[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tthe0:AAS80819.1

[Show Plain Result]


## Summary of Sequence Search
    1::211
   48::217     7e-16  31%  217 aa  BDBD_BACAN RecName: Full=Probable disulfide bond formation protein
  445::614     2e-15  40%  616 aa  NHAA2_NOCSJ RecName: Full=Na(+)/H(+) antiporter nhaA 2;AltName:
   47::216     2e-14  29%  216 aa  BDBD_BACCR RecName: Full=Probable disulfide bond formation protein
   87::231     9e-13  28%  259 aa  DSB_RICBR RecName: Full=Putative protein-disulfide oxidoreductase
  100::263     3e-12  26%  270 aa  DSB_RICTY RecName: Full=Putative protein-disulfide oxidoreductase
   52::219     3e-12  28%  222 aa  BDBD_BACSU RecName: Full=Disulfide bond formation protein
  102::265     3e-12  26%  278 aa  DSB_RICFE RecName: Full=Putative protein-disulfide oxidoreductase
   99::262     2e-11  25%  272 aa  DSB_RICPR RecName: Full=Putative protein-disulfide oxidoreductase
  466::625     1e-10  35%  652 aa  NHAA3_SALTO RecName: Full=Na(+)/H(+) antiporter nhaA 3;AltName:
  101::264     4e-10  25%  277 aa  DSB_RICCN RecName: Full=Putative protein-disulfide oxidoreductase
  442::604     4e-09  36%  622 aa  NHAA1_RHOSR RecName: Full=Na(+)/H(+) antiporter nhaA 1;AltName:
  466::623     1e-08  32%  652 aa  NHAA1_SALAI RecName: Full=Na(+)/H(+) antiporter nhaA 1;AltName:
  467::626     1e-08  36%  629 aa  NHAA2_STRCO RecName: Full=Na(+)/H(+) antiporter nhaA 2;AltName:
  457::596     2e-08  31%  621 aa  NHAA_HERAR RecName: Full=Na(+)/H(+) antiporter nhaA;AltName:
  454::598     5e-08  37%  613 aa  NHAA1_MYCSS RecName: Full=Na(+)/H(+) antiporter nhaA 1;AltName:
  454::598     5e-08  37%  613 aa  NHAA1_MYCSK RecName: Full=Na(+)/H(+) antiporter nhaA 1;AltName:
  454::598     5e-08  37%  613 aa  NHAA1_MYCSJ RecName: Full=Na(+)/H(+) antiporter nhaA 1;AltName:
  439::601     2e-07  32%  617 aa  NHAA1_MYCVP RecName: Full=Na(+)/H(+) antiporter nhaA 1;AltName:
   22::176     3e-07  29%  624 aa  NHAA_NITMU RecName: Full=Na(+)/H(+) antiporter nhaA;AltName:
  439::601     3e-07  31%  617 aa  NHAA1_MYCGI RecName: Full=Na(+)/H(+) antiporter nhaA 1;AltName:
   40::181     6e-07  37%  644 aa  NHAA_ANADE RecName: Full=Na(+)/H(+) antiporter nhaA;AltName:
   16::206     7e-05  32%  272 aa  Y964_LISMO RecName: Full=UPF0413 protein lmo0964;
   16::206     2e-04  32%  272 aa  Y984_LISMF RecName: Full=UPF0413 protein LMOf2365_0984;
  224::276     8e-04  42%  348 aa  TRPD_SYNP6 RecName: Full=Anthranilate phosphoribosyltransferase;   
   92::146     8e-04  35%  248 aa  DSBG_ECOLI RecName: Full=Thiol:disulfide interchange protein
