[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tthe0:AAS80853.1

[Show Plain Result]


## Summary of Sequence Search
    1::274
  112::269     9e-26  46%  269 aa  CDSA_BACSU RecName: Full=Phosphatidate cytidylyltransferase;       
  125::258     2e-24  55%  271 aa  CDSA_PSEAE RecName: Full=Phosphatidate cytidylyltransferase;       
  100::283     4e-23  37%  288 aa  CDSA_HAEIN RecName: Full=Phosphatidate cytidylyltransferase;       
   95::280     1e-21  33%  285 aa  CDSA_SHIFL RecName: Full=Phosphatidate cytidylyltransferase;       
   95::280     1e-21  33%  285 aa  CDSA_ECOLI RecName: Full=Phosphatidate cytidylyltransferase;       
   95::280     1e-21  33%  285 aa  CDSA_ECO57 RecName: Full=Phosphatidate cytidylyltransferase;       
   77::258     2e-21  44%  260 aa  CDSA_STAS1 RecName: Full=Phosphatidate cytidylyltransferase;       
  106::258     4e-21  38%  260 aa  CDSA_STAHJ RecName: Full=Phosphatidate cytidylyltransferase;       
   72::258     5e-21  36%  260 aa  CDSA_STAAW RecName: Full=Phosphatidate cytidylyltransferase;       
   72::258     5e-21  36%  260 aa  CDSA_STAAS RecName: Full=Phosphatidate cytidylyltransferase;       
   72::258     5e-21  36%  260 aa  CDSA_STAAR RecName: Full=Phosphatidate cytidylyltransferase;       
   72::258     5e-21  36%  260 aa  CDSA_STAAN RecName: Full=Phosphatidate cytidylyltransferase;       
   72::258     5e-21  36%  260 aa  CDSA_STAAM RecName: Full=Phosphatidate cytidylyltransferase;       
   72::258     5e-21  36%  260 aa  CDSA_STAAC RecName: Full=Phosphatidate cytidylyltransferase;       
  109::261     2e-20  41%  270 aa  CDSA_THEMA RecName: Full=Phosphatidate cytidylyltransferase;       
  106::258     6e-20  38%  260 aa  CDSA_STAES RecName: Full=Phosphatidate cytidylyltransferase;       
  106::258     6e-20  38%  260 aa  CDSA_STAEQ RecName: Full=Phosphatidate cytidylyltransferase;       
   82::293     9e-19  43%  298 aa  YNBB_ECOLI RecName: Full=Uncharacterized protein ynbB;
  183::292     2e-14  34%  306 aa  CDSA_MYCTU RecName: Full=Phosphatidate cytidylyltransferase;       
  183::292     2e-14  34%  306 aa  CDSA_MYCBO RecName: Full=Phosphatidate cytidylyltransferase;       
  139::256     5e-14  42%  266 aa  CDSA_HELPY RecName: Full=Phosphatidate cytidylyltransferase;       
  164::310     6e-14  31%  312 aa  CDSA_MYCLE RecName: Full=Phosphatidate cytidylyltransferase;       
  123::257     6e-14  34%  270 aa  CDSA_BRUSU RecName: Full=Phosphatidate cytidylyltransferase;       
  123::257     6e-14  34%  270 aa  CDSA_BRUME RecName: Full=Phosphatidate cytidylyltransferase;       
  123::257     1e-13  34%  270 aa  CDSA_BRUAB RecName: Full=Phosphatidate cytidylyltransferase;       
  123::257     1e-13  34%  270 aa  CDSA_BRUA2 RecName: Full=Phosphatidate cytidylyltransferase;       
  139::256     1e-13  45%  266 aa  CDSA_HELPJ RecName: Full=Phosphatidate cytidylyltransferase;       
   95::230     3e-13  32%  231 aa  CDSA_RICBR RecName: Full=Phosphatidate cytidylyltransferase;       
