[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tthe0:AAS80912.1

[Show Plain Result]


## Summary of Sequence Search
    1::427
    1::427       0.0 100%  427 aa  GSA_THET2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::424       0.0  92%  424 aa  GSA_THET8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    3::421     e-119  55%  424 aa  GSA_AQUAE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::424     e-119  52%  429 aa  GSA2_BREBN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   12::438     e-118  55%  446 aa  GSA_DEIGD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::422     e-118  53%  427 aa  GSA_SULAA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    3::417     e-118  52%  428 aa  GSA_PERMH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    9::435     e-117  54%  441 aa  GSA_DEIDV RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::413     e-116  52%  417 aa  GSA_SOLUE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::417     e-115  51%  428 aa  GSA_SULSY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::422     e-114  51%  428 aa  GSA_THISH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    3::418     e-114  51%  426 aa  GSA_HAHCH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   13::427     e-114  51%  431 aa  GSA_ACIBL RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    8::425     e-113  52%  432 aa  GSA_DESAP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   21::432     e-113  52%  439 aa  GSA_RUBXD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::419     e-113  48%  427 aa  GSA_THEYD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   11::422     e-113  50%  432 aa  GSA_NOSP7 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   12::423     e-112  57%  444 aa  GSA_DEIRA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-112  51%  426 aa  GSA_SALPK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-112  51%  426 aa  GSA_SALPA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-112  51%  426 aa  GSA_SALPC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-112  51%  426 aa  GSA_SALCH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   12::421     e-112  55%  432 aa  GSA_CARHZ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::416     e-112  50%  429 aa  GSA_ANADF RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-111  51%  426 aa  GSA_ENTS8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    2::426     e-111  49%  430 aa  GSA_DESHD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-111  51%  426 aa  GSA_KLEP7 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-111  50%  426 aa  GSA_ENT38 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-111  50%  426 aa  GSA_SALAR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-111  50%  426 aa  GSA_SALTY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    2::426     e-111  48%  430 aa  GSA_DESHY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::424     e-111  51%  430 aa  GSA_THERP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-111  50%  426 aa  GSA_SALHS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-111  50%  426 aa  GSA_KLEP3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::422     e-111  54%  429 aa  GSA_AZOVD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   15::433     e-111  50%  436 aa  GSA_SYNJA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   11::419     e-111  50%  432 aa  GSA_GLOVI RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::419     e-111  49%  429 aa  GSA2_GEOTN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    4::422     e-110  50%  427 aa  GSA_PSEA7 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   11::429     e-110  49%  432 aa  GSA_ANAVT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::422     e-110  50%  427 aa  GSA_ACTSZ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   12::430     e-110  49%  433 aa  GSA_CYAA5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-110  51%  427 aa  GSA_MARMS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   11::429     e-110  49%  432 aa  GSA_ANASP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::423     e-110  50%  430 aa  GSA_SHEB9 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::423     e-110  50%  430 aa  GSA_SHEB8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::423     e-110  50%  430 aa  GSA_SHEB5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::423     e-110  50%  430 aa  GSA_SHEB2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-110  50%  428 aa  GSA_PROMH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::419     e-110  50%  429 aa  GSA2_GEOKA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    4::422     e-110  50%  427 aa  GSA_PSEAB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::423     e-110  50%  430 aa  GSA_SHESW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::423     e-110  50%  430 aa  GSA_SHEPC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::422     e-110  53%  427 aa  GSA_PSEPK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    8::420     e-110  50%  432 aa  GSA_DESRM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::422     e-109  50%  427 aa  GSA_PSEAE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::422     e-109  50%  427 aa  GSA_PSEA8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    8::428     e-109  51%  437 aa  GSA_MOOTA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::423     e-109  50%  430 aa  GSA_SHESR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::423     e-109  48%  428 aa  GSA_RUTMC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::422     e-109  52%  427 aa  GSA_PSEP1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-109  50%  426 aa  GSA_CELJU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-109  49%  424 aa  GSA_ALKOO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   15::433     e-109  49%  436 aa  GSA_SYNJB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::422     e-109  50%  427 aa  GSA_PSEU5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::422     e-109  50%  427 aa  GSA_PSEF5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::422     e-109  48%  425 aa  GSA_HYDS0 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::422     e-109  52%  427 aa  GSA_PSEPG RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-109  49%  426 aa  GSA_CITK8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::420     e-109  49%  428 aa  GSA_SHEFN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::422     e-109  50%  427 aa  GSA_PSEU2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-109  50%  427 aa  GSA_EDWI9 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   12::423     e-109  49%  433 aa  GSA_CYAP8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-109  50%  426 aa  GSA_YERPY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-109  50%  426 aa  GSA_YERPS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-109  50%  426 aa  GSA_YERPP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-109  50%  426 aa  GSA_YERPN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-109  50%  426 aa  GSA_YERPG RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-109  50%  426 aa  GSA_YERPE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-109  50%  426 aa  GSA_YERPB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-109  50%  426 aa  GSA_YERPA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-109  50%  426 aa  GSA_YERP3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    8::422     e-108  49%  431 aa  GSA_TOLAT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::422     e-108  52%  427 aa  GSA_PSEPW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::423     e-108  49%  428 aa  GSA_PROMM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::422     e-108  52%  427 aa  GSA_IDILO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::423     e-108  50%  430 aa  GSA_SHESM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::423     e-108  50%  430 aa  GSA_SHESA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-108  50%  426 aa  GSA_ECOLC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-108  50%  426 aa  GSA_ECO8A RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-108  50%  426 aa  GSA_ECO55 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-108  50%  426 aa  GSA_ECO24 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   52::470     e-108  51%  473 aa  GSA_BRANA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase,
