[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tthe0:AAS80903.1

[Show Plain Result]


## Summary of Sequence Search
    1::370
    1::326     e-134 100%  326 aa  Y924_THET8 RecName: Full=UPF0103 protein TTHA0924;
    4::372     9e-27  33%  374 aa  Y1336_AQUAE RecName: Full=UPF0103 protein aq_1336;
  137::276     3e-07  32%  277 aa  Y087_THEMA RecName: Full=UPF0103 protein TM_0087;
  137::276     5e-07  31%  277 aa  Y860_THESQ RecName: Full=UPF0103 protein TRQ2_0860;
   50::278     2e-06  24%  282 aa  Y1590_CALMQ RecName: Full=UPF0103 protein Cmaq_1590;
  137::276     3e-06  29%  277 aa  Y837_THEP1 RecName: Full=UPF0103 protein Tpet_0837;
   67::257     1e-05  25%  290 aa  MEMO1_DICDI RecName: Full=Protein MEMO1 homolog;
  137::260     2e-05  34%  281 aa  Y1771_AERPE RecName: Full=UPF0103 protein APE_1771;
   40::198     2e-05  27%  281 aa  Y028_PYRCJ RecName: Full=UPF0103 protein Pcal_0028;
   78::196     7e-05  27%  277 aa  Y605_THENN RecName: Full=UPF0103 protein CTN_0605;
   84::135     7e-05  48%  733 aa  GLGB_BURCM RecName: Full=1,4-alpha-glucan-branching enzyme;        
   40::198     9e-05  25%  281 aa  Y062_PYRAR RecName: Full=UPF0103 protein Pars_0062;
   93::253     2e-04  27%  350 aa  TG253_CAEEL RecName: Full=UPF0103 protein tag-253;
  164::234     4e-04  41%  249 aa  Y1519_SHEHH RecName: Full=Putative hydrolase Shal_1519;       
  131::198     5e-04  31%  281 aa  Y818_PYRAE RecName: Full=UPF0103 protein PAE0818;
  131::195     6e-04  32%  281 aa  Y1105_PYRIL RecName: Full=UPF0103 protein Pisl_1105;
    1::370

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxRLREPQITPIEGGFLVSDPYGVYEKPLALTEGGLFLLSLMEGRTLEEVQEEVFKRHGVLVPXXXX
Y924_THET8      --------------------------------------------MEGRTLEEVQEEVFKRHGVLVPXXXX
Y1336_AQUAE     -----KVRFFDLQPYGDKFVVRDPVGI-SQPFIATPELLFLLSLMDGRDITDLQAEFFKKTGHLIPKEEI
Y087_THEMA      ----------------------------------------------------------------------
Y860_THESQ      ----------------------------------------------------------------------
Y1590_CALMQ     ----------------------------------------------------------------------
Y837_THEP1      ----------------------------------------------------------------------
MEMO1_DICDI     ----------------------------------------------------------------------
Y1771_AERPE     ----------------------------------------------------------------------
Y028_PYRCJ      ----------------------------------------------------------------------
Y605_THENN      ----------------------------------------------------------------------
GLGB_BURCM      ----------------------------------------------------------------------
Y062_PYRAR      ----------------------------------------------------------------------
TG253_CAEEL     ----------------------------------------------------------------------
Y1519_SHEHH     ----------------------------------------------------------------------
Y818_PYRAE      ----------------------------------------------------------------------
Y1105_PYRIL     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGLSYPXXXXXXXXXXXXXXXSYPGEGEEARVL
Y924_THET8      XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGLSYPXXXXXXXXXXXXXXXSYPGEGEEARVL