  156::274     5e-13  51%  293 aa  CDSA_SYNY3 RecName: Full=Phosphatidate cytidylyltransferase;       
   93::227     1e-12  31%  227 aa  CDSA_RICFE RecName: Full=Phosphatidate cytidylyltransferase;       
  117::250     9e-11  38%  259 aa  CDSA_AQUAE RecName: Full=Phosphatidate cytidylyltransferase;       
  160::300     1e-10  39%  308 aa  CDSA_CHLPN RecName: Full=Phosphatidate cytidylyltransferase;       
  103::222     2e-09  31%  228 aa  CDSA_RICTY RecName: Full=Phosphatidate cytidylyltransferase;       
   99::297     1e-08  35%  305 aa  CDSA_CHLMU RecName: Full=Phosphatidate cytidylyltransferase;       
   99::297     2e-08  27%  305 aa  CDSA_CHLTR RecName: Full=Phosphatidate cytidylyltransferase;       
  103::222     1e-07  28%  228 aa  CDSA_RICPR RecName: Full=Phosphatidate cytidylyltransferase;       
  196::356     4e-07  34%  393 aa  CDS1_ENCCU RecName: Full=Phosphatidate cytidylyltransferase;       
  188::229     2e-06  48%  230 aa  CDSA_RICCN RecName: Full=Phosphatidate cytidylyltransferase;       
  214::377     4e-06  48%  457 aa  CDS1_YEAST RecName: Full=Phosphatidate cytidylyltransferase;       
  147::365     2e-05  26%  424 aa  CDS1_SOLTU RecName: Full=Phosphatidate cytidylyltransferase;       
  204::368     4e-05  49%  439 aa  CDSH_SCHPO RecName: Full=Putative phosphatidate
  201::255     3e-04  39%  395 aa  CDSA_MYCPN RecName: Full=Putative phosphatidate
  375::413     3e-04  49%  455 aa  CDSA_CAEEL RecName: Full=Probable phosphatidate
  157::265     3e-04  23%  421 aa  CDS1_ARATH RecName: Full=Phosphatidate cytidylyltransferase;       
  220::272     6e-04  43%  443 aa  CDS2_RAT RecName: Full=Phosphatidate cytidylyltransferase 2;       
  220::272     6e-04  43%  444 aa  CDS2_MOUSE RecName: Full=Phosphatidate cytidylyltransferase 2;     
  221::273     6e-04  43%  445 aa  CDS2_HUMAN RecName: Full=Phosphatidate cytidylyltransferase 2;     
  221::273     6e-04  43%  445 aa  CDS2_BOVIN RecName: Full=Phosphatidate cytidylyltransferase 2;     
  240::290     6e-04  45%  461 aa  CDS1_HUMAN RecName: Full=Phosphatidate cytidylyltransferase 1;     
  256::335     8e-04  32%  421 aa  T194B_MOUSE RecName: Full=Transmembrane protein 194B;
  371::394     8e-04  54%  447 aa  CDSA_DROME RecName: Full=Phosphatidate cytidylyltransferase,
  240::290     8e-04  43%  461 aa  CDS1_RAT RecName: Full=Phosphatidate cytidylyltransferase 1;       
  240::290     8e-04  43%  461 aa  CDS1_MOUSE RecName: Full=Phosphatidate cytidylyltransferase 1;     
    1::274

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CDSA_BACSU      ----------------------------------------------------------------------
CDSA_PSEAE      ----------------------------------------------------------------------
CDSA_HAEIN      ----------------------------------------------------------------------
CDSA_SHIFL      ----------------------------------------------------------------------
CDSA_ECOLI      ----------------------------------------------------------------------