    6::424     e-108  48%  427 aa  GSA_PELCD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-108  50%  426 aa  GSA_ERWCT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::422     e-108  50%  427 aa  GSA_PSEFS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::423     e-108  49%  430 aa  GSA_SHEON RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    9::422     e-108  54%  429 aa  GSA_ACIC5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   12::425     e-108  52%  433 aa  GSA_SYNE7 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   22::435     e-108  53%  437 aa  GSA_SORC5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-108  49%  428 aa  GSA_SHELP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-108  49%  427 aa  GSA_PHOLL RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::420     e-108  49%  433 aa  GSA_SHEDO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::423     e-108  47%  431 aa  GSA_PSEA6 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::423     e-108  48%  427 aa  GSA_HAEPS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    8::421     e-108  49%  425 aa  GSA_CHRVO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-108  49%  426 aa  GSA_ECOUT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-108  49%  426 aa  GSA_ECOL6 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-108  49%  426 aa  GSA_ECOL5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-108  49%  426 aa  GSA_ECOK1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-108  49%  426 aa  GSA_ECO45 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-108  49%  426 aa  GSA_ECO27 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::419     e-108  48%  431 aa  GSA2_BACLD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   53::471     e-108  51%  474 aa  GSA1_ARATH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    6::423     e-107  49%  428 aa  GSA_PROM3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    8::419     e-107  51%  436 aa  GSA_HELMI RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::421     e-107  52%  428 aa  GSA_VESOH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::422     e-107  52%  427 aa  GSA_PSEE4 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-107  49%  426 aa  GSA_ECO81 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   12::425     e-107  51%  433 aa  GSA_SYNP6 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-107  49%  426 aa  GSA_SHISS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::422     e-107  49%  427 aa  GSA_PSEPF RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::422     e-107  49%  427 aa  GSA_PSE14 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-107  49%  426 aa  GSA_MARAV RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-107  49%  426 aa  GSA_ECO7I RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::428     e-107  47%  433 aa  GSA_CLONN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::419     e-107  48%  430 aa  GSA_BACSU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::419     e-107  47%  444 aa  GSA_XYLFM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-107  48%  428 aa  GSA_SHESH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::416     e-107  49%  427 aa  GSA_MANSM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   48::466     e-107  49%  469 aa  GSA_HORVU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase,
    4::418     e-107  49%  426 aa  GSA_ECO5E RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-107  49%  426 aa  GSA_ECO57 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::419     e-107  47%  444 aa  GSA_XYLFT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::419     e-107  47%  444 aa  GSA_XYLF2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::426     e-107  50%  431 aa  GSA_PELPB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   45::458     e-107  53%  466 aa  GSA_SOYBN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase,
    4::422     e-107  49%  427 aa  GSA_PSESM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-107  48%  428 aa  GSA_AERS4 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-107  49%  426 aa  GSA_SALEP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    8::422     e-107  53%  426 aa  GSA_HALHL RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::414     e-107  50%  427 aa  GSA_CLOTH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::406     e-107  49%  427 aa  GSA_BURXL RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   12::429     e-107  47%  434 aa  GSA_SYNR3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::421     e-107  48%  429 aa  GSA_SERP5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-107  49%  426 aa  GSA_SALPB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-107  49%  426 aa  GSA_SALNS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-107  49%  426 aa  GSA_SALG2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-107  49%  426 aa  GSA_ECOSE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-107  49%  426 aa  GSA_ECOLU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-107  49%  426 aa  GSA_ECOHS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::422     e-107  48%  425 aa  GSA_DESAA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   11::424     e-107  52%  432 aa  GSA_CYAP4 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   57::475     e-106  49%  478 aa  GSA_ORYSJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase,
    4::418     e-106  49%  426 aa  GSA_ECOLI RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-106  49%  426 aa  GSA_ECODH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-106  49%  426 aa  GSA_ECOBW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   13::428     e-106  49%  433 aa  GSA_CYAP7 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::423     e-106  49%  429 aa  GSA2_BACHD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    6::424     e-106  49%  428 aa  GSA1_GEOTN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    4::418     e-106  48%  432 aa  GSA_HAES1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::421     e-106  49%  431 aa  GSA_CHLPB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-106  49%  426 aa  GSA_ECOSM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::419     e-106  48%  429 aa  GSA2_BACA2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    1::423     e-106  55%  431 aa  GSA_MYXXD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::419     e-106  47%  427 aa  GSA1_CLOPH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   57::475     e-106  51%  478 aa  GSA_TOBAC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase,
    7::426     e-106  50%  431 aa  GSA_CHLL2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::422     e-106  49%  429 aa  GSA_PSEMY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::423     e-106  48%  427 aa  GSA_SHEAM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-106  49%  426 aa  GSA_ESCF3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-106  48%  428 aa  GSA_AERHH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::422     e-106  47%  426 aa  GSA_ACTPJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::423     e-106  47%  431 aa  GSA2_ANOFW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    4::418     e-106  49%  426 aa  GSA_YERE8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   12::428     e-106  48%  433 aa  GSA_SYNY3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-106  49%  426 aa  GSA_SHIFL RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-106  49%  426 aa  GSA_SHIF8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   12::430     e-106  48%  433 aa  GSA_MICAN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-106  50%  426 aa  GSA_ERWT9 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::422     e-106  47%  426 aa  GSA_ACTP7 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::420     e-106  47%  425 aa  GSA_THIDA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    8::419     e-106  48%  425 aa  GSA_CLOPE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::418     e-106  48%  427 aa  GSA_CLOBB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::419     e-105  46%  444 aa  GSA_XYLFA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   11::422     e-105  51%  432 aa  GSA_TRIEI RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-105  49%  426 aa  GSA_SHIBS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-105  49%  426 aa  GSA_SHIB3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-105  49%  426 aa  GSA_SALTI RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-105  49%  426 aa  GSA_SALSV RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-105  49%  426 aa  GSA_SALDC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-105  49%  427 aa  GSA_PASMU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::418     e-105  48%  427 aa  GSA_CLOBA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    5::418     e-105  48%  424 aa  GSA_AZOSB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-105  49%  426 aa  GSA_SHIDS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    3::421     e-105  48%  425 aa  GSA_PSYIN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-105  47%  432 aa  GSA_HAES2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::419     e-105  48%  428 aa  GSA_GEOLS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::421     e-105  52%  428 aa  GSA_FLAPJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::416     e-105  49%  429 aa  GSA_ALHEH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::424     e-105  49%  428 aa  GSA1_GEOKA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    4::418     e-105  49%  426 aa  GSA_PECCP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::423     e-105  47%  427 aa  GSA_GEOUR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::419     e-105  46%  422 aa  GSA_CLOAB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   11::426     e-105  50%  431 aa  GSA_CHLCH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   12::431     e-105  46%  440 aa  GSA_ALKMQ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    5::426     e-105  48%  432 aa  GSA_ACIBC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   51::469     