVQRLLAIKQRPVEKGLILIAADLVQLQDY
RIMN_XANC5      --------LDRAVATLTQGGVIAYPTEAVWGLGCDPRQEAAVLRLLEIKRRPVEKGVIVVASSVDLLRDW
RIMN_SHISS      ------DAIAAAIDVLNEERVIAYPTEAVFGVGCDPDSETAVMRLLELKQRPVDKGLILIAANYEQLKPY
RIMN_SHIF8      ------DAIAAAIDVLNEKRVIAYPTEAVFGVGCDPDSETAVMRLLELKQRPVDKGLILIAANYEQLKPY
RIMN_SHIB3      ------DAIAAAIDVLNEERVIAYPTEAVFGVGCDPDSETAVMRLLELKQRPVDKGLILIAANYEQLKPY
RIMN_ECOUT      ------DAIAAAIDVLNEERVIAYPTEAVFGVGCDPDSETAVMRLLELKQRPVDKGLILIAANYEQLKPY
RIMN_ECOSM      ------DAIAAAIDVLNEERVIAYPTEAVFGVGCDPDSETAVMRLLELKQRPVDKGLILIAANYEQLKPY
RIMN_ECOLI      -----RDAIAAAIDVLNEERVIAYPTEAVFGVGCDPDSETAVMRLLELKQRPVDKGLILIAANYEQLKPY
RIMN_ECOLC      -----RDAIAAAIDVLNEERVIAYPTEAVFGVGCDPDSETAVMRLLELKQRPVDKGLILIAANYEQLKPY
RIMN_ECOL6      ------DAIAAAIDVLNEERVIAYPTEAVFGVGCDPDSETAVMRLLELKRRPVDKGLILIAANYEQLKPY
RIMN_ECOL5      ------DAIAAAIDVLNEERVIAYPTEAVFGVGCDPDSETAVMRLLELKQRPVDKGLILIAANYEQLKPY
RIMN_ECOK1      ------DAIAAAIDVLNEERVIAYPTEAVFGVGCDPDSETAVMRLLELKQRPVDKGLILIAANYEQLKPY
RIMN_ECOHS      -----RDAIAAAIDVLNEERVIAYPTEAVFGVGCDPDSETAVMRLLELKQRPVDKGLILIAANYEQLKPY
RIMN_ECODH      -----RDAIAAAIDVLNEERVIAYPTEAVFGVGCDPDSETAVMRLLELKQRPVDKGLILIAANYEQLKPY
RIMN_ECO24      ------DAIAAAIDVLNEERVIAYPTEAVFGVGCDPDSETAVMRLLELKQRPVDKGLILIAANYEQLKPY
RIMN_ECO57      ------DAIAAAIDVLNEERVIAYPTEAVFGVGCDPDSETAVMRLLELKQRPVDKGLILIAANYEQLKPY
RIMN_CITK8      ------DAIAAAVAVLHKECVIAYPTEAVFGVGCDPDSETAVNRLLELKQRPVEKGLILIAANFEQLKPY
RIMN_SHIDS      ------DAIAAAIDVLNEERVIAYPTEAVFGVGCDPDSETAVMRLLELKLRPVDKGLILIAANYEQLKPY
RIMN_XANOR      --------LDNAVATLTQGGVIAYPTEAVWGLGCDPRQEAAVLRLLEIKRRPVDKGVIVVTSRVDVLRDW
RIMN_XANOP      --------LDNAVATLTQGGVIAYPTEAVWGLGCDPRQEAAVLRLLEIKRRPVDKGVIVVTSRVDVLRDW
RIMN_XANOM      --------LDNAVATLTQGGVIAYPTEAVWGLGCDPRQEAAVLRLLEIKRRPVDKGVIVVTSRVDVLRDW
RIMN_MARAV      --------LALARQTVLAGGVIAYPTEAVWGLGCDPWNREAVEYILELKQRPMEKGVILVAASVEQVRFL
RIMN_KLEP7      ------EAVAHAVAVLKNEHVIAYPTEAVFGVGCDPDSETAVMRLLELKQRPVEKGLILIAASFEQLKPY
RIMN_SHIFL      ------DAIAAAIDVLNEKRVIAYPTEAVFGVGCDPDSETAVMRLLELKQRPVDKGLILIAANYEQLKPY
RIMN_XANAC      --------LDRAVAALTQGGVIAYPTEAVWGLGCDPRQRAAVMRLLEIKRRPVEKGVIVVASSVDVLRDW
RIMN_SHIBS      ------DAIAAAIDVLNEERVIAYPTEAVFGVGCDPDSETAVMRLLELKQRPVDKGLILIAANYEQLKPY
RIMN_CELJU      -----------AANMMRQGGVIAYPTEAVWGLGCNPFDEDAVADLLALKQRPVEKGVILIAANLQQIEPF
RIMN_SALAR      -------SIAAAVDLLNKENVIAYPTEAVFGVGCDPDSETAVTRLLELKQRPVDKGLILIAASFEQLKPY
RIMN_HALHL      -----------AAAELRQGGVVAYPTEAVWGLGCDPRNADAVARLLALKGRPERQGLILIAAESRQLARY
RIMN_ENT38      -------SIAQAVDVLKNEEVIAYPTEAVFGVGCDPDSETAVTRLLELKQRPVEKGLILIAANFEQLKPY
RIMN_NITOC      -----------AARIIRGGGVIAYPTEGVFGLGCDPGRKAAIERILQLKGRSISKGFILIAADFVQLQSY
RIMN_HAHCH      --------IQKAVSVLSRGGVLAYPTEAVWGLGCDPSCEDAVNRILQLKRRPWRKGLILVSGQIEHFSQL
RIMN_VIBF1      --------LNQVVDALKQGNVIAYPTEGVFGVGCDPDNEQALLNLLDVKKRPKEKGLILIAASIEQLLPY
RIMN_SALTY      -------SIAAAVDLLNKENVIAYPTEAVFGVGCDPDSETAVTRLLALKQRPVDKGLILIAASFEQLKPY
RIMN_SALPB      -------SIAAAVDLLNKENVIAYPTEAVFGVGCDPDSETAVTRLLALKQRPVDKGLILIAASFEQLKPY
RIMN_SALCH      -------SIAAAVDLLNKENVIAYPTEAVFGVGCDPDSETAVTRLLALKQRPVDKGLILIAASFEQLKPY
Y1301_MYCTU     --------IVSAVGAIKAGQLVVMPTDTVYGIGADAFDSSAVAALLSAKGRGRDMPVGVLVGSWHTIEGL
RIMN_SHESW      ------------------GGVIAYPTEAVYGLGCDPDNDTAIQKLLAVKQRPWQKGLILVASDFQQLLAY
RIMN_SHEPC      ------------------GGVIAYPTEAVYGLGCDPDNDTAIQKLLAVKQRPWQKGLILVASDFQQLLAY
RIMN_SHEB8      ------------------GGVIAYPTEAVYGLGCDPDNDTAIQKLLAVKQRPWQKGLILVASDFQQLLAY
RIMN_SHEB5      ------------------GGVIAYPTEAVYGLGCDPDNDTAIQKLLAVKQRPWQKGLILVASDFQQLLAY
RIMN_SHEPA      ---------ADAAELVEQGGVIAYPTEAVYGLGCDPDNDEAINQLLQIKQRPWQKGLILVAGDYQQLLPY
RIMN_SALPA      -------SIAAVVDLLNKENVIAYPTEAVFGVGCDPDSETAVTRLLALKQRPVDKGLILIAASFEQLKPY
RIMN_SHEB9      ------------------GGVIAYPTEAVYGLGCDPDNDTAILKLLAVKQRPWQKGLILVASDFQQLLAY
RIMN_VIBHB      ------EQVLKALQT---GEVIAYPTEGVFGVGCDPDNPEAIQKLLELKQRPVEKGLILIAASYEQLLPY
RIMN_ENTS8      ------DAISFIVDVLKKEQVIAYPTEAVFGVGCDPDSETAVKRLLELKQRPMEKGLILIAANFDQLKPY
RIMN_SALTI      ---------AAVVDLLNKENVIAYPTEAVFGVGCDPDSETAVTRLLALKQRPVDKGLILIAASFEQLKPY
RIMN_PSEMY      ----------QAARVVCEGGVIAYPTEAVWGLGCDPWNEVAVDRLLALKERPVHKGLILVADDIEQFDFL
RIMN_XYLFA      --------LSEAVTALQQGGVIAYPTEAVWGLGCDPRQETAVHTLLNIKQRASGKGLILVTAELNTLQDW
RIMN_STRMK      --------LDSAVATLRAGGVIAYPTEAVWGLGCDPSHEAAVHMVLRLKQRPIEKGMILVAADLAQLEGW
RIMN_PSEU5      ---------------------IAYPTEAVWGVGCDPWDEDAVLRLLALKERPVEKGL-ILIADTVEQFDF
RIMN_HAEIN      ------------ADALRQNQVVAYPTEAVFGLGCNPQSESAVKKLLDLKQRPVEKGLILVAPSLDFFRPF
RIMN_SHEFN      ------------ATTIQQGGVIAYPTEAVFGLGCDPDNDSAIEKLLVVKQRPWQKGLILVASSFEQLLPY
RIMN_PSEPK      ----------QAAREIRAGAVIAYPTEAVWGLGCDPWNEDAVYRLLALKSRPVDKGL-ILIADNIRQFDF
RIMN_XYLFT      --------LSEAVTALQQGDVIAYPTEAVWGLGCDPRQETAVHTLLNIKQRASGKGLILVTAELNTLQDW
RIMN_XYLF2      --------LSEAVTALQQGDVIAYPTEAVWGLGCDPRQETAVHTLLNIKQRASGKGLILVTAELNTLQDW
RIMN_VIBVY      --------LQQVVKALKQGQVVAYPTEGVFGLGCDPDNEVAIERLLTIKQRPSDKGLILIAADFQQLQPY
RIMN_VIBVU      --------LQQVVKALKQGQVVAYPTEGVFGLGCDPDNEVAIERLLTIKQRPSDKGLILIAADFQQLQPY
RIMN_VIBPA      ---------------LQQGEVIAYPTEGVFGVGCDPDNPDAIQKLLDLKQRPVEKGLILIAASYEQLLPY