CDSA_ECO57      ----------------------------------------------------------------------
CDSA_STAS1      ----------------------------------------------------------------------
CDSA_STAHJ      ----------------------------------------------------------------------
CDSA_STAAW      ----------------------------------------------------------------------
CDSA_STAAS      ----------------------------------------------------------------------
CDSA_STAAR      ----------------------------------------------------------------------
CDSA_STAAN      ----------------------------------------------------------------------
CDSA_STAAM      ----------------------------------------------------------------------
CDSA_STAAC      ----------------------------------------------------------------------
CDSA_THEMA      ----------------------------------------------------------------------
CDSA_STAES      ----------------------------------------------------------------------
CDSA_STAEQ      ----------------------------------------------------------------------
YNBB_ECOLI      ----------------------------------------------------------------------
CDSA_MYCTU      ----------------------------------------------------------------------
CDSA_MYCBO      ----------------------------------------------------------------------
CDSA_HELPY      ----------------------------------------------------------------------
CDSA_MYCLE      ----------------------------------------------------------------------
CDSA_BRUSU      ----------------------------------------------------------------------
CDSA_BRUME      ----------------------------------------------------------------------
CDSA_BRUAB      ----------------------------------------------------------------------
CDSA_BRUA2      ----------------------------------------------------------------------
CDSA_HELPJ      ----------------------------------------------------------------------
CDSA_RICBR      ----------------------------------------------------------------------
CDSA_SYNY3      ----------------------------------------------------------------------
CDSA_RICFE      ----------------------------------------------------------------------
CDSA_AQUAE      ----------------------------------------------------------------------
CDSA_CHLPN      ----------------------------------------------------------------------
CDSA_RICTY      ----------------------------------------------------------------------
CDSA_CHLMU      ----------------------------------------------------------------------
CDSA_CHLTR      ----------------------------------------------------------------------
CDSA_RICPR      ----------------------------------------------------------------------
CDS1_ENCCU      ----------------------------------------------------------------------
CDSA_RICCN      ----------------------------------------------------------------------
CDS1_YEAST      ----------------------------------------------------------------------