e-105  50%  472 aa  GSA2_ARATH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    4::422     e-105  48%  426 aa  GSA_SODGM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::421     e-105  50%  431 aa  GSA_PELLD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::415     e-105  48%  427 aa  GSA_NEIM0 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    8::419     e-105  48%  425 aa  GSA_CLOP1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    5::426     e-105  48%  432 aa  GSA_ACIBY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    5::426     e-105  48%  432 aa  GSA_ACIBT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    5::426     e-105  48%  432 aa  GSA_ACIBS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    5::426     e-105  48%  432 aa  GSA_ACIB5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    5::426     e-105  48%  432 aa  GSA_ACIB3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-105  48%  426 aa  GSA_SALA4 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::421     e-105  49%  431 aa  GSA_PROA2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-105  49%  431 aa  GSA_VIBVY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-105  49%  431 aa  GSA_VIBVU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   16::433     e-105  47%  438 aa  GSA_SYNS3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-105  50%  426 aa  GSA_METCA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    3::419     e-105  46%  422 aa  GSA_CLOK5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    3::419     e-105  46%  422 aa  GSA_CLOK1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::403     e-105  49%  427 aa  GSA_BURPP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-105  48%  426 aa  GSA_AKKM8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::422     e-105  47%  426 aa  GSA_ACTP2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   16::429     e-105  47%  437 aa  GSA_THEEB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-104  49%  432 aa  GSA_VIBCM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-104  49%  432 aa  GSA_VIBCH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-104  49%  432 aa  GSA_VIBC3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   10::424     e-104  50%  431 aa  GSA_SYNWW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::423     e-104  47%  428 aa  GSA_SYNPX RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   11::423     e-104  46%  427 aa  GSA1_STAES RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   11::423     e-104  46%  427 aa  GSA1_STAEQ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    3::426     e-104  49%  434 aa  GSA_PELTS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::423     e-104  47%  428 aa  GSA1_STAAB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   11::428     e-104  47%  433 aa  GSA_SYNPW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    3::422     e-104  47%  426 aa  GSA_PSEHT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::415     e-104  47%  428 aa  GSA_METFK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::426     e-104  49%  431 aa  GSA_CHLTE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-104  48%  426 aa  GSA_ALTMD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-104  48%  431 aa  GSA_VIBPA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    5::415     e-104  52%  423 aa  GSA_SACD2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::419     e-104  46%  427 aa  GSA_GEOBB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    8::421     e-104  47%  434 aa  GSA2_EXISA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    6::423     e-104  47%  428 aa  GSA1_STAAU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    6::423     e-104  47%  428 aa  GSA1_STAAT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    6::423     e-104  47%  428 aa  GSA1_STAAN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    6::423     e-104  47%  428 aa  GSA1_STAAM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    6::423     e-104  47%  428 aa  GSA1_STAAE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    6::423     e-104  47%  428 aa  GSA1_STAAC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    6::423     e-104  47%  428 aa  GSA1_STAA9 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    6::423     e-104  47%  428 aa  GSA1_STAA8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    6::423     e-104  47%  428 aa  GSA1_STAA3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    6::423     e-104  47%  428 aa  GSA1_STAA2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    6::423     e-104  47%  428 aa  GSA1_STAA1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    9::423     e-104  48%  432 aa  GSA_PROM4 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    5::416     e-104  47%  435 aa  GSA_NITEU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::415     e-104  48%  427 aa  GSA_NEIMF RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::417     e-104  50%  430 aa  GSA_DESPS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    2::417     e-104  47%  426 aa  GSA_BURP8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   11::426     e-104  48%  432 aa  GSA_ACIAD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::404     e-104  49%  429 aa  GSA_SHEPW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::423     e-104  47%  428 aa  GSA1_STAAW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    6::423     e-104  47%  428 aa  GSA1_STAAS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    6::423     e-104  47%  428 aa  GSA1_STAAR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    1::404     e-104  48%  430 aa  GSA_ANAD2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    5::425     e-104  46%  433 aa  GSA_PSYCK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::419     e-104  47%  428 aa  GSA_PELPD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::404     e-104  48%  430 aa  GSA_ANASK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::407     e-103  48%  429 aa  GSA_SHEPA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    8::417     e-103  48%  427 aa  GSA_BORPE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    5::407     e-103  54%  430 aa  GSA_ACIF5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    5::407     e-103  54%  430 aa  GSA_ACIF2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::424     e-103  49%  431 aa  GSA1_ANOFW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    1::423     e-103  46%  433 aa  GSA_SYNFM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::407     e-103  48%  429 aa  GSA_SHEHH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::425     e-103  52%  430 aa  GSA_NITOC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    8::417     e-103  48%  427 aa  GSA_BORBR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-103  48%  431 aa  GSA_VIBHB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   10::426     e-103  47%  433 aa  GSA_PROMA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::422     e-103  48%  428 aa  GSA_PROM1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::423     e-103  51%  429 aa  GSA_CHRSD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::422     e-103  50%  426 aa  GSA_ALCBS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   11::419     e-103  49%  430 aa  GSA2_BACSK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    4::426     e-103  47%  430 aa  GSA_RALEH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    3::425     e-103  49%  434 aa  GSA_POLSQ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    8::420     e-103  47%  430 aa  GSA2_LYSSC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    6::423     e-103  47%  428 aa  GSA_SYNSC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   10::426     e-103  47%  432 aa  GSA_PROMT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    8::418     e-103  49%  427 aa  GSA_TERTT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::412     e-103  48%  428 aa  GSA_DESAH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::419     e-103  46%  429 aa  GSA1_LISIN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    6::423     e-103  46%  428 aa  GSA_SYNS9 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::425     e-103  45%  432 aa  GSA_SYNAS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    5::423     e-103  47%  427 aa  GSA_NITSB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::426     e-103  49%  432 aa  GSA_CHLT3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    2::418     e-103  46%  429 aa  GSA1_STACT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    6::424     e-103  48%  432 aa  GSA1_BACWK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    8::417     e-103  47%  427 aa  GSA_BORPA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   13::433     e-103  47%  438 aa  GSA_SALRD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    8::421     e-103  46%  430 aa  GSA2_BACP2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   11::424     e-102  47%  432 aa  GSA_SYNP2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   71::478     e-102  51%  481 aa  GSA_SOLLC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase,