RIMN_SHEDO      ------------------GGVIAYPTEAVYGLGCDPDNDQAIEKLLAVKQRPWQKGLILVASSFEQLLPY
RIMN_PSEE4      ----------QAAREVKAGAVIAYPTEAVWGLGCDPWNEDAVYRLLALKSRPVDKGL-ILIADNIRQFDF
RIMN_XYLFM      --------LSEAVTALQQGGVIAYPTEAVWGLGCDPRQETAVHTLLNIKQRASGKGLILVTAELNTLQDW
RIMN_PSEPG      ----------QAAREIRAGAVIAYPTEAVWGLGCDPWNEDAVYRLLALKSRPVDKGL-ILIADNIRQFDF
RIMN_PSE14      ----------QAAQDIRAGAVIAYPTEAVWGLGCDPWDEEAVYRLLAIKSRPVEKGL-ILIADNIRQFDF
RIMN_HAEIG      ------------ADALRQNQVVAYPTEAVFGLGCNPQSESAVKKLLDLKQRPVEKGLILVAPSLDFFRPF
RIMN_HAEIE      ------------ANALRQNQVVAYPTEAVFGLGCNPQSESAVKKLLDLKQRPVEKGLILVAPSLDFFRPF
RIMN_AERHH      -----------AVAALQRDGVIAYATEAVFGLGCDPDSESAVHRLLAIKQRPVEKGXXXXXXXXXXXXXY
RIMN_CHRVO      ----------RARKQLRDGGVIAYSTESCYGLGCRPLDARAIRRVLAIKARPNHKGLIVIAADFEQIRHL
RIMN_SACD2      --------LTQCVRTLLQGGVIAYPTEAVWGLGCDPDNDHAVEKILRLKKRPVHKGLILVAASIEQLDFL
RIMN_PSEP1      ----------QAAREIRAGAVIAYPTEAVWGLGCDPWNEDAVYRLLALKSRPVDKGL-ILIADNIRQFDF
RIMN_PSEAE      -----------AARVVREGGVIAYPTEAVWGLGCDPWNEDAVYRLLALKARPVEKGLIVVAANIHQLDFL
RIMN_PSEAB      -----------AARVVREGGVIAYPTEAVWGLGCDPWNEDAVYRLLALKARPVEKGLIVVAANIHQLDFL
RIMN_HAEI8      ------------AEALRQNQVVAYPTEAVFGLGCNPQSESAVKKLLDLKQRPVEKGLILVAPSLDFFRPF
RIMN_PSEA7      -----------AARVVREGGVIAYPTEAVWGLGCDPWNEDAVYRLLALKARPVEKGLIVVAAHIHQLDFL
RIMN_PSEF5      ----------QAAREIRAGAVIAYPTEAVWGLGCDPWNEEAVDRLLAIKSRSVDKGL-ILIADNIHQFDF
RIMN_SHEWM      -----EQAPAEVKQVIESGGVVAYPTEAVYGLGCDPDNDAAITKLLAIKKRPWEKGLILVASDYQQLLPY
RIMN_SHEON      -------------DVVLNGGVIAYPTEAVYGLGCDPDNDTAIQKLLAVKQRPWQKGLILVASEFSQLLAY
RIMN_PSEU2      ----------QAAQDIRAGAVIAYPTEAVWGLGCDPWDEEAVYRLLAIKSRPVEKGL-ILIADNIRQFDF
RIMN_PSESM      ----------QAAQNIRAGAVIAYPTEAVWGLGCDPWDEEAVYRLLAIKLRPVEKGL-ILIADNIRQFDF
RIMN_SHEAM      ---------------IESGGVVAYPTEAVYGLGCDPDNDTAIQKLLAVKQRPWEKGLILIASSFDQLKPY
RIMN_METCA      --------LRLAANALRNGRIVAYPTEAVYGLGCDPFNEDAVRKLLALKRRSQIKGLILIAADVEAVESL
RIMN_SHEHH      ---------ADVAELVEQGGVIAYPTEAVYGLGCDPDNDDAIERLLEIKLRPWQKGLILVAGDYQQLLPY
RIMN_PSEPW      ----------QAAREIRAGAVIAYPTEAVWGLGCDPWNEDAVYRLLALKSRPVDKGL-ILVADNIRQFDF
RIMN_SHESR      ------------------GGVIAYPTEAVYGLGCDPDNDTAIQKLLAVKQRPWQKGLILVASEFSQLVDY
RIMN_SHESM      ------------------GGVIAYPTEAVYGLGCDPDNDTAIQKLLAVKQRPWQKGLILVASEFSQLVDY
RIMN_SHESH      -----EQAPDEVQEIIEQGGVVAYPTEAVYGLGCDPDNDEAITRLLALKKRPWQKGLILVASDYQQLLPY
RIMN_SHESA      ------------------GGVIAYPTEAVYGLGCDPDNDTAIQKLLAVKQRPWQKGLILVASEFSQLVDY
RIMN_PSEPF      ----------QAAREIRAGAVIAYPTEAVWGLGCDPWNEEAVDRLLAIKNRSVDKGL-ILVADNIRQFDF
RIMN_ALCBS      --------LLSAAQIIQEGGVVAYPTESVYGLGCDPFNRNAVMQLLAIKHRPVSKGL-ILIG--ESLAQL
RIMN_VIBCH      ------ENLQQAVDALRKGCVIAYPTEGVFGLGCDPDNQTAMLRLLAIKQRPVEKGVILIAASYAQLRPY
RIMN_VIBC3      ------ENLQQAVDALRKGCVIAYPTEGVFGLGCDPDNQTAMLRLLAIKQRPVEKGVILIAASYAQLRPY
RIMN_SERP5      -------------DALHNQQVIAYPTEAVFGLGCDPDSEQAVNALLALKQRPWEKGLILIAADYAQLTPY
Y1136_MYCLE     --------IASAVAALKGGRLVVMPTDTVYGIGXXXXXXXXXXXXXXXKGRGRDMPVGVLVGSWHTIEGL
RIMN_YERE8      -------ALSDVLQALQQEEVIAYPTEAVFGLGCDPDSEKAVNALLALKQRPWQKGLILIAANYEQLKPY
RIMN_PHOPR      --------LQQVVSALQSGEVIAYPTEGVFGVGCDPDNPQAVEKLLALKQRPIEKGLILIAANYQQLQPY
RIMN_PHOLL      -------AFESVLTALKAEKVIAYPTEAVFGLGCDPDSEKAVNELLILKKRPWQKGLILIADNYEQLQPY
RIMN_SHELP      -----QQDPAALVETVLQGGVIAYPTEAVYGLGCDPDNDEAIQKLLDLKQRPWQKGLILVASDFNQLTPY
RIMN_IDILO      ----------EAAHSAIKTGIIAYPTEAVFGLGCDPRNEVAVQKLLSLKQRPAEKGLILIAADYSQLLPY
RIMN_COXBU      ----YTQSINDAVKCLRQGGVIAYPTEAVYGLGCDPFNHDAVAQLLTIKKRSIKKGFILIASEWKQVEPL
RIMN_METFK      ---------------LRSGGVIAYPTESCFGLGCDPTNHRALKRLLRIKGRPQRKGLIVIAQHFSQLQKL
RIMN_CHRSD      -----------------------YPTEAVWGLGCXXXXXXXXXXXXXXKQRDPAKGLILIAGDMDQ-LEL
RIMN_COXBR      ----YTQSINDAVKCLRQGGVIAYPTEAVYGLGCDPFNHDAVAQLLTIKKRSIKKGFILIASEWKQVEPL
RIMN_ACTSZ      ------------AEKLKQNQVVAYPTEAVFGLGCNPLSESAVKKLLDLKQRPIDKGXXXXXXXXXXXXXF
RIMN_YERPY      --------LADIVRALRQEEVIAYPTEAVFGLGCDPDSEKAVNTLLALKQRPWQKGLILVAANYAQLEPY
RIMN_YERPS      --------LADIVRALRQEEVIAYPTEAVFGLGCDPDSEKAVNTLLALKQRPWQKGLILVAANYAQLEPY
RIMN_YERPP      --------LADIVRALRQEEVIAYPTEAVFGLGCDPDSEKAVNTLLALKQRPWQKGLILVAANYAQLEPY
RIMN_YERPN      --------LADIVRALRQEEVIAYPTEAVFGLGCDPDSEKAVNTLLALKQRPWQKGLILVAANYAQLEPY
RIMN_YERPG      --------LADIVRALRQEEVIAYPTEAVFGLGCDPDSEKAVNTLLALKQRPWQKGLILVAANYAQLEPY
RIMN_YERPE      --------LADIVRALRQEEVIAYPTEAVFGLGCDPDSEKAVNTLLALKQRPWQKGLILVAANYAQLEPY
RIMN_YERPB      --------LADIVRALRQEEVIAYPTEAVFGLGCDPDSEKAVNTLLALKQRPWQKGLILVAANYAQLEPY
RIMN_YERPA      --------LADIVRALRQEEVIAYPTEAVFGLGCDPDSEKAVNTLLALKQRPWQKGLILVAANYAQLEPY
RIMN_YERP3      --------LADIVRALRQEEVIAYPTEAVFGLGCDPDSEKAVNTLLALKQRPWQKGLILVAANYAQLEPY
RIMN_COXBN      ----YTQSINDAVKCLRQGGVIAYPTEAVYGLGCDPFNHDAVAQLLTIKKRSIKKGFILIASEWKQVEPL
RIMN_ACTPJ      --------LENIVEQLKRNRVVAYPTEAVFGLGCNPNNESAVRALLKLKKRPEEKGLILIAPTKELLLPY
RIMN_ACTP7      --------LENIVEQLKRNRVVAYPTEAVFGLGCNPNNESAVRALLKLKKRPEEKGLILIAPTKELLLPY
RIMN_ALHEH      --------IRQCAARLQAGGVVAYPTEAVYGLGCDPGDPAAVATLLTLKRRDPGKGLILIASRVSQLSPW
RIMN_ACTP2      --------LENIVEQLKRNRVVAYPTEAVFGLGCNPNNESAVRALLKLKKRPEEKGLILIAPTKELLLPY
RIMN_HAES1      --------ITQIIEKLKQNEVVAYPTEAVFGLGCNPFSQSAVEKLLILKQRPREKGLILVAPKLDYFFSF