CDS1_SOLTU      ----------------------------------------------------------------------
CDSH_SCHPO      ----------------------------------------------------------------------
CDSA_MYCPN      ----------------------------------------------------------------------
CDSA_CAEEL      ----------------------------------------------------------------------
CDS1_ARATH      ----------------------------------------------------------------------
CDS2_RAT        ----------------------------------------------------------------------
CDS2_MOUSE      ----------------------------------------------------------------------
CDS2_HUMAN      ----------------------------------------------------------------------
CDS2_BOVIN      ----------------------------------------------------------------------
CDS1_HUMAN      ----------------------------------------------------------------------
T194B_MOUSE     ----------------------------------------------------------------------
CDSA_DROME      ----------------------------------------------------------------------
CDS1_RAT        ----------------------------------------------------------------------
CDS1_MOUSE      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxYWHFPQVPWREVALGLFLLASFSYELLFGANLPRFAFGLMAFLYLPWSLGYVLLLRETPDAAMG
CDSA_BACSU      ------------------------------------------FITLAAIYIGMCFHYFIEIRNLDQ--YG
CDSA_PSEAE      ---------------------------------------------------------LVLLKQWP-LANG
CDSA_HAEIN      -------------------LALLLVISYPKSAKFWSKNPLLQLLFAFSTLIPFVAGVLRLRLETHDPYHG
CDSA_SHIFL      --------------WWIVALLLVLFYPGSAAIWRNSKTLRLIFGVLTIVPFFWGMLALRAWHYDENHYSG
CDSA_ECOLI      --------------WWIVALLLVLFYPGSAAIWRNSKTLRLIFGVLTIVPFFWGMLALRAWHYDENHYSG
CDSA_ECO57      --------------WWIVALLLVLFYPGSAAIWRNSKTLRLIFGVLTIVPFFWGMLALRAWHYDENHYSG
CDSA_STAS1      -------------------LQLKSLIAMSFILLSYTVLSKNRFSFMDAAFCLMSIAYVMYLYET--RSEG
CDSA_STAHJ      -----------------------------------------AFCLMSVAYV--GIGFMYFYATRSD---G
CDSA_STAAW      -------------PWVQV-IQLKSLIAMSFIVLSYTVLSKNRFSFMDAAFCLMSVAYVMFFYET--RSEG
CDSA_STAAS      -------------PWVQV-IQLKSLIAMSFIVLSYTVLSKNRFSFMDAAFCLMSVAYVMFFYET--RSEG
CDSA_STAAR      -------------PWVQV-IQLKSLIAMSFIVLSYTVLSKNRFSFMDAAFCLMSVAYVMFFYET--RSEG
CDSA_STAAN      -------------PWVQV-IQLKSLIAMSFIVLSYTVLSKNRFSFMDAAFCLMSVAYVMFFYET--RSEG
CDSA_STAAM      -------------PWVQV-IQLKSLIAMSFIVLSYTVLSKNRFSFMDAAFCLMSVAYVMFFYET--RSEG
CDSA_STAAC      -------------PWVQV-IQLKSLIAMSFIVLSYTVLSKNRFSFMDAAFCLMSVAYVMFFYET--RSEG
CDSA_THEMA      ---------------------------------------------IALIYVTFFLSFFLPIYRDFGAANA
CDSA_STAES      -----------------------------------------AFCLMSVAYV--GIGFMYFYETRSE---G
CDSA_STAEQ      -----------------------------------------AFCLMSVAYV--GIGFMYFYETRSE---G
YNBB_ECOLI      --------HFPRWLYWGIPLN-YLLIGFNCFELFLLFIPLAGFLILAFLHTVSAIGWIMTVFALSHAA--
CDSA_MYCTU      ----------------------------------------------------------------------
CDSA_MYCBO      ----------------------------------------------------------------------