    6::429     e-102  48%  433 aa  GSA_METI4 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::409     e-102  48%  429 aa  GSA2_BACCR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    7::409     e-102  48%  429 aa  GSA2_BACC4 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   10::427     e-102  47%  433 aa  GSA_PROM0 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::426     e-102  48%  431 aa  GSA_CHLP8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::409     e-102  48%  429 aa  GSA2_BACCQ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    7::409     e-102  48%  429 aa  GSA2_BACC7 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    7::409     e-102  48%  428 aa  GSA1_BACC2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    8::426     e-102  48%  434 aa  GSA1_BACAC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   10::427     e-102  47%  433 aa  GSA_PROMP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::424     e-102  45%  430 aa  GSA_NATTJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    8::426     e-102  48%  434 aa  GSA1_BACHK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    8::426     e-102  48%  434 aa  GSA1_BACAN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    8::426     e-102  48%  434 aa  GSA1_BACAA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    4::415     e-102  47%  427 aa  GSA_NEIMB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::409     e-102  48%  429 aa  GSA2_BACHK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    7::409     e-102  48%  429 aa  GSA2_BACCZ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    7::409     e-102  48%  429 aa  GSA2_BACC3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    8::426     e-102  48%  434 aa  GSA2_BACC2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    7::409     e-102  48%  429 aa  GSA2_BACC0 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    7::409     e-102  48%  429 aa  GSA2_BACAH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    6::424     e-102  48%  432 aa  GSA1_BACCR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    6::424     e-102  48%  432 aa  GSA1_BACC4 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    8::426     e-102  48%  434 aa  GSA1_BACC3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    8::426     e-102  48%  434 aa  GSA1_BACAH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    7::421     e-102  49%  431 aa  GSA_PROVI RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::422     e-102  46%  429 aa  GSA_GRAFK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::409     e-102  48%  429 aa  GSA2_BACC1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    6::424     e-102  48%  432 aa  GSA1_BACCZ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    8::426     e-102  48%  434 aa  GSA1_BACC0 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    4::419     e-102  47%  427 aa  GSA_COLP3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::424     e-102  49%  431 aa  GSA1_BACP2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    8::426     e-102  50%  432 aa  GSA1_BACCN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    7::429     e-101  47%  433 aa  GSA_RALPJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::413     e-101  47%  430 aa  GSA_RALME RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::423     e-101  45%  427 aa  GSA2_STAS1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    7::409     e-101  48%  429 aa  GSA2_BACAN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    7::409     e-101  48%  429 aa  GSA2_BACAC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    7::409     e-101  48%  429 aa  GSA2_BACAA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    8::426     e-101  48%  434 aa  GSA1_BACCQ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    8::426     e-101  48%  434 aa  GSA1_BACC7 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    8::426     e-101  48%  434 aa  GSA1_BACC1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   10::427     e-101  47%  433 aa  GSA_PROMS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::414     e-101  49%  426 aa  GSA_NEIG1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   18::419     e-101  46%  429 aa  GSA1_LISW6 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   10::423     e-101  49%  429 aa  GSA1_BACA2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    1::424     e-101  49%  432 aa  GSA1_BACLD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    4::418     e-101  48%  431 aa  GSA_VIBF1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    8::422     e-101  47%  432 aa  GSA_PHOPR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::420     e-101  48%  434 aa  GSA1_BACSK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    1::419     e-101  45%  431 aa  GSA_LACRJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::419     e-101  45%  431 aa  GSA_LACRD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   16::433     e-101  47%  438 aa  GSA_DELAS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    8::417     e-101  50%  427 aa  GSA_BORPD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-101  48%  431 aa  GSA_VIBFM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::411     e-101  47%  429 aa  GSA_HERA2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::415     e-101  47%  427 aa  GSA_NEIMA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::414     e-101  48%  426 aa  GSA_NEIG2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::419     e-101  46%  422 aa  GSA_CLOTE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   18::419     e-101  46%  429 aa  GSA1_LISMF RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   18::419     e-101  46%  429 aa  GSA1_LISMC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    4::407     e-101  48%  428 aa  GSA_SHEWM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    5::417     e-101  45%  432 aa  GSA_JANMA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::428     e-101  47%  432 aa  GSA1_EXISA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   11::409     e-100  46%  429 aa  GSA2_BACCN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   18::419     e-100  46%  429 aa  GSA1_LISMO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    5::408     e-100  48%  427 aa  GSA_DECAR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::409     e-100  47%  429 aa  GSA2_BACWK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   10::426     e-100  46%  434 aa  GSA_PROM9 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::421     e-100  45%  431 aa  GSA_CLOB8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   18::419     e-100  46%  429 aa  GSA2_LISMH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   10::427     e-100  46%  433 aa  GSA_PROM5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    5::418     e-100  46%  427 aa  GSA_NITEC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::428     e-100  47%  432 aa  GSA1_EXIS2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    5::425     e-100  45%  433 aa  GSA_PSYA2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   10::419     e-100  45%  427 aa  GSA_GEOSF RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    8::416     e-100  47%  427 aa  GSA_BORA1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::414     e-100  46%  429 aa  GSA_XANOR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::414     e-100  46%  429 aa  GSA_XANOP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::414     e-100  46%  429 aa  GSA_XANOM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::423     e-100  46%  431 aa  GSA_VIBSL RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::426     e-100  46%  429 aa  GSA_RALEJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     e-100  46%  428 aa  GSA_HAMD5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   11::424     e-100  46%  432 aa  GSA_ACAM1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   17::418     1e-99  48%  435 aa  GSA_GEMAT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::425     2e-99  48%  433 aa  GSA_POLNS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::413     2e-99  46%  430 aa  GSA_CUPTR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::423     2e-99  45%  434 aa  GSA_CLOCE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::404     2e-99  48%  426 aa  GSA_THICR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::419     2e-99  46%  427 aa  GSA_GEOMG RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   10::423     3e-99  48%  436 aa  GSA_METPP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::421     3e-99  48%  428 aa  GSA_FLAJ1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::424     3e-99  49%  434 aa  GSA_ROSCS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::419     3e-99  46%  427 aa  GSA_GEOSL RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   10::422     3e-99  47%  428 aa  GSA2_OCEIH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   10::427     4e-99  46%  433 aa  GSA_PROM2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::426     4e-99  48%  431 aa  GSA_CHLPD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    5::422     6e-99  45%  434 aa  GSA_PSYWF RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::425     8e-99  46%  430 aa  GSA_SULNB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::415     8e-99  47%  425 aa  