RIMN_PSEHT      -----QSTIAAAITCLAQGEVILYPTEAVYGLGCDPDNQQAVERLLAIKQRPVEKGLILIADNYGQLLKY
RIMN_MANSM      --------LAQIVERLKKNEVVAYPTEAVFGLGCNPNSKSAVEKLLILKQRPVEKGLILVAHKLDLLLPF
RIMN_HAES2      --------ITQIIEKLKQNEVVAYPTEAVFGLGCNPFSQSAVEKLLILKQRPREKGLILVAPKLDYFFSF
RIMN_MARMS      -------SVEELADIIRQGGVIAYPTEAVWGLGCDPFNESAVRRILTLKSRPESKGL-ILVAGAQEELS-
RIMN_COLP3      -------------EAFKNGGIIAYPTEAVFGLGCDPDNKEALKRLLKLKQRSPEKGLILLAGSYSQLLPY
RIMN_BLOFL      MSKVYTNFTVKGTEQLNKGKVIVYPTESVFGLGCNPDNENAINTLLKIKCRSWKKGLILVAANYTQLFKY
Y062_METJA      -----EEERKKVLEFLKNGKIVICGTDTLYGISANALNEKAVRKVYNIKRREFNKPLSICVRDKNEIEKY
RIMN_PSYIN      -----QSELNDALKILKSQGVIAYPTESVFGLGCDPDCEAAIQKILLLKQRPAYKGLILIAASIEQLEKY
RIMN_ACIAD      -------SVAEAAHCLKQGQVLAYPTEAVWGLGCDPFNELAFRQILALKQRPIEKQIEYLLADLDETIRA
RIMN_SODGM      --------VASLVIALRQQQVIAYPTEAVFGLGCNPDSESAVQALLALKQRPWQKGLILVAAHYAQLKEY
RIMN_PSYCK      ------DSTIQAATWLKNGQLLAYPTESVWGIGCDPFNKQAVMRLLDIKQRPIEKGM-IVVTDSPSRITA
RIMN_PSEA6      ------------------GKVFAYPTEAVFGLGCDPDNEQAVNKLLALKQRDVSKGLILVGDNYSQLLPY
YCIO_SHIFL      -----QRLINQAVEIVRKGGVIVYPTDSGYALGCKIEDKNAMERICRIRQLPDGHNFTLMCRDLS---EL
YCIO_ECOLI      -----QRLINQAVEIVRKGGVIVYPTDSGYALGCKIEDKNAMERICRIRQLPDGHNFTLMCRDLS---EL
YCIO_ECOL6      -----QRLINQAVEIVRKGGVIVYPTDSGYALGCKIEDKNAMERICRIRQLPDGHNFTLMCRDLS---EL
SUA5_SCHPO      -----RSALENAANILRNTDYVAFPTETVYGLGADARRTEAVLSIYKAKNRPADNPLIVHVASLDQLRRL
RIMN_PSYA2      ------DSVIQAAHWLKKGQLLAYPTESVWGIGCDPFNQQAVMQLLTIKQRPIEKGM-IVVTDSPSRITV
Y1198_HAEIN     ----------QAVEILQKGGVIVYPTDSGYALGCMMGDKHAMDRIVAIRKLPEGHNFTLVCSDLS---EL
RIMN_PASMU      --------IQQIVEQLKQNEVVAYPTEAVFGLGCNPNSESAVQKLLVLKQRSVEKGLILVAPCLDYFLPF
RIMN_HAEDU      --------LLAVIELLKQNQVVAYPTESVFGLGCNPNNEEAIRQLLQLKNRPIEKGLILVAPTKELLLPY
RIMN_ACIBY      -------SVTEAAECLQQGQVLAYPTEAVWGLGCDPFNEQAFQKILELKQRPIEKGVILLAGHISQVEHL
RIMN_ACIBT      -------SVTEAAECLQQGQVLAYPTEAVWGLGCDPFNEQAFQKILELKQRPIEKGVILLAGHISQVEHL
RIMN_ACIBS      -------SVTEAAECLQQGQVLAYPTEAVWGLGCDPFNEQAFQKILELKQRPIEKGVILLAGHISQVEHL
RIMN_ACIBC      -------SVTEAAECLQQGQVLAYPTEAVWGLGCDPFNEQAFQKILELKQRPIEKGVILLAGHISQVEHL
RIMN_BUCAP      ----FLSSLIKCIRKLYDKKIIAYPTEAMFGLGCDPTSEKAVKRLLDLKKRSIKKGLILVASNYNQIKMY
RIMN_BAUCH      --------------------VVAYPTEAMFGLGCDPDSEKAVHTLLTLKKRDWQKGLILVAANYEQLANY
RIMN_NEIG1      -------AQRKLSVYLKKGGLVAYPTESCYGLGCLPTXXXXXXXXXXXXXRPQHKGM-IVIGNXXXXXXX
RIMN_NEIMF      -------AQRKLSVYLKKGGLVAYPTESCYGLGCLPTXXXXXXXXXXXXXRPQHKGMIVIGNQFEQLQPL
RIMN_NEIMB      -------AQRKLSVYLKKGGLVAYPTESCYGLGCLPTXXXXXXXXXXXXXRPQHKGMIVIGNQFEQLQPL
RIMN_NEIMA      -------AQRKLSVYLKKGGLVAYPTESCYGLGCLPTXXXXXXXXXXXXXRPQHKGMIVIGNQFEQLQPL
RIMN_NEIM0      -------AQRKLSVYLKKGGLVAYPTESCYGLGCLPTXXXXXXXXXXXXXRPQHKGMIVIGNQFEQLQPL
RIMN_THIDA      ---------------LRRGGVIAYPTESCYGLGCDPRNXXXXXXXXXXKGRDAGKGM-LLIADRYRRLQP
RIMN_BLOPB      ---------------LSQGKVIIYPTESVFGLGCDPDNKNAISTLLKIKNRSWKKGLILVAANYTQLLKY
RIMN_WIGBR      --------LMKIINALREEEVVAYPTESMFGLGCDPDSISAVNKLIYLKKRKINKGFIIVAANISQLNNY
YRDC_BOVIN      ------------------------PTDTLYGLACSASCSEALGAVYRVKGRSETKPLAVCLGRVADVYRY
SUA5_YEAST      -----EAALVEAARIIRDTDTVAFPTETVYGLGGSALNDNSVLSIYRAKNRPSDNPLITHVSSIDQLNRK
RIMN_THICR      -----------AAKLITEGGVLAYPTEAVYGLGCDPLNKDAFQQLLRLKQRPLEKGVILIIAQIEPFVKL
YRDC_RAT        ------------------------PTDTLYGXXXXXXXXXXXXXVYRLKGRSEAKPLAVCLGRVADVYRY
YRDC_MOUSE      ------------------------PTDTLYGXXXXXXXXXXXXXVYRLKGRSEAKPLAVCLGRVADVYRY
YRDC_HUMAN      ------------------------PTDTLYGXXXXXXXXXXXRAVYRLKGRSEAKPLAVCLGRVADVYRY
RIMN_BUCAI      ---------------LHNDDVIAYPTESMFGLGCDPXXXXXXXXXXXXXXRSIEKGLILVASDFDQIKMY
RIMN_BUCBP      -------SLSECVDRLRKNLVIAYPTESVLGLGCNPESIDAVXXXXXXXXXXXXXGFILVASHFNQIRSY
HYPF_RHILV      ---------------LEGGAIVALKGVGGFHLLCDARNDGAIG-LLRLRKAGDQKPFAVMVRDIEAARQL
MRAW_BACLD      --RVFEEALLQAIEVLKPGGRVSVIT------FHSLEDR-ICKSTFKDMSSPPELPLPVIPKEFEPKLKL


                         .         .         *         .         .         .         .:140
query           VDLGPLEGKFLRLAEAFWPGGLTVVVPGKAIPPWISKDGSVGLRMPDHALLRELLRRVGGHAAATSLNKS
YWLC_BACSU      T--GPAPEKAKTLMKRFWPGALTLILPCKALSPRVTAGETVAIRMPDHPLALALIRESGLPIAAPSANLS
RIMN_XANCP      IDIAALGSEQLTAVLAQWPGPHTWILPVTAAPRWVTGDDGLAVRISAHPVVAALCKAWGAPLVSTSANLA
RIMN_XANCB      IDIAALGSEQLTAVLAQWPGPHTWILPVTAAPRWVTGDDGLAVRISAHPVVAALCKAWGAPLVSTSANLA
RIMN_XANC8      IDIAALGSEQLTAVLAQWPGPHTWILPVTAAPRWVTGDDGLAVRISAHPVVAALCKAWGAPLVSTSANLA
RIMN_AERS4      IDLSQLSGEQLARVEASWPGPFTWIMPARATPTWLTQFDTLAVRVTAHPQVQALCRAFGKPLVSTSANLT
RIMN_XANC5      VDIDALEPARRQDVLASWPGPHTWILPVTAAPRWVTEHDGLAVRISAHPVVAALCAAWGAPLVSTSANLA
RIMN_SHISS      IDDTMLTDAQRETIFSRWPGPVTFVFPAPATTPWLTRFDSLAVRVTDHPLVVALCQAYGKPLVSTSANLS
RIMN_SHIF8      IDDTMLTDVQRETIFSCWPGPVTFVFPAPATTPWLTRFDSLAVRVTDHPLVVALCQAYGKPLVSTSANLS
RIMN_SHIB3      IDDTMLTDAQRETIFSRWPGPVTFVFPAPATTPWLTRFDSLAVRVTDHPLVVALCQAYGKPLVSTSANLS
RIMN_ECOUT      IDDTMLTDAQRETIFSRWPGPVTFVFPAPATTPWLTRFDSLAVRVTDHPLVVALCQAYGKPLVSTSANLS
RIMN_ECOSM      IDDTMLTDAQRETIFSRWPGPVTFVFPAPATTPWLTRFDSLAVRVTDHPLVVALCQAYGKPLVSTSANLS
RIMN_ECOLI      IDDTMLTDVQRETIFSRWPGPVTFVFPAPATTPWLTRFDSLAVRVTDHPLVVALCQAYGKPLVSTSANLS