CDSA_HELPY      ----------------------------------------------------------------------
CDSA_MYCLE      -------------------------------------------------WVPLFASFAALLVYPKDGAGR
CDSA_BRUSU      -----------------------------------------------------------------DEPFG
CDSA_BRUME      -----------------------------------------------------------------DEPFG
CDSA_BRUAB      -----------------------------------------------------------------DEPFG
CDSA_BRUA2      -----------------------------------------------------------------DEPFG
CDSA_HELPJ      ----------------------------------------------------------------------
CDSA_RICBR      ----------------------------------------------------------------------
CDSA_SYNY3      ---------------------------------------------------------------------G
CDSA_RICFE      ----------------------------------------------------------------------
CDSA_AQUAE      ------------------------------------------------------LVYLIKIKE-----IS
CDSA_CHLPN      ---------------------------------------------------------------TQEPYLG
CDSA_RICTY      ----------------------------------------------------------------------
CDSA_CHLMU      --------HVDLIPW-------FFLFFWTVHLVFKSRHPIGSTGLALFCMLYVSVPIRLFLHHTDTPFIG
CDSA_CHLTR      --------HIDLLPW-------FFLFFWTIRLVFKSRHPIGSTGLALFCMLYVSVPIRLFLHHTDTPFVG
CDSA_RICPR      ----------------------------------------------------------------------
CDS1_ENCCU      ---------------------------------------------------------------------G
CDSA_RICCN      ----------------------------------------------------------------------
CDS1_YEAST      ---------------------------------------------------------------------G
CDS1_SOLTU      ------------VKYHMVTCYFFYIAGFMWFILLKKKMYKYQFSQYAWTHMILIVVFTQSAFTVANIFEG
CDSH_SCHPO      ---------------------------------------------------------------------G
CDSA_MYCPN      ----------------------------------------------------------------------
CDSA_CAEEL      ----------------------------------------------------------------------
CDS1_ARATH      ---------------------LYIIGFMWFILTLKKKMYKYQFGQYAWTHMILIVVFTQSSFTVANIFEG
CDS2_RAT        ---------------------------------------------------------------------G
CDS2_MOUSE      ---------------------------------------------------------------------G
CDS2_HUMAN      ---------------------------------------------------------------------G
CDS2_BOVIN      ---------------------------------------------------------------------G
CDS1_HUMAN      ----------------------------------------------------------------------
T194B_MOUSE     ------YSHGPLADEGSRDLLMWTLRLFSLALVYGVAAPQFAYAVLIVLLFSWSLHYLLRAFSYLRWKMR
CDSA_DROME      ----------------------------------------------------------------------
CDS1_RAT        ----------------------------------------------------------------------
CDS1_MOUSE      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LWTLTLPLVASFATDIGAYFIGRAFGRRKLAPEISPGKTVEGSLGGIAVSFLALVVYTGLVREVFPFXXX
CDSA_BACSU      LTYIFYACVVIWSTDSGAYFVGKSLGKRKLWPEISPNKTVEGFAGGIVIALVLATIFQLVAQXXXXXXXX