   92::146     8e-04  35%  248 aa  DSBG_ECO57 RecName: Full=Thiol:disulfide interchange protein
    1::211

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxPKGKAGLDPAEGARFALGREDAPVVVVDFSNYLCPHCQNHALNVLPR
BDBD_BACAN      --------------------------------------SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPR
NHAA2_NOCSJ     -----------------------------LDPPVDARHVRGREDAPLTLVEYGDFECPFCAR-ATGVTTE
BDBD_BACCR      --------------------------------------SLGKDDAPVKVVEFGDFKCPACRTWDVTVLPR
DSB_RICBR       ---------------------------------------LGNKDSKIVVVEYFSPTCPHCAYYHSTIFPE
DSB_RICTY       ---------------------------------------LGNKKSNVIVVEYFSPTCPHCAYYHQTIFPA
BDBD_BACSU      ---------------------------------------LGKDDAPVTVVEFGDYKCPSCKVFNSDIFPK
DSB_RICFE       ---------------------------------------LGNKKSNVIVVEYFSPTCPHCAYYHQTIFPE
DSB_RICPR       ---------------------------------------LGNKKSNVIVVEYFSPTCPHCAYYHQTIFPE
NHAA3_SALTO     ----------------------------------------GPREAPVTVVEYADFECPYCGQAE----PA
DSB_RICCN       ---------------------------------------LGNKKSNVIVVEYFSPTCPHCAYYHQTIFPE
NHAA1_RHOSR     -----------------------------LRPVDPGRDHLGPADAPLTLVEYGDFECPFCSK-ATGSIRD
NHAA1_SALAI     ----------------------------------------GPREAPVTVVEYGDFECPYCGQAE----PA
NHAA2_STRCO     ----------------------------------------GPESAVVTVVEYGDFECPYC-GQAEPVVRD
NHAA_HERAR      ----------------------------------------GPEDAQLTLVEYVDFECAYCA-HATGSWDD
NHAA1_MYCSS     ----------------------------------------GDPDAPLVLVEYGDYECPFC-GRATGAIDE
NHAA1_MYCSK     ----------------------------------------GDPDAPLVLVEYGDYECPFC-GRATGAIDE
NHAA1_MYCSJ     ----------------------------------------GDPDAPLVLVEYGDYECPFC-GRATGAIDE
NHAA1_MYCVP     -----------------------PVGLKLLRPVEPDRHVRGRYDAPLVLVEYGDFECPFC-SRATGAIDE
NHAA_NITMU      ---------------------------------------LGPADAEITLVEYGSYADAPSRS-AHERVAE
NHAA1_MYCGI     -----------------------PVGLKLLRPIDPERHVRGRPDAPLTLVEYGDFECPFC-SRVTGAIDE
NHAA_ANADE      ---------------------------------------LGEPGADLTLVEYGSYACPHC-HVAHEVVAE
Y964_LISMO      ---------------------------------------------PIEIYLFFDPACDDCWNIEANML-R
Y984_LISMF      ---------------------------------------------PIEIYLFFDPACDDCWNIEANML-R
TRPD_SYNP6      ----------------------------------------------------------------------
DSBG_ECOLI      -----------------------PAGREMWQRMEQSHWLLGKKDAPVIVYVFADPFCPYCKQFWQQARP-
DSBG_ECO57      -----------------------PAGREMWQRMEQSHWLLGKKDAPVIVYVFADPFCPYCKQFWQQARP-


                         .         .         *         .         .         .         .:140