RIMN_ECOLC      IDDTMLTDVQRETIFSRWPGPVTFVFPAPATTPWLTRFDSLAVRVTDHPLVVALCQAYGKPLVSTSANLS
RIMN_ECOL6      IDDTMLTDAQRETIFSRWPGPVTFVFPAPATTPWLTRFDSLAVRVTDHPLVVALCQAYGKPLVSTSANLS
RIMN_ECOL5      IDDTMLTDAQRETIFSRWPGPVTFVFPAPATTPWLTRFDSLAVRVTDHPLVVALCQAYGKPLVSTSANLS
RIMN_ECOK1      IDDTMLTDAQRETIFSRWPGPVTFVFPAPATTPWLTRFDSLAVRVTDHPLVVALCQAYGKPLVSTSANLS
RIMN_ECOHS      IDDTMLTDVQRETIFSRWPGPVTFVFPAPATTPWLTRFDSLAVRVTDHPLVVALCQAYGKPLVSTSANLS
RIMN_ECODH      IDDTMLTDVQRETIFSRWPGPVTFVFPAPATTPWLTRFDSLAVRVTDHPLVVALCQAYGKPLVSTSANLS
RIMN_ECO24      IDDTMLTDAQRETIFSRWPGPVTFVFPAPATTPWLTRFDSLAVRVTDHPLVVALCQAYGKPLVSTSANLS
RIMN_ECO57      IDDTMLTDVQRETIFSRWPGPVTFVFPAPATTPWLTRFDSLAVRVTDHPLVVALCQAYGKPLVSTSANLS
RIMN_CITK8      IDDSMLTDTQREAIFACWPGPVTFVFPAPATTPWLTRFDSLAVRVTDHPLVVSLCQAYGKPLVSTSANLT
RIMN_SHIDS      IDDTMLTDAQRETIFSRWPGPVTFVFPAPATTPWLTRFDSLAVRVTDHPLVVALCQAYGKPLVSTSANLS
RIMN_XANOR      VDIDALAPARRQDVLASWPGPHTWILPVTAAPRWVTEHDGLAVRISAHPVVAALCAAWGAPLVSTSANLA
RIMN_XANOP      VDIDALAPARRQDVLASWPGPHTWILPVTAAPRWVTEHDGLAVRISAHPVVAALCAAWGAPLVSTSANLA
RIMN_XANOM      VDIDALAPARRQDVLASWPGPHTWILPVTAAPRWVTEHDGLAVRISAHPVVAALCAAWGAPLVSTSANLA
RIMN_MARAV      LD--PLPDAVQSEALRHWPGPVTCLLPNQQVPEWVGKHSSIAVRVSDHPVVRALCEATGMPLVSTSCNPA
RIMN_KLEP7      IDDSRLSDSQREAIFSCWPGPVTFVFPARETPRWLTRFDSLAVRVTNHPLVIELCEAYGKPLVSTSANLT
RIMN_SHIFL      IDDTMLTDVQRETIFSCWPGPVTFVFPAPATTPWLTRFDSLAVRVTDHPLVVALCQAYGKPLVSTSANLS
RIMN_XANAC      VDIDALEPARRRDVLTSWPGPHTWILPTDRAPRWVTEHDGLAVRISAHPVVAALCGAWGAPLVSTSANLA
RIMN_SHIBS      IDDTMLTDAQRETIFSRWPGPVTFVFPAPATTPWLTRFDSLAVRVTDHPLVVALCQAYGKPLVSTSANLS
RIMN_CELJU      IDLDDLQRQRLKNT---WPGPVTWLVPNNGLAPWITAFPSVALRVTDHPVAAGLCRAFGGPVVSTSCNPA
RIMN_SALAR      IDDSILTTAQRKAVFDCWPGPVTFVFPASATTPWLTRFDSLAVRVTDHPLVVALCNAYGKPLVSTSANLS
RIMN_HALHL      --LAPLPAEWAETIQASWPGPMTWVLPASTAPRWVSGGDTLAVRVTAHPVAAALCSAFGGALVSTSANPS
RIMN_ENT38      IDDSMLTEQQRNTIFSAWPGPVTFVFPAPSTPSWLTRFDSLAVRVTDHPLVVELCETFGKPLVSTSANLT
RIMN_NITOC      --LLPLTASTRSRLEVTWPGPVTWLLPARGVPPWLGRYDTLAVRVTAHPLAACLCRTLGHALVSTSANRA
RIMN_HAHCH      LDRLPQQQKDQILAT--WPGPVTWVVPGVYAPLVRGAHDAIAIRVTAHPLVVELTKAFGGPIVSTSANPA
RIMN_VIBF1      IDLEQLTEEQVNTIKASWPGPVTWIVPVKTLPLVTGQFDSIAVRVTAHPQVKAICNAFGKPITSTSANLS
RIMN_SALTY      IDDSILTAAQRKAVFDCWPGPVTFVFPAPATTPWLTRFDSLAVRVTNHPLVVALCNAYGKPLVSTSANLS
RIMN_SALPB      IDDSILTAAQRKAVFDCWPGPVTFVFPAPATTPWLTRFDSLAVRVTNHPLVVALCNAYGKPLVSTSANLS
RIMN_SALCH      IDDSILTAAQRKAVFDCWPGPVTFVFPAPATTPWLTRFDSLAVRVTNHPLVVALCNAYGKPLVSTSANLS
Y1301_MYCTU     VYSMPDGAR--ELIRAFWPGALSLVVVQAPSLQWDLGDGTVMLRMPLHPVAIELLREV-GPMAVSSANIS
RIMN_SHESW      VDESQLTAEQLEFAFSKWPGPFTFVMPIKAVSKYLCGEDSIAVRVSAHAGVQALCRALNKPLVSTSANLA
RIMN_SHEPC      VDESQLTAEQLEFAFSKWPGPFTFVMPIKAVSKYLCGEDSIAVRVSAHAGVQALCRALNKPLVSTSANLA
RIMN_SHEB8      VDESQLTAEQLEFAFSKWPGPFTFVMPIKAVSKYLCGEDSIAVRVSAHAGVQALCRALNKPLVSTSANLA
RIMN_SHEB5      VDESQLTAEQLEFAFSKWPGPFTFVMPIKAVSKYLCGEDSIAVRVSAHAGVQALCRALNKPLVSTSANLA
RIMN_SHEPA      IDESQLNAQQLAFAQSKWPGPFTFIMP---VKPGLSKFDSIAVRVTAHAGVKALCAAIHKPIVSTSANLS
RIMN_SALPA      IDDSILTAAQRKAVFDCWPGPVTFVFPAPATTPWLTRFDSLAVRVTNHPLVVALCNAYGKPLVSTSANLS
RIMN_SHEB9      VDESQLTAEQLEFAFSKWPGPFTFVMPIKAVSKYLCGEDSIAVRVSAHAGVQALCRALNKPLVSTSANLA
RIMN_VIBHB      IDESQLTQEQLDQVHATWPGPYTWIMPASKVSHWVSQFDSIAVRVTDHPLVQKMCNAFGKPLTSTSANLT
RIMN_ENTS8      IDDAALTAEQREAVFARWPGPVTFVFPAKSTPRWLTRFDSLAVRVTNHPQVIALCEAFGKPLVSTSANLS
RIMN_SALTI      IDDSILTAAQRKAVFDCWPGPVTFVFPAPATTPWLTRFDSLAVRVTNHPLVVALCNAYGKPLVSTSANLS
RIMN_PSEMY      LD--DLPAIWQERLAASWPGPNTWLVPHQRLPAWITVHDSVALRVSDHPLVRALC-RLTGPLISTSANPA
RIMN_XYLFA      LDLDTLSPERLHEVQTSWPGPHTWVLPASTAPHWITHHNGLAVRISAHPLVSALCRAWNMALISTSANVA
RIMN_STRMK      VRLQALPDARQRAVLASWPGANTWILPGPRAQPWVTGEHSIAVRISAHPLVAELCRAWGGPLVSTSANLA
RIMN_PSEU5      L-LDDLPERWLDRLSGTWPGPNTWLVPHRGLPEWITRHDSVALRVTDHPLVKRLC-ALTGPLVSTSANPA
RIMN_HAEIN      VDFEQINDEQLSRLQGKYERPTTWIVPAKSTTPHFGKFDSIAIRLCDHPSVKALCELTGFALTSTSANLT
RIMN_SHEFN      LDITQLTEQQLQFAQSKWPGPFTFVMP---IQSHVSKFDSIAVRVSAHPVVRELCDTLNKPLVSTSANLA
RIMN_PSEPK      LFEDFPEDWIDRMSST-WPGPNTWLVPHQLLPEWVTQHDTVALRVSDHPVVRELCALV-GPLISTSCNPG
RIMN_XYLFT      LDLDTLSPERLHEVQASWPGPHTWVLPASTAPHWITHHNGLAVRISAHPLVSALCRAWNMALISTSANVA
RIMN_XYLF2      LDLDTLSPERLHEVQASWPGPHTWVLPASTAPHWITHHNGLAVRISAHPLVSALCRAWNMALISTSANVA
RIMN_VIBVY      LDLTSLSAEQLQRVFATWPGPYTWVMPASARASALGYRQTVAVRVSDHPLVQKLCSEYGKPLTSTSANLS
RIMN_VIBVU      LDLTSLSAEQLQRVFATWPGPYTWVMPASARASALGYRQTVAVRVSDHPLVQKLCSEYGKPLTSTSANLS
RIMN_VIBPA      IDESQLTPEQLATVHATWPGPYTWIMPASKVSNWVSQFDSIAVRVTDHPLVQKMCNAFGKPLTSTSANLS
RIMN_SHEDO      VDVAQLTQAQLDFAHSKWPGPFTFVMPVKSSNKLRGEFDSIAVRVSAHPIVRELCDSLNKPLVSTSANLA
RIMN_PSEE4      L-FEDFPQDWIDRMSATWPGPNTWLVPHQLLPEWVTQHDTVALRVSDHPQVRELCALV-GPLISTSCNPA
RIMN_XYLFM      LDLDTLSPERLHEVQASWPGPHTWVLPASTAPHWITHHNGLAVRISAHPLVSALCRAWNMALISTSANVA
RIMN_PSEPG      LFEDFPEDWIERMGST-WPGPNTWLVPHQLLPEWVTKHDTVALRVTDHPQVRELCALV-GPLISTSCNPG
RIMN_PSE14      L-FEDFPQLWLDRMASTWPGPNTWLVPHQLLPEWITGHETVALRVTDHPTVRELCALV-GPLISTSANPA
RIMN_HAEIG      VDFEQINDEQLSRLQGKYERPTTWIVPAKSTTPHFGKFDSIAVRLCDHPSVKALCEITGFALTSTSANLT
RIMN_HAEIE      VDFEQINDEQLSRLQGKYERPTTWIVPSKSTTPYFGKFDSIAVRLCDHPSVKALCELTGFALTSTSANLT