CDSA_PSEAE      LIIAVMVLV--WGADIGAYFSGKAFGKRKLAPRVSPGKSWEGVYGGLAAS-LAITLAVGLYRGWSXXXXX
CDSA_HAEIN      LFLLLYVFILVWAADSGAYFSGRAFGKRKLAPKVSPGKSWEGVIGGLITALVLAFIFIHFSNNVGDRNIT
CDSA_SHIFL      AIWLLYVMILVWGADSGAYMFGKLFGKHKLAPKVSPGKTWQGFIGGLATA--AVISWGYGMWANLDVAPV
CDSA_ECOLI      AIWLLYVMILVWGADSGAYMFGKLFGKHKLAPKVSPGKTWQGFIGGLATA--AVISWGYGMWANLDVAPV
CDSA_ECO57      AIWLLYVMILVWGADSGAYMFGKLFGKHKLAPKVSPGKTWQGFIGGLATA--AVISWGYGMWANLDVAPV
CDSA_STAS1      LHYILFAFLVVWLTDTGAYIFGRLMGKHKLWPVISPNKTVEGFVGGLICSLIVPLVMMIFVD--FNXXXX
CDSA_STAHJ      LHYILYAFLVVWLTDTGAYIFGRLMGKHKLWPVISPNKTIEGFIGGLICSLIVPIVMLFFVD--FNLNIW
CDSA_STAAW      LHYILYAFLIVWLTDTGAYLFGKMMGKHKLWPVISPNKTIEGFIGGL---FCSLIVPLAMLYFVFNMNVW
CDSA_STAAS      LHYILYAFLIVWLTDTGAYLFGKMMGKHKLWPVISPNKTIEGFIGGL---FCSLIVPLAMLYFVFNMNVW
CDSA_STAAR      LHYILYAFLIVWLTDTGAYLFGKMMGKHKLWPVISPNKTIEGFIGGL---FCSLIVPLAMLYFVFNMNVW
CDSA_STAAN      LHYILYAFLIVWLTDTGAYLFGKMMGKHKLWPVISPNKTIEGFIGGL---FCSLIVPLAMLYFVFNMNVW
CDSA_STAAM      LHYILYAFLIVWLTDTGAYLFGKMMGKHKLWPVISPNKTIEGFIGGL---FCSLIVPLAMLYFVFNMNVW
CDSA_STAAC      LHYILYAFLIVWLTDTGAYLFGKMMGKHKLWPVISPNKTIEGFIGGL---FCSLIVPLAMLYFVFNMNVW
CDSA_THEMA      LLVLT----STWVFDSFAYFTGLKFGRTRISPRYSPRKSLEGVIGG----FLGVVIYTFLYRSVNVISFR
CDSA_STAES      LRYILFAFLIVWLTDTGAYIFGRLMGKHKLWPVISPNKTIEGFFGGILCSILVPLVMQMFVD--LHMNIW
CDSA_STAEQ      LRYILFAFLIVWLTDTGAYIFGRLMGKHKLWPVISPNKTIEGFFGGILCSILVPLVMQMFVD--LHMNIW
YNBB_ECOLI      -WLLMLPTTXTESNDIAQYLWGKSCGRRKVVPKVSPGKTLEGLMGGVITIMIASLI---IGXXXXXXXXX
CDSA_MYCTU      -------MIAVIASDVGGYAVGVLFGKHPMVPTISPKKSWEGFAGSLVCGITATIITATFLVGKTPWIGA
CDSA_MYCBO      -------MIAVIASDVGGYAVGVLFGKHPMVPTISPKKSWEGFAGSLVCGITATIITATFLVGKTPWIGA
CDSA_HELPY      -------------SDVGAFFGGKLLGKTPFTPT-SPNKTLEGALIGVVLSVLGSFVGMGKLSGGF----F
CDSA_MYCLE      VFCLMIAVVAS---DVGGYTVGVLFGKHPLVPRISPNKSWEGFAGSLVCGXXXXXXXXXXXXGKTPWVGA
CDSA_BRUSU      FTTIVFLFAVVWSTDIAAYFNGRALGGPKLAPRFSPNKTWSXXXXXXXXXXXXXXXXXXXXXXXXXWGVP
CDSA_BRUME      FTTIVFLFAVVWSTDIAAYFNGRALGGPKLAPRFSPNKTWSXXXXXXXXXXXXXXXXXXXXXXXXXWGVP
CDSA_BRUAB      FTTIVFLFAVVWSTDITAYFNGRALGGPKLAPRFSPNKTWSXXXXXXXXXXXXXXXXXXXXXXXXXWGVP
CDSA_BRUA2      FTTIVFLFAVVWSTDITAYFNGRALGGPKLAPRFSPNKTWSXXXXXXXXXXXXXXXXXXXXXXXXXWGVP
CDSA_HELPJ      -------------SDVGAFFGGKLLGKTPFTAT-SPNKTLEGALIGVVLSFVGMGKLSGLMALLFSFLIA
CDSA_RICBR      -WLIMLYFCIVWSVDIFAMIGGKTLGGAKLAPKISPKKTWSGLITGILVATLISFIPSFYIENYYFSNRI
CDSA_SYNY3      LLVTILAFACIWAADIGAYIMGKWLGRTRLS-DISPKKTXXXXXXXXXXXXXXXXXXAWYLQ--WPYWEX
CDSA_RICFE      -WLIMLYFCIIWSVDSFAMIGGKTFKGAKLAPKISPKKTWSGLVTGVLVAVLASFIPNFHIENYYFSNKI
CDSA_AQUAE      TYYLLIFIFGIWINDVFAYYIGKNFGKTPLFPKISPKKTVEXXXXGILNSFLTFVLTVGVAGDYF-----
CDSA_CHLPN      IWWASFLIATTKGADIFGYFFGKAFGNKKIAPQISPNKTVAGCLGATLISFIFFLQIPTRFASYFPM-XX
CDSA_RICTY      -----------WSVDTFAMIGGKTFKGTKLAPKISPKKTWTGLIGTISAGLIAVLVSLIPYYHIENYYFS
CDSA_CHLMU      IWWAIFLIATTKSSDIXXXXXXXXXXXXRIAPVISPNKTVVGFVAGCIASILVSLIFYSHLPKSFAAMPW
CDSA_CHLTR      IWWAIFLIATTKSSDIXXXXXXXXXXXXRIAPVISPNKTVVGFIAGCCGSILVSLLFYSHLPKAFAAVPW