GSA_NITMU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::417     8e-99  45%  422 aa  GSA_DESDG RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   11::423     8e-99  48%  429 aa  GSAB_BACSU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    7::429     2e-98  46%  433 aa  GSA_RALSO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    8::419     2e-98  46%  425 aa  GSA_CLOPS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::424     3e-98  45%  427 aa  GSA_ROSS1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   10::423     4e-98  45%  436 aa  GSA2_EXIS2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    1::414     6e-98  46%  429 aa  GSA_STRMK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   18::434     6e-98  46%  442 aa  GSA_POLNA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    5::422     6e-98  44%  428 aa  GSA_HERAR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::403     6e-98  47%  427 aa  GSA_BURTA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::412     6e-98  46%  427 aa  GSA_BURCJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::424     8e-98  46%  429 aa  GSA1_LYSSC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    1::424     8e-98  47%  437 aa  GSA1_BACHD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    4::418     1e-97  47%  431 aa  GSA_ALISL RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     1e-97  44%  429 aa  GSA_LEGPH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::404     1e-97  46%  430 aa  GSA_ANADE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::415     2e-97  43%  420 aa  GSA_NAUPA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::423     2e-97  44%  427 aa  GSA1_MACCJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   42::455     2e-97  45%  463 aa  GSA_CHLRE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase,
    5::404     2e-97  49%  427 aa  GSA_AZOSE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::421     3e-97  46%  433 aa  GSA_FRAP2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::421     3e-97  46%  428 aa  GSA2_MACCJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    3::422     4e-97  45%  425 aa  GSA_OPITP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::421     4e-97  46%  431 aa  GSA_FRATT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::421     4e-97  46%  431 aa  GSA_FRAT1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   12::424     4e-97  47%  434 aa  GSA_DIAST RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   11::424     5e-97  49%  433 aa  GSA_MAGSM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     5e-97  44%  429 aa  GSA_LEGPC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::403     5e-97  45%  425 aa  GSA_LARHH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::425     7e-97  45%  431 aa  GSA_WOLSU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   12::424     7e-97  47%  434 aa  GSA_ACISJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::414     9e-97  45%  429 aa  GSA_STRM5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::418     9e-97  44%  428 aa  GSA_LEGPA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    2::408     1e-96  48%  423 aa  GSA_THEAB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::421     1e-96  46%  433 aa  GSA_FRATN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    5::420     1e-96  46%  435 aa  GSA_COXB2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::421     2e-96  46%  431 aa  GSA_FRATW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::423     2e-96  43%  426 aa  GSA2_CLOPH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    4::418     2e-96  45%  429 aa  GSA_LEGPL RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::412     3e-96  45%  427 aa  GSA_BURS3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::419     4e-96  45%  427 aa  GSA_DESOH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   12::429     4e-96  45%  437 aa  GSA_ACIAC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::412     5e-96  45%  427 aa  GSA_BURA4 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   16::436     6e-96  45%  439 aa  GSA_RHOBA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::421     6e-96  46%  431 aa  GSA_FRATM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::412     6e-96  45%  427 aa  GSA_BURVG RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::412     6e-96  45%  427 aa  GSA_BURCM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::421     1e-95  46%  431 aa  GSA_FRATO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::421     1e-95  46%  431 aa  GSA_FRATF RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::425     1e-95  47%  430 aa  GSA_CYTH3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    5::420     1e-95  46%  435 aa  GSA_COXBN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    5::420     1e-95  46%  435 aa  GSA_COXB1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::420     1e-95  46%  429 aa  GSA2_STAES RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    6::420     1e-95  46%  429 aa  GSA2_STAEQ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    7::421     1e-95  46%  431 aa  GSA_FRATH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::420     2e-95  46%  437 aa  GSA_LEPCP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::403     2e-95  49%  427 aa  GSA_BURP6 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::424     3e-95  46%  428 aa  GSA1_BREBN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    5::420     4e-95  45%  435 aa  GSA_COXBU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    5::420     4e-95  45%  435 aa  GSA_COXBR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::412     4e-95  45%  427 aa  GSA_BURM1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::412     4e-95  45%  427 aa  GSA_BURCC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::414     5e-95  44%  426 aa  GSA_DICNV RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::424     5e-95  47%  429 aa  GSA1_STAS1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    4::403     1e-94  49%  427 aa  GSA_BURM9 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    2::409     1e-94  43%  423 aa  GSA_THEM4 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   10::419     1e-94  45%  430 aa  GSA_SULDN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::403     1e-94  49%  427 aa  GSA_BURPS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::403     1e-94  49%  427 aa  GSA_BURP1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::403     1e-94  49%  427 aa  GSA_BURMS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::403     1e-94  49%  427 aa  GSA_BURMA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::403     1e-94  49%  427 aa  GSA_BURM7 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::412     1e-94  44%  427 aa  GSA_BURCH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::412     1e-94  44%  427 aa  GSA_BURCA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::415     2e-94  45%  427 aa  GSA_CALS8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::403     2e-94  49%  427 aa  GSA_BURP0 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::414     4e-94  45%  429 aa  GSA_XANAC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::422     4e-94  44%  432 aa  GSA_STRSV RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    8::421     4e-94  46%  425 aa  GSA_CAMLR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    5::407     6e-94  50%  423 aa  GSA_DESVH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::421     6e-94  45%  432 aa  GSA2_LISIN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    9::421     1e-93  47%  438 aa  GSA_STRCO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::423     1e-93  45%  426 aa  GSA_ARCB4 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::419     1e-93  45%  426 aa  GSA_ANATD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::421     1e-93  45%  432 aa  GSA1_LISMH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    5::407     1e-93  49%  423 aa  GSA_DESVV RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::408     2e-93  46%  429 aa  GSA_XANCH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   10::422     2e-93  43%  430 aa  GSA_HELPG RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   10::424     3e-93  47%  424 aa  GSA_METAC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::421     3e-93  45%  432 aa  GSA2_LISMC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    1::421     4e-93  45%  432 aa  GSA2_LISMF RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    1::421     5e-93  45%  432 aa  GSA2_LISW6 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    1::421     5e-93  45%  432 aa  GSA2_LISMO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    1::410     6e-93  45%  429 aa  GSA_XANC5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   10::422     6e-93  43%  430 aa  GSA_HELPH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    5::407     6e-93  48%  425 aa  GSA_DESVM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::411     8e-93  48%  435 aa  GSA_STRGG RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::418     8e-93  47%  418 aa  GSA_ARCFU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   10::422     1e-92  43%  430 aa  GSA_HELP2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   13::423     1e-92  43%  427 