RIMN_AERHH      IDLDQLTSEQLARVEASWPGPFTWIMPARSTPAWLTQFTTLAVRVTAHPQVQALCRAFGKPLVSTSANLT
RIMN_CHRVO      VK--PLSAAQRAELARYWPGPYTFLLPSRRVPPALGRHHKIAVRVTAHGEAAALCRRLGTALVSTSANRA
RIMN_SACD2      --LHDLEPEYYQKLEASWPGANTWLIPGRVSPMVTGKHATVAVRVSNHPIVKALCEGFGGPIVSTSANPM
RIMN_PSEP1      LFEDFPEDWIDRMGST-WPGPNTWLVPHQLLPEWVTQHDTVALRVSDHPVVRELCALV-GPLISTSCNPG
RIMN_PSEAE      LE--DLPDVWLDRLAGTWPGPNTWLVPQERLPEWVTVHDSVAVRVTDHPLVQELC-HLTGPLISTSANPA
RIMN_PSEAB      LE--DLPDVWLDRLAGTWPGPNTWLVPQERLPEWVTVHDSVAVRVTDHPLVQELC-HLTGPLISTSANPA
RIMN_HAEI8      VDFEQINDEQLSHLQGKYERPTTWIVPAKSTTSHFGKFDSIAIRLCDHPSVKALCELTGFALTSTSANLT
RIMN_PSEA7      LE--DLPDVWLERLAGTWPGPNTWLVPHQRLPEWVTVHDSVAVRVTDHPLVQELC-YLTGPLISTSANPA
RIMN_PSEF5      L-FEDFPDTWIDRMSSTWPGPNTWLVPHQLLPEWVTVHDTVALRVSDHPLVRELCSLV-GPLISTSANPQ
RIMN_SHEWM      IDDSQLTEEQRERVFSKWPGPFTFIMP---IKPGISSFNSLAVRVSDHPTIQAICQQLGKPLVSTSANHS
RIMN_SHEON      VDESQLTDEQLELAFSKWPGPFTFVMP---IKPHVSRFDSIAVRVSAHEGVRALCQALGKPLVSTSANLA
RIMN_PSEU2      LFEDFPELWLDRMAST-WPGPNTWLVPHQLLPEWITGHETVALRVTDHPTVRELCALV-GPLISTSANPA
RIMN_PSESM      LFEDFPELWLDRMAST-WPGPNTWLVPHQLLPEWITGHETVALRVTDHPTVRELCALV-GPLISTSANPA
RIMN_SHEAM      IDLSRVTEAQLQAAFDKWPGPFTFVIPAKAVSPMLGCFDTIAVRVSAHQDVRAMCYACQKPLVSTSANLA
RIMN_METCA      VDLAPLGAE----VRAGWPGPTTWLIPPRGIPDWLGAHDSLAVRVTAHPVAAALCRVFGGAIVSTSANLS
RIMN_SHEHH      IDESQLSAEQLAFVHSKWPGPFTFIMP---VKPGLSSFDSIAVRVTAHEGVKALCAAINKPIVSTSANLT
RIMN_PSEPW      LFEDFPEDWIDRMGST-WPGPNTWLVPHQLLPEWVTQHDTVALRVSDHPQVRELCALV-GPLISTSCNPG
RIMN_SHESR      VDESQLSAEQLEFAFSKWPGPFTFVMP---IKPHVSRFDSIAVRVSAHEGVRALCQALGKPLVSTSANLA
RIMN_SHESM      VDESQLSAEQLEFAFSKWPGPFTFVMP---IKPHVSRFDSIAVRVSAHEGVRALCQALGKPLVSTSANLA
RIMN_SHESH      IDESRLTNEQLNKVFVKWPGPFTFIMP---IKPGLSSFNSLAVRVSSHPTIQAICQRLGKPLVSTSANHA
RIMN_SHESA      VDESQLSAEQLEFAFSKWPGPFTFVMP---IKPHVSRFDSIAVRVSAHDGVRALCQALGKPLVSTSANLA
RIMN_PSEPF      LFEDFPQDWIDRMAST-WPGPNTWLVPHQLLPEWVTVHDTVALRVSDHPQVRDLCSLV-GPLISTSANPQ
RIMN_ALCBS      APYLHLNEQQSAQLEKKWPAPITYLVDASRLPAWVGEHRKVAVRVPDHPLARQLCQLAGQPIISTSANIS
RIMN_VIBCH      VDETQLTAEQLTQVLASWPAPLTWVMPASGTPSWVGQFDTVAVRVSDHPVVQKLCLAFGKPLTSTSANLS
RIMN_VIBC3      VDETQLTAEQLTQVLASWPAPLTWVMPASGTPSWVGQFDTVAVRVSDHPVVQKLCLAFGKPLTSTSANLS
RIMN_SERP5      IDDTALNEQQRATMFASWPGPVTWVIPARSETSRLGRFNSLAVRVSDHPLVQQLCRQFGKPLVSTSANLS
Y1136_MYCLE     VYTMPDGAR--ELIRAFWPGALSLVVVHAPSLNWDLGDGTVMLRMPLHSVAIELLCEV-GPMAVSSANVS
RIMN_YERE8      VDDSALTDSQRETIFSVWPGPVTWVIPHPETPRWLTGSDSLAVRVSDHPLVQQLCSQYGKPLVSTSANLS
RIMN_PHOPR      IDDAQLSDLQKQKIFSTWPGPVTWVMPKKDISPLLTKFTSIAVRVSDHPLVQKLCHQFGKPITSTSANLT
RIMN_PHOLL      LDDKLLTEEQKKAMFACWPGPVTWVIPAKSAPKWLTQFATLAVRVSDHPLVKQLCTFYGKPLVSTSANLN
RIMN_SHELP      IDSSVLTEAQLQSAFDKWPGPFTFIMPKR---PGLSQFDSLAVRVSNHPGVQALCQALGKPIVSTSANLT
RIMN_IDILO      VEDSAIAQDKRFSVLSHWPGPVTLILPVRKGVSTLLTGGTIAVRVTAHEPARALCRELGHALVSTSANLT
RIMN_COXBU      TE--PIDPKALARVFDTWPGPFTWTFPAKEAPHWITQHSTIAIRVTAHPLAKLLCQRFAGPLISSSANQE
RIMN_METFK      I--APVTPEQKQRMFTRWPGPHTWLVPASRRCPALGRHTSLAVRVTANPLAANLCRHAGMALVSTSANHN
RIMN_CHRSD      AGLDALQRA--RLAES-WPGPNTWLVPGRARPLLRGEHTSLAVRVSDHPLVRQLCAAFGGPLVSSSANRA
RIMN_COXBR      TE--PIDPKALARVFDTWPGPFTWTFPAKEAPHWITQHSTIAIRVTAHPLAKLLCQRFAGPLISSSANQE
RIMN_ACTSZ      IDTERLNSRQISRLTANYSHPVTWVVPVKGTPKFLTRFNSIAVRISDHPAVAELCSLTGFALTSTSANLS
RIMN_YERPY      INDSMLNEIQRETLFSTWPGPITWVIPARVTPQWLTGCDSLAVRVSNHPLVQQLCAEYGKPLVSTSANLS
RIMN_YERPS      INDSMLNEIQRETLFSTWPGPITWVIPARVTPQWLTGCDSLAVRVSNHPLVQQLCAEYGKPLVSTSANLS
RIMN_YERPP      INDSMLNEIQRETLFSTWPGPITWVIPARVTPQWLTGCDSLAVRVSNHPLVQQLCAEYGKPLVSTSANLS
RIMN_YERPN      INDSMLNEIQRETLFSTWPGPITWVIPARVTPQWLTGCDSLAVRVSNHPLVQQLCAEYGKPLVSTSANLS
RIMN_YERPG      INDSMLNEIQRETLFSTWPGPITWVIPARVTPQWLTGCDSLAVRVSNHPLVQQLCAEYGKPLVSTSANLS
RIMN_YERPE      INDSMLNEIQRETLFSTWPGPITWVIPARVTPQWLTGCDSLAVRVSNHPLVQQLCAEYGKPLVSTSANLS
RIMN_YERPB      INDSMLNEIQRETLFSTWPGPITWVIPARVTPQWLTGCDSLAVRVSNHPLVQQLCAEYGKPLVSTSANLS
RIMN_YERPA      INDSMLNEIQRETLFSTWPGPITWVIPARVTPQWLTGCDSLAVRVSNHPLVQQLCAEYGKPLVSTSANLS
RIMN_YERP3      INDSMLNEIQRETLFSTWPGPITWVIPARVTPQWLTGCDSLAVRVSNHPLVQQLCAEYGKPLVSTSANLS
RIMN_COXBN      TE--PIDPKALARVFDTWPGPFTWTFPSKEAPHWITQHSTIAIRVTAHPLAKLLCQRFAGPLISSSANQE
RIMN_ACTPJ      IDENKLTAAHWQIFETPSERAITWVMPAKAVPQYLTQFDTIAVRLCCIPAVIDLCERTGFALTSTSCNLT
RIMN_ACTP7      IDENKLTAAHWQIFETPSERAITWVMPAKAVPQYLTQFDTIAVRLCCIPAVIDLCERTGFALTSTSCNLT
RIMN_ALHEH      LGDAPLPQAVL----ASWPGPNTWLLPAAPTPAWITGGAKVAVRVTAHPVAAALCEAFGGAIVSTSANRD
RIMN_ACTP2      IDENKLTAAHWQIFETPSERAITWVMPAKAVPQYLTQFDTIAVRLCCIPAVIDLCERTGFALTSTSCNLT
RIMN_HAES1      IDKEQINSQHWQKLQQTYPRPITWIVPAKKIAKFLCGNNSIAIRVSQHPAIKILCEQTGFALTSTSANLS
RIMN_PSEHT      VDDAKIPMDKRADIFSSWPNAITWVMPAKNTPKWLTQYDTIAVRVTNHPTVKRLCQEFGKPLVSTSANLS
RIMN_MANSM      IDESRLKQSHWQLLTQQYDCPTTWVVPAKSVPKFITQFDSVAVRLCTHPAVAQLCEQTGFALTSTSANLS
RIMN_HAES2      IDKEQINSQHWQKLQQTYPRPITWIVPAKKIAKFLCGNNSIAIRVSQHPAIKILCEQTGFALTSTSANLS
RIMN_MARMS      PWLNLLDDKAAQRLISLNETPTSWVVPDTTIPSWVGEHQSVAIRLSQHQPVQRLCAAFQGVIVSTSANPA
RIMN_COLP3      IDDSKIQDKRLTLLSR-WPDGITQLVPNNNISSLLSGSDTIAVRITSQPDVVALCQQTNKPIVSTSANLS
RIMN_BLOFL      VDDRYLNSLQLSRIFSTWPGPFTWVFPARSTPMWLTKFSSVAIRVSNFEPIRRLCLTFGKPLVSTSANVS
Y062_METJA      AYVNDLAKKII---DKFLPGPLTIILKKKGIPDIVAKD-YIGIRIPDEPIIREL----------------