query           LKAEYIDTGKVRYLFRDFPFPGQANVIRXXXXXXXXXXQGRYYDYHEVLFRAAAGWGNLTGEALDRYLVD
BDBD_BACAN      LKEEYIDKGKVQLYFINFPFIGKSDLGAAAGEAIYKQDQDSFWIFYDEIYQSTEEW--ITEELLLNIVKE
NHAA2_NOCSJ     LRERFGDD--LRYVFRHLPLVDHPHXXXXXXXXXXXDHQGRFWELHDLLFEHQ---GELEVEDLAGYAAD
BDBD_BACCR      LKEEYIDKGKVQLYFINFPFIGKSDLGAAAGEAIYKQDKDSFWIFYDEIYKDTEEW--ITEDLLLSIVKE
DSB_RICBR       LKQKYIDTNKIAYVTREFIATKQASILARCKGDI-----NSFMLFHDIILKQQDKWS--VSNKYRELLTD
DSB_RICTY       LKKKYIDTNKIAYVVREFIATKQD--LDAAILARCKGDINSFIQFHNIILQQQDKWA--YSNKYRELLTD
BDBD_BACSU      IQKDFIDKGDVKFSFVNVMFHGKSRLAALASEEVWKEDPDSFWDFHEKLFETEQEWPGLLGD-LAKSTTK
DSB_RICFE       LKKKYIDTNKIAYVVREFIATKQD--LDAAILARCKGDINSFVQFHNIILQQQDKWA--YSNKYRELLTD
DSB_RICPR       LKKKYIDTNKIAYVIREFIATKQD--LDAAILARCKGDINSFIQFHNIILQQQDKWA--YSNKYRELLTD
NHAA3_SALTO     VRELLVDYTSVRYVWRHLPLTDVHPYAQMXXXXXXXXXQGAFWEMHDLLL---AHQDELRPADLLRY---
DSB_RICCN       LKKKYIDTNKIAYVVREFIATKQD--LDAAILARCKGDTNSFTQLHNIILIQQDKWA--YSNKYRELLTD
NHAA1_RHOSR     VRAHFGD--ELRYVFRHLPLDDHPHXXXXXXXXXXXXXQGRFWEMHDHLF------ANSDALAEDE-IFG
NHAA1_SALAI     VRELLTDFTNIRYVWRHLPLTDHPYXXXXXXXXXXXXXXXXFWEMHDLLLAHQ-------GELRPADLLG
NHAA2_STRCO     LLGQESD---VRYVWRHLPLRDHPXXXXXXXXXXXXXXXDRFWEMHDLLLERQNA---LAAPDLLRY---
NHAA_HERAR      LRAHFGDD--LRYVVRHLPHHPHGPIAARASEAAAN--QGMFWPWLDFVFTRQ--------HALERHLIG
NHAA1_MYCSS     VRTHFGD--DLLYVWRHFPLEAHPRSFDXXXXXXXXXXQGKFFEMGRELF---AHQDDLEWSDMYRYAV-
NHAA1_MYCSK     VRTHFGD--DLLYVWRHFPLEAHPRSFDXXXXXXXXXXQGKFFEMGRELF---AHQDDLEWSDMYRYAV-
NHAA1_MYCSJ     VRTHFGD--DLLYVWRHFPLEAHPRSFDXXXXXXXXXXQGKFFEMGRELF---AHQDDLEWSDMYRYAV-
NHAA1_MYCVP     VRAHFGD--DLLYVWRHFPLEAHPRXXXXXXXXXXXXLQGKFWEMAHELFDHQDDL-----EWSDMYRYA
NHAA_NITMU      LRSRF--GNRMRYVFRHRPLAGSKIARRAAELVESHNNSGRFWDLHVALMSRS---DKLSADDLCTIISD
NHAA1_MYCGI     VRAHFGD--DLLYVWRHFPLEAHPRXXXXXXXXXXXXLQGRFWEMTHELFTHQDDL-----EWSDMYRYA
NHAA_ANADE      LRDRLGD--RLRYVFRQXXXXXXXXXXXXXXXXXXXXXXXXFWHAHDLLMRRGPSFA--AGE-----LDA
Y964_LISMO      LQMEYGNYFKLRYVLHNNLQTFVCKQKRAGNSNLSLKEQGAHLSYISCLVKAAELQGKKQGIASDEVLYD
Y984_LISMF      LQMEYGNYFKLRYVLHNNLQTFVCKQKRAGNSNLSLKEQGAHLSYISCLVKAAELQGKKQGIASEEVLYD
TRPD_SYNP6      -----------------------------------------------------------------RRAIV
DSBG_ECOLI      ----WVDSGKVQ----------------------------------------------------------
DSBG_ECO57      ----WVDSGKVQ----------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LAGQIGLDEGAFAACLASGRHREEVLADQKLATDLGLTGTPTFFIAGEKHTGFLPYEEWKRLLDEALAKA
BDBD_BACAN      KLPKIDVEQ--FKKDLHSKEIKEKVRKDSDRAQKLKVQGAPSVYVNG--NLANPDFDSLKKAIDKELKK-
NHAA2_NOCSJ     L----GLDVEAFLRDLXXXXXXXXXXXXXXXXXXXGARGTPTFFVGGVRHTGPHDAETLARALEES----