aa  GSA2_STAHJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    1::408     1e-92  48%  429 aa  GSA_XANCP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::408     1e-92  48%  429 aa  GSA_XANCB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::408     1e-92  48%  429 aa  GSA_XANC8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   10::422     3e-92  42%  430 aa  GSA_HELPJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   11::434     3e-92  46%  438 aa  GSA_CHLAD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    8::418     4e-92  43%  426 aa  GSA_METJA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   10::424     7e-92  46%  424 aa  GSA_METMA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    8::423     9e-92  46%  449 aa  GSA_FRASN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   10::422     1e-91  42%  430 aa  GSA_HELAH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   24::433     2e-91  53%  445 aa  GSA_NOCSJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   22::422     2e-91  46%  451 aa  GSA_MYCS2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   10::422     2e-91  42%  430 aa  GSA_HELPY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    8::412     6e-91  44%  436 aa  GSA_RHOFD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   10::422     6e-91  42%  430 aa  GSA_HELPS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    9::421     1e-90  45%  438 aa  GSA_STRAW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::405     2e-90  45%  429 aa  GSA1_STAHJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   18::424     2e-90  44%  442 aa  GSA_POLSJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   10::424     2e-90  46%  424 aa  GSA_METBF RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::424     2e-90  45%  432 aa  GSA1_OCEIH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    3::416     3e-90  48%  441 aa  GSA_PROFF RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   10::421     4e-90  44%  434 aa  GSA_FUSNN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::419     4e-90  43%  423 aa  GSA_CAMFF RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::405     4e-90  46%  429 aa  GSA2_STACT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    6::420     4e-90  44%  429 aa  GSA2_STAAW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    6::420     4e-90  44%  429 aa  GSA2_STAAS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    6::420     4e-90  44%  429 aa  GSA2_STAAN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    6::420     4e-90  44%  429 aa  GSA2_STAAM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    6::420     4e-90  44%  429 aa  GSA2_STAA9 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    6::420     4e-90  44%  429 aa  GSA2_STAA2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    6::420     4e-90  44%  429 aa  GSA2_STAA1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    6::420     5e-90  44%  429 aa  GSA2_STAAT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    6::420     5e-90  44%  429 aa  GSA2_STAAR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    6::420     5e-90  44%  429 aa  GSA2_STAAE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    6::420     5e-90  44%  429 aa  GSA2_STAAC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    6::420     5e-90  44%  429 aa  GSA2_STAAB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    6::420     5e-90  44%  429 aa  GSA2_STAA8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    6::420     5e-90  44%  429 aa  GSA2_STAA3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
   14::424     6e-90  41%  427 aa  GSA_METVS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::425     8e-90  44%  439 aa  GSA_ARTAT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   16::422     1e-89  46%  429 aa  GSA_METTP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   12::424     1e-89  47%  447 aa  GSA_LEIXX RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    2::424     1e-89  47%  432 aa  GSA_PARUW RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   10::424     1e-89  41%  427 aa  GSA_METM5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::420     1e-89  44%  424 aa  GSA_CAMJR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::415     2e-89  48%  432 aa  GSA_MYCVP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   11::419     2e-89  46%  438 aa  GSA_MYCSS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   11::419     2e-89  46%  438 aa  GSA_MYCSK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   11::419     2e-89  46%  438 aa  GSA_MYCSJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   10::424     3e-89  41%  427 aa  GSA_METMP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::420     4e-89  44%  424 aa  GSA_CAMJJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::420     4e-89  44%  424 aa  GSA_CAMJ8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   10::424     7e-89  41%  427 aa  GSA_METM6 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   10::424     9e-89  40%  427 aa  GSA_METM7 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   13::425     9e-89  41%  432 aa  GSA_META3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   11::430     9e-89  48%  443 aa  GSA_CHLSY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   11::430     9e-89  48%  443 aa  GSA_CHLAA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::416     1e-88  47%  422 aa  GSA_METBU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::420     1e-88  44%  424 aa  GSA_CAMJE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::421     1e-88  41%  429 aa  GSA_CAMC5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::420     3e-88  44%  424 aa  GSA_CAMJD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    8::425     4e-88  45%  433 aa  GSA_SYMTH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::429     4e-88  44%  447 aa  GSA_ARTS2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::418     5e-88  42%  423 aa  GSA_METST RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::421     5e-88  41%  427 aa  GSA_CAMC1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    9::420     6e-88  45%  430 aa  GSA_CALMQ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   14::422     8e-88  45%  443 aa  GSA_MYCUA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::415     8e-88  48%  432 aa  GSA_MYCGI RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    8::419     1e-87  50%  423 aa  GSA_IGNH4 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   19::416     1e-87  48%  448 aa  GSA_SALTO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   26::419     2e-87  49%  445 aa  GSA_NOCFA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    3::421     2e-87  44%  439 aa  GSA_KOCRD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   12::429     2e-87  43%  437 aa  GSA_VEREI RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   21::430     2e-87  47%  442 aa  GSA_COREF RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::422     2e-87  43%  430 aa  GSA_CORDI RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    9::418     2e-87  46%  437 aa  GSA_ACIC1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    3::415     9e-87  43%  420 aa  GSA_METTH RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::418     9e-87  46%  430 aa  GSA_LAWIP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::414     2e-86  45%  430 aa  GSA_THEFY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   17::431     2e-86  48%  446 aa  GSA_MYCLE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   17::431     2e-86  48%  446 aa  GSA_MYCLB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   14::422     3e-86  48%  443 aa  GSA_MYCMM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::429     4e-86  43%  443 aa  GSA_ARTCA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::421     7e-86  46%  426 aa  GSA_HYPBU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::426     1e-85  46%  444 aa  GSA_SALAI RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::425     2e-85  48%  430 aa  GSA_METKA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    3::419     5e-85  45%  421 aa  GSA_THEAC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    3::414     5e-85  45%  423 aa  GSA_PYRAR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   15::415     1e-84  46%  441 aa  GSA_RHOSR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    3::411     1e-84  45%  423 aa  GSA_PYRAE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    3::413     1e-84  46%  415 aa  GSA_METMJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   21::425     2e-84  47%  445 aa  GSA_MYCA1 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   10::417     2e-84  42%  435 aa  GSA_HELHP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   30::430     2e-84  45%  447 aa  GSA_CORU7 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   20::424     3e-84  46%  448 aa  GSA_KINRD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   21::425     4e-84  47%  445 aa  GSA_MYCPA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    2::408     4e-84  47%  420 aa  GSA_METPE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   15::415     5e-84  48%  441 aa  GSA_RHOOB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    3::415     7e-84  42%  