RIMN_PSYIN      ADFSLLTAAQLTVIKKTWPGPITWIVPSKNLSKLISGDESVAVRVTAHPIVRQI----------------
RIMN_ACIAD      QVIESWTTRSVDERAITW----LLPVSSDQVPTWITQHHQVAVRVTNHPLCVALCHAFNGFIVSTSANPA
RIMN_SODGM      IXXXXXXXXXRSRIFASWPGPVTWVIPCPTTPSWLTQHASLAVRVSAFEPVRRLCLAFGKPLVSTSANLT
RIMN_PSYCK      LLEGLTAVERQTVLDSWQADSINATIPKNTIPSWITAHDSVAVRVIDHPLVKQLCAQMYGFVVSTSCNPS
RIMN_PSEA6      VDDSAI--KMTKRTEIFWPGPITWLLPSKTAPSWVTGESEIAVRVSAHPLIKDLCQRANKPLVSTSANTA
YCIO_SHIFL      STYSFVDNVAFRLMKNNTPGNYTFILKGKEVPRRLEKRKTIGMRVPSNPIAQALLEALGEPMLSTSLMLP
YCIO_ECOLI      STYSFVDNVAFRLMKNNTPGNYTFILKGKEVPRRLEKRKTIGMRVPSNPIAQALLEALGEPMLSTSLMLP
YCIO_ECOL6      STYSFVDNVAFRLMKNNTPGNYTFILKGKEVPRRLEKRKTIGMRVPSNPIAQALLEALGEPMLSTSLMLP
SUA5_SCHPO      LLSAYPKAKYLPLIKKFWPGPLSILLPDEANPP-VSPIVTAGVRMPQHPVALALISISDSPLAAPSANAS
RIMN_PSYA2      L----LEGLDAVERQTVLDSWQTDSINGTAIPSWITAHDSVAVRVIDHPLVKQLCAQMYGFVVSTSCNPA
Y1198_HAEIN     STYARVNNTAYRLIKNNTPGRYTFILTAKELPRRLSKRKTIGLRVPDNKIALDLLSALGEPILSCSLTQS
RIMN_PASMU      IDTTAFSQADWDRLQAKYDRPTTWVVPAKTTTPLTGQFDSIAVRLCDHPAVKQLCEQAGFXXXXXXXXXX
RIMN_HAEDU      IDESQLTEKHWQRFDTITEQAVTWIMPHKNVSHYLTKFNTIAVRLCRVPAVVKLCESLGFALTSTSANFT
RIMN_ACIBY      LTSLPTQQEIIDCWTNHQPSATTWLLPAQHIPSWIKGEHPVAVRVTTHPLCVALCNAFHGFIVSTSANPS
RIMN_ACIBT      LTSLPTQQEIIDCWTNHQPSATTWLLPAQHIPSWIKGEHPVAVRVTTHPLCVALCNAFHGFIVSTSANPS
RIMN_ACIBS      LTSLPTQQEIIDCWTNHQPSATTWLLPAQHIPSWIKGEHPVAVRVTTHPLCVALCNAFHGFIVSTSANPS
RIMN_ACIBC      LTSLPTQQEIIDCWTNHQPSATTWLLPAQHIPSWIKGEHPVAVRVTTHPLCVALCNAFHGFIVSTSANPS
RIMN_BUCAP      INESKLSAQQKKTMFFHWPGPYTFLVPANSVPCWLTQFDTIAVRISAHFSIIKLCNVFGKALVSTSANIS
RIMN_BAUCH      IDDNSLNINQRARMFSLWPGPITWTIPARTTTPWLTKFSTLAVRISAFKPVRMLCLAFGKPIVSTSANVS
RIMN_NEIG1      XXXMPSENIQTMLRNE-WPAPKTFLLLAKSLPALRGKRRSLAVRVPDHTGARRLCQALGMPLVSTSCNRA
RIMN_NEIMF      LQM-PSENLQDMLRKE-WPAPKTFLLSAKSLPELRGKQRSLAVRVPAHVGARRLCQALQTPLVSTSCNRA
RIMN_NEIMB      LQM-PSENLQDMLRKE-WPAPKTFLLSAKSLPELRGKQRSLAVRVPAHVGARRLCQALQTPLVSTSCNRA
RIMN_NEIMA      LQM-PSENLQDMLRKE-WPAPKTFLLSAKSLPELRGKQRSLAVRVPAHVGARRLCQALQTPLVSTSCNRA
RIMN_NEIM0      LQM-PSENLQDMLRKE-WPAPKTFLLSAKSLPELRGKQRSLAVRVPAHVGARRLCQALQTPLVSTSCNRA
RIMN_THIDA      F-VGALSPTGRARMRRSWPGPVTWVVPSRRCPPELTGXXXXXXXXXXXXXXXXLCRSLGTALVSTSANKS
RIMN_BLOPB      IDDSCLNETQRSRVFSTWPGPMTWVFPAQANRSWLTQFSSVAVRVSHFEPIQRLCLAFGKPLVSTSANLS
RIMN_WIGBR      IDCTSLSKNNLNKIFCTWPGFITLMPPKKDIPCWIGNNSLIAVRVSNFFPIKKICNIFGKPIISTSANLS
YRDC_BOVIN      CHVRVPEG----LLKDLLPGPVTLVMENKDLNPFTP---LVGIRIPDHAFMQDLAQMFGG----------
SUA5_YEAST      VFNQPLSGTSLPLISSLWPGPLTILLPHSALSKLTTADPTFAVRIPANPVARALIALSDTPIAAPSANAS
RIMN_THICR      HNQAWTEKVLASWQVLNQP--VTWVLPADNVPEWITGGNTVAVRVTQHPDVMALCNQLNFPIVSTSANLS
YRDC_RAT        CQVRPRE-----LLEDLFPGPVTLVMENKDLNPFTP---LVGIRIPDHAFMLDLAQMFGG----------
YRDC_MOUSE      CQVRPRE-----LLEDLFPGPVTLVMENKDLNPFTR---LVGIRIPDHAFMLDLAQMFGG----------
YRDC_HUMAN      CRVRVPEG----LLKDLLPGPVTLVMENKDLNPFTP---LVGIRIPDHAFMQDLAQMFEG----------
RIMN_BUCAI      VNENILSNKQKKKIFFHWPGPFTFLLPAKPTPYWLTKFNTVAVRVSAHFEIIKLCNAFGQAVVSTSANIS
RIMN_BUCBP      ISESKLSIYHKKILYSSWPDTITYLLPAKSVPDWLTRSNFLGIRISAHNGINKLCSAFGKAIISTSANIS
HYPF_RHILV      A--RPNEAEEALLISPARPIVLVAARAGELIAPGLTRVGLMLAYAPVHHLLLDELSRSSPHCVATSANPG
MRAW_BACLD      VNRKPI----------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GEPPVRTEAEARTFAVDFVFPGEAGGLASSVVDLRTGEVLREGAIPKEALLAxxx
YWLC_BACSU      GKPPTKAEHVAHDLIAGIVDGGPTGGVESTVLSCADDVLLRPGGITKEQIEA---
RIMN_XANCP      GEPPARSRAPALLARIDGVLDGEVGGLATPIRDARTGQILRD-------------
RIMN_XANCB      GEPPARSRAPALLARIDGVLDGEVGGLATPIRDARTGQILRD-------------
RIMN_XANC8      GEPPARSRAPALLARIDGVLDGEVGGLATPIRDARTGQILRD-------------
RIMN_AERS4      GEEPARRVGELLASKLAYILPGEVGGQASEIKDARTGAVIR--------------
RIMN_XANC5      GEPPARSRAPALLATIDGVVDGETGALATQIRDARSGQILRD-------------
RIMN_SHISS      GLPPCRTVDEVRAFGAAFVVPGETGGRPSEIRDALTGELFRQG------------
RIMN_SHIF8      GLPPCRTVDEVRAFGAAFVVPGETGGRPSEIRDALTGELFRQG------------
RIMN_SHIB3      GLPPCRTVDEVRAFGAAFVVPGETGGRPSEIRDALTGELFRQG------------
RIMN_ECOUT      GLPPCRTVDEVRAFGAAFVVPGETGGRPSEIRDALTGELFRQG------------
RIMN_ECOSM      GLPPCRTVDEVRAFGAAFVVPGETGGRPSEIRDALTGELFRQG------------
RIMN_ECOLI      GLPPCRTVDEVRAFGAAFVVPGETGGRPSEIRDALTGELFRQG------------
RIMN_ECOLC      GLPPCRTVDEVRAFGAAFVVPGETGGRPSEIRDALTGELFRQG------------
RIMN_ECOL6      GLPPCRTVDEVRAFGAAFVVPGETGGRPSEIRDALTGELFRQG------------
RIMN_ECOL5      GLPPCRTVDEVRAFGAAFVVPGETGGRPSEIRDALTGELFRQG------------
RIMN_ECOK1      GLPPCRTVDEVRAFGAAFVVPGETGGRPSEIRDALTGELFRQG------------
RIMN_ECOHS      GLPPCRTVDEVRAFGAAFVVPGETGGRPSEIRDALTGELFRQG------------
RIMN_ECODH      GLPPCRTVDEVRAFGAAFVVPGETGGRPSEIRDALTGELFRQG------------
RIMN_ECO24      GLPPCRTVDEVRAFGAAFVVPGETGGRPSEIRDALTGELFRQG------------
RIMN_ECO57      GLPPCRTVDEVRAFGAAFVVPGETGGRPSEIRDALTGELFRQG------------
RIMN_CITK8      GLPPCRTVEEVRAFGADFVVEGETGGRPSEIRDALTGELFRQG------------
RIMN_SHIDS      GLPPCRTVDEVRAFGAAFVVPGETGGRPSEIRDALTGELFRQG------------
RIMN_XANOR      GEPPARSRAPALLATIDGVVDGEVGALATRIRDARSGQILRD-------------
RIMN_XANOP      GEPPARSRAPALLATIDGVVDGEVGALATRIRDARSGQILRD-------------
RIMN_XANOM      GEPPARSRAPALLATIDGVVDGEVGALATRIRDARSGQILRD-------------