Y1336_AQUAE     NQVINFLDENYLLYNERFXXXXXXXXXXXXXXGYREPAGQAYPENPQELKNFIEETVNKN-SEKFKARGI
Y087_THEMA      ----------------------------------------------------------------------
Y860_THESQ      ----------------------------------------------------------------------
Y1590_CALMQ     ---------------------------------------------------------------------V
Y837_THEP1      ----------------------------------------------------------------------
MEMO1_DICDI     ----------------------------------------------------------------------
Y1771_AERPE     ----------------------------------------------------------------------
Y028_PYRCJ      ------------------------------------------------------------PKLGTEALGG
Y605_THENN      ----------------------------------------------------------------------
GLGB_BURCM      ----------------------------------------------------------------------
Y062_PYRAR      ------------------------------------------------------------PKLGEKALGG
TG253_CAEEL     ------------------------------------------------------------------ARAL
Y1519_SHEHH     ----------------------------------------------------------------------
Y818_PYRAE      ----------------------------------------------------------------------
Y1105_PYRIL     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LMPHLEPSRVPEVYGAALAALEKTPPPERIYLVGVAHRPLKEKAAALPVPFQTPFGXXXXXXXXXXXXXX
Y924_THET8      LMPHLEPSRVPEVYGAALAALEKTPPPERIYLVGVAHRPLKEKAAALPVPFQTPFGXXXXXXXXXXXXXX
Y1336_AQUAE     LVPHMDLRVASGVYGSVYSAIKENEY-DTVVLLGVSHYFHETPFSVLPLDLRTPLGDLKVDIERVEELQK
Y087_THEMA      ----------------------------------------------------------------------
Y860_THESQ      ----------------------------------------------------------------------
Y1590_CALMQ     IVPHAGYVYSGPVAAHAYVEVGKYIKPKVFVIIGPNHYGVGSPAAIMTSTWETPLGQVEIDEEVAKQIKA
Y837_THEP1      ----------------------------------------------------------------------
MEMO1_DICDI     ---------------------------KRVFILGPSHHVYMKTCGLTKLDWETPIGNLKVDKDTTNKLFD
Y1771_AERPE     ----------------------------------------------------------------------
Y028_PYRCJ      VVPHAGYMYSGPVAAWLYSALAGYGAPTTFVIIGPNHYGIGAPVAIMKSAWETPFGRVEIDEELASLIAS
Y605_THENN      --------------------------PSLVVIIGPNHTGLGKPVGIWPEGFETPLGRVPVNEEAVEILLN
GLGB_BURCM      ----------------------------------------------------------------------
Y062_PYRAR      VVPHAGYIYSGPVAAWLYSALAGYGKPDAIIIIGPNHYGIGAPVAVMKSGWETPLGRVEVDGDLAELIMR
TG253_CAEEL     ISPHAGYSYCGETAAYAFKQVVSSAV-ERVFILGPSHVALNGCAITTCSKYRTPLGDLIVDHKINEELRA
Y1519_SHEHH     ----------------------------------------------------------------------
Y818_PYRAE      ----------------------------------------------------------------------
Y1105_PYRIL     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           XXXFELFNTPLAFREEHSLELPLFFLKGRFPEARVLPLLVARRSPELGEALKVVLRDFPGLLVLAVDLSH
Y924_THET8      XXXFELFNTPLAFREEHSLELPLFFLKGRFPEARVLPLLVARRSPELGEALKVVLRDFPGLLVLAVDLSH
Y1336_AQUAE     MFDYDLSHDVLAYKNEHSIEFQTIFLKYLFPEVKVIPAIVSKSLKEIAHKITKVLEDSQNLIISSVDFSH
Y087_THEMA      ---------------EHSIEVQIPFLQFVFGEVSIVPICLMDQSPDLASALAKLVAEFPGVLIIATDLNH
Y860_THESQ      ---------------EHSIEVQIPFLQFVFGEVSMVPICLMDQSPDLASALMKLAAEFPGVLIIATDLNH