423 aa  GSA_METS3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   19::424     2e-83  43%  443 aa  GSA_CORJK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    3::414     4e-83  44%  424 aa  GSA_PYRIL RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::414     6e-83  41%  450 aa  GSA_CAMHC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    3::414     1e-82  44%  424 aa  GSA_THENV RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::421     1e-82  46%  433 aa  GSA_RENSM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    8::417     1e-82  42%  436 aa  GSA_PROAC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    3::410     3e-82  43%  418 aa  GSA_SULSO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::417     4e-82  40%  420 aa  GSA_PICTO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    3::416     6e-82  44%  420 aa  GSA_THEVO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    8::418     6e-82  43%  452 aa  GSA_FRASC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   16::428     8e-82  46%  446 aa  GSA_MYCA9 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::406     2e-81  50%  432 aa  GSA_RHOE4 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   21::424     5e-81  43%  444 aa  GSA_CORA7 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::422     9e-81  43%  426 aa  GSA_UNCMA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::448     4e-80  49%  466 aa  GSA_TROWT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::448     4e-80  49%  466 aa  GSA_TROW8 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   18::436     4e-80  48%  462 aa  GSA_MYCTU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   18::436     4e-80  48%  462 aa  GSA_MYCTA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   18::436     4e-80  48%  462 aa  GSA_MYCBT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   18::436     4e-80  48%  462 aa  GSA_MYCBP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   18::436     4e-80  48%  462 aa  GSA_MYCBO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   12::419     1e-79  42%  437 aa  GSA_CORGB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   16::416     2e-79  46%  448 aa  GSA_SACEN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   18::415     2e-79  44%  441 aa  GSA_PYRCJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   11::422     2e-79  41%  426 aa  GSA_SULIY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   11::422     2e-79  41%  426 aa  GSA_SULIN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   11::422     2e-79  41%  426 aa  GSA_SULIL RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   11::422     2e-79  41%  426 aa  GSA_SULIK RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   11::422     3e-79  41%  426 aa  GSA_SULIM RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   11::422     3e-79  41%  426 aa  GSA_SULIA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    3::402     5e-79  44%  413 aa  GSA_METB6 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   12::419     9e-79  41%  437 aa  GSA_CORGL RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::419     4e-78  39%  424 aa  GSA_NITMS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    5::405     6e-78  43%  417 aa  GSA_METHJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    7::423     1e-77  40%  429 aa  GSA_AERPE RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::413     3e-77  41%  417 aa  GSA_METS5 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   10::425     5e-77  41%  454 aa  GSA_FRAAA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    3::406     1e-76  45%  412 aa  GSA_METLZ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    2::423     9e-76  40%  435 aa  GSA_WIGBR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::413     2e-75  43%  420 aa  GSA_SULAC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    9::420     6e-75  42%  427 aa  GSA_SULTO RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   13::417     6e-73  40%  440 aa  GSA_CHLPN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    3::423     6e-72  38%  425 aa  GSA_LEPBP RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    3::423     6e-72  38%  425 aa  GSA_LEPBA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   20::440     2e-71  38%  443 aa  GSA_LEPIC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   20::440     4e-71  38%  443 aa  GSA_LEPIN RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::417     1e-70  36%  423 aa  GSA_DESDA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::438     3e-70  39%  455 aa  GSA_CLAM3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    4::438     7e-70  39%  455 aa  GSA_CLAMS RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   18::437     3e-69  39%  441 aa  GSA_LEPBL RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   18::437     3e-69  39%  441 aa  GSA_LEPBJ RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    5::415     2e-68  37%  422 aa  GSA_CHLTB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    5::415     2e-68  37%  422 aa  GSA_CHLT2 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::424     9e-68  35%  426 aa  GSA_BDEBA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    5::415     2e-67  37%  422 aa  GSA_CHLTA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::446     5e-67  43%  446 aa  GSA_HALWD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    5::415     6e-67  37%  422 aa  GSA_CHLTR RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::445     3e-66  41%  445 aa  GSA_HALLT RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   32::445     1e-65  44%  445 aa  GSA_HALMA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    5::415     2e-65  35%  422 aa  GSA_CHLMU RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    6::446     4e-64  43%  446 aa  GSA_NATPD RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   11::430     1e-63  35%  437 aa  GSA_CHLFF RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   11::430     7e-63  35%  437 aa  GSA_CHLCV RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   11::430     8e-59  33%  437 aa  GSA_CHLAB RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    3::417     1e-58  38%  421 aa  GSA1_CENSY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
    1::445     2e-58  40%  445 aa  GSA_HALSA RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
    1::445     2e-58  40%  445 aa  GSA_HALS3 RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;  
   14::428     2e-39  34%  434 aa  GSA2_CENSY RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase
 1528::1915    1e-28  31% 3971 aa  MYCA_BACSU RecName: Full=Mycosubtilin synthetase subunit A;       
   24::277     1e-25  35%  375 aa  ARGD_ARCFU RecName: Full=Acetylornithine aminotransferase;       
   10::224     6e-25  38%  364 aa  ARGD_PYRAB RecName: Full=Acetylornithine/acetyl-lysine
   14::230     1e-24  36%  387 aa  ARGD_SULTO RecName: Full=Acetylornithine/acetyl-lysine
   22::240     2e-24  38%  390 aa  ARGD_METTH RecName: Full=Acetylornithine aminotransferase;       
   19::279     2e-24  35%  389 aa  ARGD_METKA RecName: Full=Acetylornithine aminotransferase;       
   10::224     8e-24  40%  366 aa  ARGD_PYRFU RecName: Full=Acetylornithine/acetyl-lysine
   10::224     2e-23  35%  366 aa  ARGD_PYRHO RecName: Full=Acetylornithine/acetyl-lysine
   29::274     2e-23  35%  445 aa  YKAB_BACPF RecName: Full=Uncharacterized aminotransferase in katA
   28::315     2e-23  31%  436 aa  GABT_BACSU RecName: Full=Probable 4-aminobutyrate aminotransferase;
   31::288     2e-23  40%  395 aa  ARGD_THET8 RecName: Full=Acetylornithine/acetyl-lysine
   31::288     2e-23  40%  395 aa  ARGD_THET2 RecName: Full=Acetylornithine/acetyl-lysine
   24::397     5e-23  31%  435 aa  YC7B_SCHPO RecName: Full=Uncharacterized aminotransferase C417.11c;
   24::373     9e-23  30%  426 aa  GABT_ECOLI RecName: Full=4-aminobutyrate aminotransferase;       
   10::224     9e-23  43%  362 aa  ARGD_PYRKO RecName: Full=Acetylornithine aminotransferase;       
   15::232     3e-22  33%  383 aa  ARGD_PYRAE RecName: Full=Acetylornithine/acetyl-lysine
   25::360     4e-21  30%  421 aa  PUUE_ECOLI RecName: Full=4-aminobutyrate aminotransferase;       
   19::222     5e-21  45%  402 aa  ARGD_STRCO RecName: Full=Acetylornithine aminotransferase;       
   19::280     5e-21  40%  400 aa  ARGD_STRCL RecName: Full=Acetylornithine aminotransferase;       
    2::328     1e-20  38%  449 aa  GABT_MYCTU RecName: Full=4-aminobutyrate aminotransferase;       
    2::328     1e-20  38%  449 aa  GABT_MYCBO RecName: Full=4-aminobutyrate aminotransferase;       
    8::281     2e-20  40%  396 aa  ARGD2_BORPE RecName: Full=Acetylornithine aminotransferase 2;      
    8::281     2e-20  40%  396 aa  ARGD2_BORPA RecName: Full=Acetylornithine aminotransferase 2;      
    8::281     2e-20  40%  396 aa  ARGD2_BORBR RecName: Full=Acetylornithine aminotransferase 2;      
   22::228     7e-20  39%  408 aa  ASTC_SALNS RecName: Full=Succinylornithine transaminase;       
   28::248     7e-20  33%  403 aa  ARGD_VIBVY RecName: Full=Acetylornithine aminotransferase;       
   28::248     7e-20  33%  403 aa  ARGD_VIBVU RecName: Full=Acetylornithine aminotransferase;       
    5::211     9e-20  35%  377 aa  ARGD_LACLA RecName: Full=Acetylornithine aminotransferase;       