CDSA_RICPR      -----------WSVDTFAMIGGKTFKGIKLAPKISPKKTWTGLITGTXXXXXXXXXXXXIIEHYYFSNKI
CDS1_ENCCU      RFWFVFPALLVISNDISAYVVGKSIGKRPLY-RLSPKKTLEGFIGAFAVGFALLHVNSGFLRDVFGANVR
CDSA_RICCN      ----------------------------------------------------------------------
CDS1_YEAST      LFWFLLPCGLVIVNDIFAYLCGITFGKTKLI-EISPKKTLEGFLGAWFFTALASIILTRIL---------
CDS1_SOLTU      IFWFLLPASLIVINDIAAYFFGFFFGRTPLI-KLSPKKTWEGFIGASITTIISAFLLANMLPEWFPAWFL
CDSH_SCHPO      LFWFFVPVCYVVCNDVFAYLCGKMFGKHPLI-QVSPKKTVEGFLGG------------------------
CDSA_MYCPN      -WTTIFLLIAGVCTDTFAYLFGKRFGKNPLI-KISPSKTWEGAFFGVTGTVLTISI--------------
CDSA_CAEEL      ----------------------------------------------------------------------
CDS1_ARATH      IFWFLLPASLIIINDIFAYIFGFFFGRTPLI-KLSPKKTWEGFIGASVTTIISAFVLANIL---------
CDS2_RAT        MIWFIVPISCVICNDIMAYMFGFFFGRTPLI-KLSPKKTWEGFIGG----FFATVVF-------------
CDS2_MOUSE      MIWFIVPISCVICNDIMAYMFGFFFGRTPLI-KLSPKKTWEGFIGG----FFATVVF-------------
CDS2_HUMAN      MIWFIVPISCVICNDIMAYMFGFFFGRTPLI-KLSPKKTWEGFIGG----FFATVVF-------------
CDS2_BOVIN      MIWFIVPISCVICNDIMAYMFGFFFGRTPLI-KLSPKKTWEGFIGG----FFATVVF-------------
CDS1_HUMAN      IWFL-VPISSVICNDITAYLFGFFFGRTPLI-KLSPKKTWEGFIGG----FFSTVVF-------------
T194B_MOUSE     PWFTAEPQVARYLTD-------------------------------------------------------
CDSA_DROME      ----------------------------------------------------------------------
CDS1_RAT        IWFL-VPISSVICNDITAYLFGFFFGRTPLI-KLSPKKTWEGFIGG----FFSTVIF-------------
CDS1_MOUSE      IWFL-VPISSVICNDITAYLFGFFFGRTPLI-KLSPKKTWEGFIGG----FFSTVIF-------------


                         .         .         .         +         .         .         .:280
query           XXXXXXXXXXXXXXXXXXAESMLKRFAGVKDSGNFLPGHGGLLDRIDSLLFAFPLTYFLVVLFT
CDSA_BACSU      XXXXXXXSVFGQLGDL--VESALKRHYDVKDSGNILPGHGGILDRFDSFLFVMPFLYFLLALFS
CDSA_PSEAE      XXXXXXXXVVFVSIVGDLTESMFKRQSGIKDSSNLLPGHGGVLDRIDSLTAAIPV---------
CDSA_HAEIN      GFIILSVATVAISVLGDLTESMFKRESGVKDSSQLIPGHGGVLDRIDSLTAAVPFSYF------
CDSA_SHIFL      TLLICSIVAALASVLGDLTESMFKREAGIKDSGHLIPGHGGILDRIDSLTAAVPVFACLLLL--
CDSA_ECOLI      TLLICSIVAALASVLGDLTESMFKREAGIKDSGHLIPGHGGILDRIDSLTAAVPVFACLLLL--
CDSA_ECO57      TLLICSIVAALASVLGDLTESMFKREAGIKDSGHLIPGHGGILDRIDSLTAAVPVFACLLLL--
CDSA_STAS1      XXXXXXXXXSMFGQLGDLVESGFKRHFGVKDSGRILPGHGGILDRFDSFMFVLPLLNILLI---
CDSA_STAHJ      LLLLVTIILSIFGQLGDLVESGFKRHFGVKDSGRILPGHGGILDRFDSFMFVLPLLNILLI---
CDSA_STAAW      ILLGVTLILSLFGQLGDLVESGFKRHFGVKDSGRILPGHGGILDRFDSFMFVLPLLNILLI---
CDSA_STAAS      ILLGVTLILSLFGQLGDLVESGFKRHFGVKDSGRILPGHGGILDRFDSFMFVLPLLNILLI---
CDSA_STAAR      ILLGVTLILSLFGQLGDLVESGFKRHFGVKDSGRILPGHGGILDRFDSFMFVLPLLNILLI---
CDSA_STAAN      ILLGVTLILSLFGQLGDLVESGFKRHFGVKDSGRILPGHGGILDRFDSFMFVLPLLNILLI---
CDSA_STAAM      ILLGVTLILSLFGQLGDLVESGFKRHFGVKDSGRILPGHGGILDRFDSFMFVLPLLNILLI---
CDSA_STAAC      ILLGVTLILSLFGQLGDLVESGFKRHFGVKDSGRILPGHGGILDRFDSFMFVLPLLNILLI---
CDSA_THEMA      TFLPFAATVAIMDTFGDIFESALKRHYGVKDSGKTLPGHGGMLDRIDGLLFVAPVSYIV-----
CDSA_STAES      LLLLVTIVLSMFGQLGDLVESGFKRHFGVKDSGRILPGHGGILDRFDSFMFVLPLLNILLI---