RIMN_MARAV      GRQPARAIWQVRRYRIDRIVPGALGGKPSRIIDIVTGQQFR--------------
RIMN_KLEP7      GQPPCRTTAEVHAFGDSFVVDGATGGRPSEIRDALTGELFRQG------------
RIMN_SHIFL      GLPPCRTVDEVRAFGAAFVVPGETRGRPSEIRDALTGELFRQG------------
RIMN_XANAC      GEPPARSRAPALLATIDGVVDGETGALATQIRDARSGQILRD-------------
RIMN_SHIBS      GLPPCRTVDEVRAFGAAFVVLGETGGRPSEIRDALTGELFRQG------------
RIMN_CELJU      GKPPARNIHEVRRYQLDAVSSGLAGRRTSEIRDLLTGQVVR--------------
RIMN_SALAR      GLPPCRTVEEVRAFGDDFMVEGATGGRPSEIRDALTGELFRQG------------
RIMN_HALHL      ARRPARSVAEVRRYRIDALVPGRLGGLPTPIRDGRSGAYLR--------------
RIMN_ENT38      GLPPCRTSQEVAQFGDGFVVVGETGGRPSEIRDALTGERFRQG------------
RIMN_NITOC      GRPPAQTTLQVRRSSLDYILPGITGKRASEIRDGRTGQRLR--------------
RIMN_HAHCH      TREPARTLFDCRRYGVDHYLPGKLSGLSSQIRDAATGAILRQ-------------
RIMN_VIBF1      GLEPCRSVTEVEAQLGDVIFQGEVGNRTTEIRDAKTGNTLRQG------------
RIMN_SALTY      GLPPCRTVEEVRAFGDDFVVEGATGGRPSEIRDALTGELFRQG------------
RIMN_SALPB      GLPPCRTVEEVRAFGDDFVVEGATGGRPSEIRDALTGELFRQG------------
RIMN_SALCH      GLPPCRTVEEVRAFGDDFVVEGATGGRPSEIRDALTGELFRQG------------
Y1301_MYCTU     GHPPPVDAEQARSQLGDHVAPSEQQA-GSTIVDLATPRVLRPGPVSTERI-----
RIMN_SHESW      GEDPALTAAEILTGKIDALVLGELGRQPSTIIDARSGKILRNG------------
RIMN_SHEPC      GEDPALTAAEILTGKIDALVLGELGRQPSTIIDARSGKILRNG------------
RIMN_SHEB8      GEDPALTAAEILTGKIDALVLGELGRQPSTIIDARSGKILRNG------------
RIMN_SHEB5      GEDPALTAAEILTGKIDALVLGELGRQPSTIIDARSGKILRNG------------
RIMN_SHEPA      GEPALSPLAVKQQFIISGLVVGELGSQASTIIDARSGTVIREG------------
RIMN_SALPA      GLPPCRTVEEVRAFGDDFVVEGATGGKPSEIRDALTGELFRQG------------
RIMN_SHEB9      GEDPALTAAEILTGKIDALVLGELGRQPSTIIDARSGKILRNG------------
RIMN_VIBHB      GQPPCMTTEEVEEQLGDAILRGETSGKPSEIRDAKTSQILRQG------------
RIMN_ENTS8      GLEPCRTAQEVAQFGDDFVLHGATGGRPSEIRDALTGELFRQG------------
RIMN_SALTI      GLPPCRTVEEVRAFGDDFVVEGATGGRPSEIRDALTGELFRQG------------
RIMN_PSEMY      GRPAARSRLRVEQYQLDKVLGGALGGRPSLIRDLRTGDVIR--------------
RIMN_XYLFA      GQPPARRREDLDPSLLPHIVDGPTGGLATSIRDARSGHILR--------------
RIMN_STRMK      GXXXXXXXXXXXXXXXXXILDGETGGLATPIRDALSGNVLR--------------
RIMN_PSEU5      GRPAARSRLRVEQYQLDAVFNGALGGRPSVIRDLRSGEVIR--------------
RIMN_HAEIN      GEPPCRTADEVRQFGSDFPVLNEMVGRASEIRDLRTNQLFRQG------------
RIMN_SHEFN      GEQPV---VDAQHIITDFLILGKLGRQPSTIIDARSGQILRNGS-----------
RIMN_PSEPK      GRPAAKTRLRVEQYQLDLVLGGALGGRPSVIRDLATGEVVRPG------------
RIMN_XYLFT      GQPPARRREDLDPSLLPHIVDGPTGGLATSIRDARSGHILR--------------
RIMN_XYLF2      GQPPARRREDLDPSLLPHIVDGPTGGLATSIRDARSGHILR--------------
RIMN_VIBVY      GQTECKTVEQVQDSQISVILFGEIGHRPSEIRDARTEQLLRQG------------
RIMN_VIBVU      GQTECKTVEQVQDSQISVILFGEIGHRPSEIRDARTEQLLRQG------------
RIMN_VIBPA      GLPPCMTTEEVEQQLGDAILRGETSGKPSEIRDAKTSQILRQG------------
RIMN_SHEDO      GQDPVLTSRQILTFAIDALVLGDLGQQASTIIDARSGLVLRNG------------
RIMN_PSEE4      GRPAAKSRLRVEQYELDMVLGGALGGRPSLIRDLATGEVVRPG------------
RIMN_XYLFM      GQSPARRREDLDPSLLPHIVDGPTGGLATSIRDARSGHILR--------------
RIMN_PSEPG      GRPAAKTRLRVEQYQLDLVLGGALGGRPSVIRNLATGEVVRPG------------
RIMN_PSE14      GRPAARSRLRVEQYQIDGVLGGSLGGRPSVIRDIATGQVMRAG------------
RIMN_HAEIG      GEPPCRIADEVRSFGADFPVLDEMVGRASEIRDLRTNQLFRQG------------
RIMN_HAEIE      GEPPCRIADEVRQFGADFPVLDETVGDASEIRDLRTNQLFRQG------------
RIMN_AERHH      GEEPARRVAELLASQLAYILPGEVGGQASEIKDARTGAIIR--------------
RIMN_CHRVO      GQQSLKTARACRMAFKDKVLPGRIGRKPSTIIDLESGRVLR--------------
RIMN_SACD2      GLSAAKSQMQVRRY-----FAKEALSYATGVVGGRTPSVIRD-------------
RIMN_PSEP1      GRPAAKTRLRVEQYQLDLVLGGALGGRPSVIRNLATGEVVRPG------------
RIMN_PSEAE      GRPAARTRLRVEQYELDAILGGALGGRPSLIRDLVTGQVIR--------------
RIMN_PSEAB      GRPAARTRLRVEQYELDAILGGALGGRPSLIRDLVTGQVIR--------------
RIMN_HAEI8      GEPPCRTADEVRQFGADFPVLDEIVGDASEIRDLRTNQLFRQG------------
RIMN_PSEA7      GRPAARTRLRVEQYELDGVLGGALGGRPSLIRDLVTGQVIR--------------
RIMN_PSEF5      GRPAARTRLRIEQYQLDLVLSGSLGGRPSLIRDLATGKVVR--------------
RIMN_SHEWM      GEEPAMSHEEILAGEIDALVAGSLGRKPSTIIDAISGKILR--------------
RIMN_SHEON      GEDPALSGDEILNVKIDALVLGQLGRQPSTIIDARSGKILRNG------------
RIMN_PSEU2      GRPAARSRLRVEQYQIDGVLGGSLGGRPSVIRDIATAQIVRAG------------
RIMN_PSESM      GRPAARSRLRVEQYQINGVLGGSLGGRPSVIRDIATGQVMRAG------------
RIMN_SHEAM      GEQPALTLAEVQTQLGDKIDAVVLGALGSTIIDIQTGHIFRQG------------
RIMN_METCA      GHRPARTPVRLRQFAIHFL-PGRLGGAVTAIFDAMSGRRIR--------------
RIMN_SHEHH      GQDPALSGA-----AVKQQFEGIIAGLVSTIIDAKSGQVIRKG------------
RIMN_PSEPW      GRPAAKSRLRVEQYDLDMVLGGALGGRPSVIRNLATGEIVRPG------------
RIMN_SHESR      GEDPALSGDEAFEGKIDALVLGSLGRQPSTIIDARSGKILRNG------------
RIMN_SHESM      GEDPALSGDEAFEGKIDALVLGSLGRQPSTIIDARSGKILRNG------------
RIMN_SHESH      GEPPAMSCEEIIAGEIDALISGSLGAKPSTIVDAISGKVLR--------------
RIMN_SHESA      GEDPALSGDEAFEGKIDALVLGALGRQPSTIIDARSGKILRNG------------
RIMN_PSEPF      GRPAARTRLRVEQYQVDLVLGGALGGRPSLIRDLATGNIVR--------------
RIMN_ALCBS      GRPAARNRYQARQLGLDFIVSGACDRAASTIIDLESGRILR--------------
RIMN_VIBCH      GQPACVTQQEVMVNQIAVVVEGKTSGRPSEIRDARSLQVLRQG------------
RIMN_VIBC3      GQPACVTQQEVMVNQIAVVVEGKTSGRPSEIRDARSLQVLRQG------------