Y1590_CALMQ     KVK-DLAEDPIAFEREHSIEVQVPFIQYLFPGSRIVPIVLWNQSRRLGSAISEVIDGRAGVVVASSDLNH
Y837_THEP1      ---------------EHSIEVQIPFLQFVFGDVSIVPICLMDQSPDLANALTKLVAEFPSVLIIATDLNH
MEMO1_DICDI     TGSF-IWNTKSVDEDEHSLELQLPYIEKRLLELSIVPIMVGSLSIDLGKILAPYFDDPENFFVISSDFCH
Y1771_AERPE     ---------------EHSLEVQLPFLQYLYGDFRIVPIVVLHQTLDISIRIARALREENGVLVATSDLNH
Y028_PYRCJ      NYR-EIEDDAHAFSKEHSIEVQLPFIQYYFKNVKFVPIAVWRQSRELGKAIAKALREYKRYLLASSDFNH
Y605_THENN      SSRYAEEDT-LSHLKEHSIEVQLPFLQFVFGDFSIVPVCLMDQSPTVAEAVRELMKSFRNVLIIATDLNH
GLGB_BURCM      ----------------------------------------------------------------------
Y062_PYRAR      HYK-GVEDDFYAFSKEHSVEVQIPFIQYYFGDVRIVPIVVWRQSRELGKAVATAIREYGRYVLASSDFNH
TG253_CAEEL     TRHFDLMDRRDE-ESEHSIEMQLPFIAKVMGSKRIVPVLVGSRQQTYGNIFAHYMEDPRNLFVISSDFCH
Y1519_SHEHH     --------------------------------------LVSRKGSEHNLAIAKAVKEAGGLLVMGSD-SH
Y818_PYRAE      -----------AFSKEHSVEVQVPFIQYYFGDVKIVPIVMWRQSRELGRAIAKALKEYKAYVIASSDFNH
Y1105_PYRIL     -----------AFSREHSIEVQIPFIQYFFGDVKIVPITIWRQSRELGKALANAIREYRAYIIASSDFNH


                         .         *         .         .         .         .         +:350
query           VGPRFGDTPLTRTLAEEARRRDLGFLERLAEGEPEAALAFLGANPTRIDGVEVVASLLPLLRERKGKVLA
Y924_THET8      VGPRFGDTPLTRTLAEEARRRDLGFLERLAEGEPEAALAFLGANPTRIDGVEVVASLLPLLRERKGKVLA
Y1336_AQUAE     VGRKFGDPH-----SYDPSPRDREYINLLAELKNEEAFNLLQSNRTRIDGQFVFLEILKNLGVKEGKLLD
Y087_THEMA      ----YEDQRTT-------LRKDSYIIEAIEGMDPSLLYEYLVREDISMCGYGGVATLLNMDFENV-RILK
Y860_THESQ      ----YEDQRTT-------LRKDSYIIEAIKSNDPRLLYEYLVKEDISMCGYGGVATLLN-MNFKNARILK
Y1590_CALMQ     YEPH-----------EVTTDKDMKVIERILNMDEEGFYTVMDKYDVSVCGFGAIMTAIVYSRKQGSKLLK
Y837_THEP1      ----YEDQRTT-------LRKDSYIMEAIRNKDPRLLYEYLVKEDISMCGYGGVATLLN-MNFKNARILK
MEMO1_DICDI     WGERFGEVPIYKYIEELDRKG----MEIIESGDPVQFSKYLKETKNTICGRCPIAVMLWITKNSQFK---
Y1771_AERPE     YEPY-----------EENKRKDLLLLKAIEEGDPEAVFKTIEAHAISACGPSPIAAAVEALAGVKPRVLA
Y028_PYRCJ      YEP-------------------------------------------------------------------
Y605_THENN      ----------------------------------------------------------------------
GLGB_BURCM      ------DWPDTRQITDDAYALDEAALARFAAGDPAAVLDCLGATPTRVDGVDGV----------------
Y062_PYRAR      YEP-------------------------------------------------------------------
TG253_CAEEL     WGERFSFSPYDR----------------------------------------------------------
Y1519_SHEHH     VAYSLGDFTLAEQIVEQADFP----IERLLNRSPEALLAFLSA---------------------------
Y818_PYRAE      YEP-------------------------------------------------------------------
Y1105_PYRIL     ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           HRLDLEAPTLSAVGAGTLVL
Y924_THET8      HRLDLEAPTLSAVGAGTLVL
Y1336_AQUAE     YDVYHEAPTDSKVSYAGMV-
Y087_THEMA      HATDVSGDTLEVVGYLSAIL
Y860_THESQ      HATDVSGDKLEVVGYLSAIL
Y1590_CALMQ     HATDTSGYLLETVGYASI--
Y837_THEP1      HATDVSGDKLEVVGYLSAIL
MEMO1_DICDI     --------------------
Y1771_AERPE     Y-------------------
Y028_PYRCJ      --------------------
Y605_THENN      --------------------
GLGB_BURCM      --------------------
Y062_PYRAR      --------------------
TG253_CAEEL     --------------------
Y1519_SHEHH     --------------------
Y818_PYRAE      --------------------
Y1105_PYRIL     --------------------