BDBD_BACCR      KLPKVDVEQ--FKKDLHSKDIKEKVSKDSDRAQKLKVQGAPSVYVNG--NLANPDFDSMKKAIDKELKK-
DSB_RICBR       IGQLGGVTPEEYKKCLSDDKITETLIANTNFITKAKFIGTPSFFVNG-----------------------
DSB_RICTY       IGQLGGISPEEYKQCLNSDKITETLIANTNLAKAPKFIGTPSFFVNGVQTENY-SIDNISRAVDRAL---
BDBD_BACSU      IKPETNLDKETFAS---------QVEKDSDLNQKMNIQATPTIYVNDKVIKNFADYDEIKETIEKEL---
DSB_RICFE       IGQLGGVPPEEYKQCLNSDKITETLIANTNVANAPKFIGTPSFFVNGVQ-TGNYSIDSISTAVDKAL---
DSB_RICPR       IGQLGGIPPEEYKQCLNSDKITATLIANTNLAKAPKFIGTPSFFVNGVQTENY-SIDNISKAVDKAL---
NHAA3_SALTO     -AERLDLDLDRFREHLADRRGAGRIAQDVDAADLSSVSGTPTFFVNGRRHHGPYNIEALSAAVMSAFASA
DSB_RICCN       IGQLGGISPEEYKQCLNNDKITAILIANTNVAKAPQFIGTPSFFVNGVQ-TGNYSIDTISTAVDKAL---
NHAA1_RHOSR     YAAELGLDMDRFEEDIRRGTYVHRIDDDELDAESSDFRGTPTFYLGAARHSG--PYD-------------
NHAA1_SALAI     YAERLDLDLDRFREHLADRRGAVRIAEDVDGADLSSVSGTPTFFVNGRRHHGSYNIEALSAAVTSAFA--
NHAA2_STRCO     -AGELGLDVERFRQDLRDHLGARRVAEDVDSADLSRVSGTPTFFINGRRHHGAYDIAALTRAVELARQRA
NHAA_HERAR      YAAELGLDVERFIADLDSPAVIERVERDLASAVASGAHATPTFFVEGRRLRG------------------
NHAA1_MYCSS     ---AIGLDIEQFDVRVHASKVLHRVRDDAQDAEVMDLNSTPTFFVNGKRHKG------------------
NHAA1_MYCSK     ---AIGLDIEQFDVRVHASKVLHRVRDDAQDAEVMDLNSTPTFFVNGKRHKG------------------
NHAA1_MYCSJ     ---AIGLDIEQFDVRVHASKVLHRVRDDAQDAEVMDLNSTPTFFVNGKRHKG------------------
NHAA1_MYCVP     VAAGCDIEQFDQDVRVHSSKVLHRVTDDAEDAEAMDLNATPTLFVNGIRHKG------------------
NHAA_NITMU      LKLEGNKEAGQEET---AERARDRVEADIASANASGVIVTPTFFINGRRYDG--PWD--VRSLSEAM---
NHAA1_MYCGI     VAAGCDIEQFDQDVRVHSSKVLHRVSDDAEDADAMDLNATPTLFVNGKRHRG------------------
NHAA_ANADE      IARELGLERGAGPWEGAAARVREDVESARRSGVHL----TPTFFINGRRYEG------------------
Y964_LISMO      IAVSTGLDLSEFKKDLASTVAKRAYIGDQKVAQEMEIHENPTFFDAGLKLSGLHRYEVYVHVLSELLNDA
Y984_LISMF      IAVSTGLDLSEFKKDLASTVAKRAYIGDQKVAQEMEIHENPTFFDAGLKLSGLHRYEVYVHVLSELLNDA
TRPD_SYNP6      LHGREGLDEGGLADCMDLAIVREGQLSQQVVPRDLGLTQAPTVALKG-----------------------
DSBG_ECOLI      ----------------------------------------------------------------------
DSBG_ECO57      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           x
BDBD_BACAN      -
NHAA2_NOCSJ     -
BDBD_BACCR      -
DSB_RICBR       -
DSB_RICTY       -
BDBD_BACSU      -
DSB_RICFE       -
DSB_RICPR       -
NHAA3_SALTO     -
DSB_RICCN       -
NHAA1_RHOSR     -
NHAA1_SALAI     -
NHAA2_STRCO     -
NHAA_HERAR      -
NHAA1_MYCSS     -
NHAA1_MYCSK     -
NHAA1_MYCSJ     -
NHAA1_MYCVP     -
NHAA_NITMU      -
NHAA1_MYCGI     -
NHAA_ANADE      -
Y964_LISMO      -
Y984_LISMF      -
TRPD_SYNP6      -
DSBG_ECOLI      -
DSBG_ECO57      -