CDSA_STAEQ      LLLLVTIVLSMFGQLGDLVESGFKRHFGVKDSGRILPGHGGILDRFDSFMFVLPLLNILLI---
YNBB_ECOLI      XXXXXXXXXXXSGFCGDVVMSAIKRDIGVKDSGKLLPGHGGLLDRIDSLIFTAPVFFYFI----
CDSA_MYCTU      LLGVLFVLTTALGDL---VESQVKRDLGIKDMGRLLPGHGGLMDRLDGIL--------------
CDSA_MYCBO      LLGVLFVLTTALGDL---VESQVKRDLGIKDMGRLLPGHGGLMDRLDGIL--------------
CDSA_HELPY      MALFFSFLIALVAVFGDLYESYLKRKVGIKDSGKILPGHGGVLDRLDSMLFGHALLYFLEI---
CDSA_MYCLE      LLSFVLVLTCTLGDL---VESQVKRDLGIKDMGRLLPGHGGLMDRLDGVLPSAVVAWTMLTL--
CDSA_BRUSU      VLALLLSIVSQIGDL---AESWVKRQFGAKDSGRLLPGHGGVLDRVDGLVAAAALLYLFGAIF-
CDSA_BRUME      VLALLLSIVSQIGDL---AESWVKRQFGAKDSGRLLPGHGGVLDRVDGLVAAAALLYLFGAIF-
CDSA_BRUAB      VLALLLSIVSQIGDL---AESWVKRQFGAKDSGRLLPGHGGVLDRVDGLVAAAALLYLFGAIF-
CDSA_BRUA2      VLALLLSIVSQIGDL---AESWVKRQFGAKDSGRLLPGHGGVLDRVDGLVAAAALLYLFGAIF-
CDSA_HELPJ      LMAVFGDLY----------ESYLKRKVGVKDSGKILPGHGGVLDRLDSMLFGHVLLYFLEI---
CDSA_RICBR      YLFIISCTLALTAQLSDLFISYFKRKFNIKDSGNIIPGHGGVLDRFDSIILTAPILFFINGLY-
CDSA_SYNY3      XXXXXXXXXXXXXXXXXXTESMMKRDAGVKDSGQLIPGHGGILDRTDSYVF-------------
CDSA_RICFE      YLFIISCILALIAQSSDLFISYLKRKFNIKDSGHIIPGHGGVLDRFDSIILTAPVLFFISIL--
CDSA_AQUAE      -------------------KSFIKRQVGIKDFSNVFGEHGGFTDRFDALVFSAPVFYLIM----
CDSA_CHLPN      XXXXXXXXXXXTGFFGDIIESIFKRDAHLKNS-NKLKAVGGMXXXXXXXXXXXPIAYLFLLI--
CDSA_RICTY      NKIYLFIISCILALIAQSSDSYFKRKFNIKDSGHIIPGHGGVLDRFDSIILTAPVFF-------
CDSA_CHLMU      ILVAXXXXXXXXXXXXXXXESTFKRDAQIKNSSD-LESIGGMLDVLDSLLLSTPIVYAILLI--
CDSA_CHLTR      ILIALGTVLGVSGFFGDIIESTFKRDAQIKNSSD-LESIGGMLDVLDSLLLSTPIVYAILLI--
CDSA_RICPR      YLFIISCILALIAQSSDLFISYFKRKFNIKDSGHIIPGHGGVLDRFDSIILTAPVFF-------
CDS1_ENCCU      VQSIYIHIIPFIFVASFVAASALKRAYKKKDFGEAISGHGGIADRMDCLIAIFASTYISSFIYT
CDSA_RICCN      --------------------SYFKRKFNIKDSGHIIPGHGGVLDRFDSIILT-TLILFLMKIY-
CDS1_YEAST      --------------------SGLKRTFKVKDFGHSIPGHGGITDRVD-----------------
CDS1_SOLTU      SREIAVLPVQWHALLLGLFASIIAPFGGIKDFGDSIPGHGGMTDRMD-----------------
CDSH_SCHPO      --------------------SGLKRAFKIKDFGASIPGHGGLTDRMD-----------------
CDSA_MYCPN      ----------------------------------------------------------------
CDSA_CAEEL      --------------------SGFKRAFKIKDFGDVIPGHGGLMDRFDCLMGTFVMVY-------
CDS1_ARATH      ----------------------------------------------------------------
CDS2_RAT        ----------------------------------------------------------------
CDS2_MOUSE      ----------------------------------------------------------------
CDS2_HUMAN      ----------------------------------------------------------------
CDS2_BOVIN      ----------------------------------------------------------------
CDS1_HUMAN      ----------------------------------------------------------------
T194B_MOUSE     ----------------------------------------------------------------
CDSA_DROME      -----------------------KRAFKIKDFGDMIPGHGGIMDRFD-----------------
CDS1_RAT        ----------------------------------------------------------------
CDS1_MOUSE      ----------------------------------------------------------------