RIMN_SERP5      GQEPCRSADEVQQFGAAFLLAGSVGGRPSEIRDVLTGEQIRQG------------
Y1136_MYCLE     GQPAAVDVDGARGQLGELVAGPSAQQAASTIVDLATPRILRAGPV----------
RIMN_YERE8      GQEPCRTIEEVR---IQFVLAGLVGGRPSEIRDALTGKQFRQG------------
RIMN_PHOPR      GLPPCKTVTEVQNQLLSAILEGETGGRPTEIRDAFSDTVLRQG------------
RIMN_PHOLL      GLEPCRTAEEVRQQFGDKILNGDVGGRPSEIRDALTGELYRQG------------
RIMN_SHELP      GEEPALTPEEVRQFKIDGLVAGSLGAKPSTIIDVISGKILR--------------
RIMN_IDILO      GQEPARTAAEVRQDSVDWIMDESTGGAATRIINPLNNQVFRDDA-----------
RIMN_COXBU      GEPPIRDVKILRLVKIDKILEGPLGPTPTPIRDAITGEILR--------------
RIMN_METFK      GRVPAKTARECRLFGGRVVLPGRTGGASSTIQDLITGAIVR--------------
RIMN_CHRSD      GEPPAMSAADVRAAFGEAVLDGALGGYASTIRDLQSGETLR--------------
RIMN_COXBR      GEPPIRDVKILRLVKIDKTLEGPLGPTPTPIRDAITGEILR--------------
RIMN_ACTSZ      GLPPCKTAAEVRSQFGQFFYPVGHAEKPSEIRNLLTDQLIREG------------
RIMN_YERPY      GHEPCRTEEEVR---IQFVLSGHVGGRPSEIRDALTGKRFRQG------------
RIMN_YERPS      GHEPCRTEEEVR---IQFVLSGHVGGRPSEIRDALTGKRFRQG------------
RIMN_YERPP      GHEPCRTEEEVR---IQFVLSGHVGGRPSEIRDALTGKRFRQG------------
RIMN_YERPN      GHEPCRTEEEVR---IQFVLSGHVGGRPSEIRDALTGKRFRQG------------
RIMN_YERPG      GHEPCRTEEEVR---IQFVLSGHVGGRPSEIRDALTGKRFRQG------------
RIMN_YERPE      GHEPCRTEEEVR---IQFVLSGHVGGRPSEIRDALTGKRFRQG------------
RIMN_YERPB      GHEPCRTEEEVR---IQFVLSGHVGGRPSEIRDALTGKRFRQG------------
RIMN_YERPA      GHEPCRTEEEVR---IQFVLSGHVGGRPSEIRDALTGKRFRQG------------
RIMN_YERP3      GHEPCRTEEEVR---IQFVLSGHVGGRPSEIRDALTGKRFRQG------------
RIMN_COXBN      GGPPIRDVKILRLVKIDKILEGPLGPTPTPIRDAITGEILR--------------
RIMN_ACTPJ      GQEPCRTADEVKQFGADFVLEAETAGKTSEIRDIFTQHIFRQG------------
RIMN_ACTP7      GQEPCRTADEVKQFGADFVLEAETAGKTSEIRDIFTQHIFRQG------------
RIMN_ALHEH      GQPPARSATQVRT---------RLGAEAAELADILPGPVDR--------------
RIMN_ACTP2      GQEPCRTADEVKQFGADFVLEAETAGKTNEIRDIFTQHIFRQG------------
RIMN_HAES1      GIAPCKTSDEVRQFGADFVLDMSVGSAASEIRDLFTNQLVRQG------------
RIMN_PSEHT      GQNTVLSIAEAKTEQIGYYVDEPLGGQPSTIKDAMNGKVFR--------------
RIMN_MANSM      GLPPCKTAQQVRSFGEFFPVLDMAVGNASEIRDIFSRQIFRRG------------
RIMN_HAES2      GIAPCKTSDEVRQFGADFPVLDMSVGSASEIRDLFTNQLVRQG------------
RIMN_MARMS      GLEPAMSAKEVHQYNIDAIFDAPLGDASSQVRDILTDNLFR--------------
RIMN_COLP3      GQEPAKTWQSVLSKQVDFILKGVTLGRTSKIIDALTGKIIR--------------
RIMN_BLOFL      GYLPARTHAVYKQLGYDFIMNTNVLGLPSIIRDAITGKIIRK-------------
Y062_METJA      -------------------------------------------------------
RIMN_PSYIN      -------------------------------------------------------
RIMN_ACIAD      GLEPARSLQEASAFGQGLNYLNGDLGLSSRIIDATTGRVIRD-------------
RIMN_SODGM      GQPPARSADEVRQLGAAFLVLDEAGRLPTEIRDALSGELIRQG------------
RIMN_PSYCK      GKPPALSLIEAQSFLGDNVNSDECVGLPSQIGDALTGQVIR--------------
RIMN_PSEA6      GHPPALSADEVTSYFSNILIDGSLGGSRS--------------------------
YCIO_SHIFL      GSEFTESDPEEIKDRLEIIHGGYLGQKPTTVIDLTTPVVVREG------------
YCIO_ECOLI      GSEFTESDPEEIKDRLEIIHGGYLGQKPTTVIDLTTPVVVREG------------
YCIO_ECOL6      GSEFTESDPEEIKDRLEIIHGGYLGQKPTTVIDLTTPVVVREG------------
SUA5_SCHPO      TRP----------------------------------------------------
RIMN_PSYA2      GQPPALSLSEAQRYFLRHYLKGETLGLPSQIGDALTGQIIR--------------
Y1198_HAEIN     DPEEIRDRLEHQVDLI--IHGGYLGQEPTTVVDLESPVILREGS-----------
RIMN_PASMU      XXPPCRTAEEVKTFGADFLPVGEATN-PSEIRDLFTHQLFRQG------------
RIMN_HAEDU      GLPPCRTALEVKQQFGDHVLEAETGNRPSEIRDIFTQHIFRQG------------
RIMN_ACIBY      GQEPAHSLQDACQYFGSQLLNGDLGQQPSRIINALTGEVIR--------------
RIMN_ACIBT      GQEPAHSLQDACQYFGSQLLNGDLGQQPSRIINALTGEVIR--------------
RIMN_ACIBS      GQEPAHSLQDACQYFGSQLLNGDLGQQPSRIINALTGEVIR--------------
RIMN_ACIBC      GQEPAHSLQDACQYFGSQLLNGDLGQQPSRIINALTGEVIR--------------
RIMN_BUCAP      NMSPCLTREDVKDFGKDFVLYGHIGNESSKIINIVNGKLIR--------------
RIMN_BAUCH      GQSPARNICEVRAFPVDQIIEGRYS--PSEIRDAISGQLIRRG------------
RIMN_NEIG1      GKRACRTEREVRQFGRDWIVGGRIGKSPSQIIDGETGKRLR--------------
RIMN_NEIMF      GKRACRTEREVRQFGRDWIVGGRIGKSPSQIIDGETGKRLR--------------
RIMN_NEIMB      GKRACRTEREVRQFGRDWIVGGRIGKSPSQIIDGETGKRLR--------------
RIMN_NEIMA      GKRACRTEREVRQFGRDWIVGGRIGKSPSQIIDGETGKRLR--------------
RIMN_NEIM0      GKRACRTEREVRQFGRDWIVGGRIGKSPSQIIDGETGKRLR--------------
RIMN_THIDA      GHTPAKTAAQCRRMARVRVVDGRIGRRPSTLIDLATGKILR--------------
RIMN_BLOPB      GQLPARTIEEVHDYKIPIMHEDILGPNPSKIRDVMTGKLIRE-------------
RIMN_WIGBR      GEIPAKNIKEIK-------------------------------------------
YRDC_BOVIN      -------------------------------------------------------
SUA5_YEAST      TRP----------------------------------------------------
RIMN_THICR      GEDPVTTEACCKAFPALAIMQGNLMGISSQIWEAQTQKRLR--------------
YRDC_RAT        -------------------------------------------------------
YRDC_MOUSE      -------------------------------------------------------
YRDC_HUMAN      -------------------------------------------------------
RIMN_BUCAI      NMTPCFTSEEVKCFGKDFLLNGKIGNNPSKIINIINGKLIR--------------
RIMN_BUCBP      GRNPCRTYEE---FLKQFTVPILCGPLGSKILNIINGSLIRHG------------
HYPF_RHILV      GEPLVADNDDA--------------------------------------------
MRAW_BACLD      -------------------------------------------------------