    5::231     9e-20  34%  385 aa  ARGD_BACSU RecName: Full=Acetylornithine aminotransferase;       
   15::329     9e-20  29%  384 aa  ARGD_BACHD RecName: Full=Acetylornithine aminotransferase;       
   22::228     1e-19  39%  408 aa  ASTC_SALTY RecName: Full=Succinylornithine transaminase;       
   19::359     1e-19  34%  401 aa  ARGD_MYXXA RecName: Full=Acetylornithine aminotransferase;       
   22::228     2e-19  37%  406 aa  ASTC_ECOSE RecName: Full=Succinylornithine transaminase;       
   22::228     2e-19  37%  406 aa  ASTC_ECOLI RecName: Full=Succinylornithine transaminase;       
   22::228     2e-19  37%  406 aa  ASTC_ECOLC RecName: Full=Succinylornithine transaminase;       
   22::228     2e-19  37%  406 aa  ASTC_ECOHS RecName: Full=Succinylornithine transaminase;       
   22::228     2e-19  37%  406 aa  ASTC_ECODH RecName: Full=Succinylornithine transaminase;       
   22::228     2e-19  37%  406 aa  ASTC_ECOBW RecName: Full=Succinylornithine transaminase;       
   22::228     2e-19  37%  406 aa  ASTC_ECO8A RecName: Full=Succinylornithine transaminase;       
   22::228     2e-19  37%  406 aa  ASTC_ECO24 RecName: Full=Succinylornithine transaminase;       
   28::248     2e-19  34%  403 aa  ARGD_VIBPA RecName: Full=Acetylornithine aminotransferase;       
   23::319     2e-19  32%  398 aa  ARGD2_BRAJA RecName: Full=Acetylornithine aminotransferase 2;      
   22::228     2e-19  39%  408 aa  ASTC_SALPC RecName: Full=Succinylornithine transaminase;       
   22::228     2e-19  39%  408 aa  ASTC_SALPB RecName: Full=Succinylornithine transaminase;       
   22::228     2e-19  39%  408 aa  ASTC_SALHS RecName: Full=Succinylornithine transaminase;       
   22::228     2e-19  39%  408 aa  ASTC_SALG2 RecName: Full=Succinylornithine transaminase;       
   22::228     2e-19  39%  408 aa  ASTC_SALEP RecName: Full=Succinylornithine transaminase;       
   22::228     2e-19  39%  408 aa  ASTC_SALDC RecName: Full=Succinylornithine transaminase;       
   22::228     2e-19  39%  408 aa  ASTC_SALA4 RecName: Full=Succinylornithine transaminase;       
   17::388     2e-19  27%  393 aa  ARGD_THETN RecName: Full=Acetylornithine aminotransferase;       
   15::231     2e-19  33%  388 aa  ARGD_SULSO RecName: Full=Acetylornithine/acetyl-lysine
   22::228     3e-19  39%  408 aa  ASTC_SALTI RecName: Full=Succinylornithine transaminase;       
   23::333     3e-19  32%  412 aa  ARGD_THEEB RecName: Full=Acetylornithine aminotransferase;       
   22::228     4e-19  38%  408 aa  ASTC_SALPK RecName: Full=Succinylornithine transaminase;       
   22::228     4e-19  38%  408 aa  ASTC_SALPA RecName: Full=Succinylornithine transaminase;       
   16::229     4e-19  38%  391 aa  ARGD_CORGL RecName: Full=Acetylornithine aminotransferase;       
   33::274     5e-19  33%  448 aa  YFZ7_SCHPO RecName: Full=Uncharacterized aminotransferase
   22::228     5e-19  37%  406 aa  ASTC_SHISS RecName: Full=Succinylornithine transaminase;       
   22::228     5e-19  37%  406 aa  ASTC_ESCF3 RecName: Full=Succinylornithine transaminase;       
   22::228     5e-19  37%  406 aa  ASTC_ECOUT RecName: Full=Succinylornithine transaminase;       
   22::228     5e-19  37%  406 aa  ASTC_ECOSM RecName: Full=Succinylornithine transaminase;       
   22::228     5e-19  37%  406 aa  ASTC_ECOL6 RecName: Full=Succinylornithine transaminase;       
   22::228     5e-19  37%  406 aa  ASTC_ECOL5 RecName: Full=Succinylornithine transaminase;       
   22::228     5e-19  37%  406 aa  ASTC_ECOK1 RecName: Full=Succinylornithine transaminase;       
   22::228     5e-19  37%  406 aa  ASTC_ECO81 RecName: Full=Succinylornithine transaminase;       
   22::228     5e-19  37%  406 aa  ASTC_ECO5E RecName: Full=Succinylornithine transaminase;       
   22::228     5e-19  37%  406 aa  ASTC_ECO57 RecName: Full=Succinylornithine transaminase;       
   22::228     5e-19  37%  406 aa  ASTC_ECO45 RecName: Full=Succinylornithine transaminase;       
   12::276     5e-19  33%  376 aa  ARGD_AQUAE RecName: Full=Acetylornithine aminotransferase;       
   22::228     6e-19  38%  408 aa  ASTC_SALCH RecName: Full=Succinylornithine transaminase;       
   23::226     6e-19  40%  403 aa  ARGD_STRAW RecName: Full=Acetylornithine aminotransferase;       
   32::251     8e-19  31%  438 aa  OAT_SCHPO RecName: Full=Probable ornithine aminotransferase;       
   22::228     8e-19  37%  406 aa  ASTC_ECOLU RecName: Full=Succinylornithine transaminase;       
   22::228     8e-19  37%  406 aa  ASTC_ECO7I RecName: Full=Succinylornithine transaminase;       
   22::228     8e-19  37%  406 aa  ASTC_ECO55 RecName: Full=Succinylornithine transaminase;       
   22::228     8e-19  37%  406 aa  ASTC_ECO27 RecName: Full=Succinylornithine transaminase;       
   20::239     8e-19  33%  399 aa  ARGD_RHIME RecName: Full=Acetylornithine aminotransferase;       
   22::228     1e-18  37%  406 aa  ASTC_SHIBS RecName: Full=Succinylornithine transaminase;       
   22::228     1e-18  37%  406 aa  ASTC_SHIB3 RecName: Full=Succinylornithine transaminase;       
   22::228     1e-18  38%  406 aa  ASTC_CITK8 RecName: Full=Succinylornithine transaminase;       
   12::267     1e-18  32%  387 aa  ARGD_LACPL RecName: Full=Acetylornithine aminotransferase;       
   37::274     1e-18  32%  454 aa  OAT_EMENI RecName: Full=Ornithine aminotransferase;       
   53::262     1e-18  36%  431 aa  OAT_DROME RecName: Full=Ornithine aminotransferase, mitochondrial; 
   41::281     1e-18  32%  454 aa  DAT_HAEIN RecName: Full=Diaminobutyrate--2-oxoglutarate
   19::240     2e-18  34%  400 aa  ARGD2_PSESM RecName: Full=Acetylornithine aminotransferase 2;      
   30::249     2e-18  33%  429 aa  ARGD_DEIRA RecName: Full=Acetylornithine/acetyl-lysine
   23::236     2e-18  39%  402 aa  ARGD_COREF RecName: Full=Acetylornithine aminotransferase;       
   19::325     3e-18  29%  385 aa  ARGD_BACST RecName: Full=Acetylornithine aminotransferase;       
   23::231     4e-18  35%  398 aa  OAT_GEOSW RecName: Full=Ornithine aminotransferase;       
   24::243     5e-18  35%  400 aa  ARGD_GLOVI RecName: Full=Acetylornithine aminotransferase;       
   25::227     7e-18  35%  398 aa  ARGD_PASMU RecName: Full=Acetylornithine aminotransferase;       
   23::228     9e-18  30%  394 aa  OAT1_STAS1 RecName: Full=Ornithine aminotransferase 1;       
   27::236     9e-18  38%  414 aa  ASTC_YERE8 RecName: Full=Succinylornithine transaminase;       
   11::332     1e-17  26%  385 aa  ARGD_THEMA RecName: Full=Acetylornithine aminotransferase;       
    5::213     1e-17  33%  229 aa  ARGD_BACAM RecName: Full=Acetylornithine aminotransferase;       
   31::253     2e-17  32%  395 aa  ARGD_METMA RecName: Full=Acetylornithine aminotransferase;       
   19::246     2e-17  32%  398 aa  ARGD_METJA RecName: Full=Acetylornithine aminotransferase;       
   27::236     3e-17  36%  414 aa  ASTC_YERPS RecName: Full=Succinylornithine transaminase;       
   27::236     3e-17  36%  414 aa  ASTC_YERPG RecName: Full=Succinylornithine transaminase;       
   27::236     3e-17  36%  414 aa  ASTC_YERPE RecName: Full=Succinylornithine transaminase;       
   27::236     3e-17  36%  414 aa  ASTC_YERPA RecName: Full=Succinylornithine transaminase;       
   27::236     3e-17  36%  414 aa  ASTC_YERP3 RecName: Full=Succinylornithine transaminase;       
    7::321     3e-17  28%  399 aa  ARGD_RALSO RecName: Full=Acetylornithine aminotransferase;       
   23::249     3e-17  30%  396 aa  OAT2_STAAW RecName: Full=Ornithine aminotransferase 2;       
   23::249     3e-17  30%  396 aa  OAT2_STAAS RecName: Full=Ornithine aminotransferase 2;       
   23::249     3e-17  30%  396 aa  OAT2_STAAN RecName: Full=Ornithine aminotransferase 2;       
   23::249     3e-17  30%  396 aa  OAT2_STAAM RecName: Full=Ornithine aminotransferase 2;       
   23::249     3e-17  30%  396 aa  OAT2_STAAC RecName: Full=Ornithine aminotransferase 2;       
   32::325     3e-17  35%  446 aa  GABT_MYCLE RecName: Full=4-aminobutyrate aminotransferase;       
   54::263     4e-17  35%  432 aa  OAT_DROAN RecName: Full=Ornithine aminotransferase, mitochondrial; 
   16::228     4e-17  32%  379 aa  ARGD_STRMU RecName: Full=Acetylornithine aminotransferase;       
   12::229     4e-17  36%  386 aa  ARGD_LISMF RecName: Full=Acetylornithine aminotransferase;       
   27::246     6e-17  37%  424 aa  OAT_YEAST RecName: Full=Ornithine aminotransferase;       
   40::249     6e-17  32%  422 aa  OAT_CAEEL RecName: Full=Probable ornithine aminotransferase,
   18::234     6e-17  35%  388 aa  ARGD_AERPE RecName: Full=Acetylornithine/acetyl-lysine
   83::324     6e-17  36%  512 aa  AGT2_RAT RecName: Full=Alanine--glyoxylate aminotransferase 2,
   36::283     7e-17  33%  445 aa  DAT_ACIBA RecName: Full=Diaminobutyrate--2-oxoglutarate
   28::230     7e-17  34%  405 aa  ARGD_SHEON RecName: Full=Acetylornithine aminotransferase;       
   25::226     7e-17  35%  405 aa  ARGD1_BRAJA RecName: Full=Acetylornithine aminotransferase 1;      
   84::325     7e-17  35%  513 aa  AGT2_MOUSE RecName: Full=Alanine--glyoxylate aminotransferase 2,
   27::232     1e-16  36%  404 aa  OAT_BRAJA RecName: Full=Ornithine aminotransferase;       
   78::337     1e-16  31%  468 aa  PAT_ERWCT RecName: Full=Putrescine aminotransferase;       
   59::268     1e-16  34%  439 aa  OAT_RAT RecName: Full=Ornithine aminotransferase, mitochondrial;   
   23::231     1e-16  29%  396 aa  OAT2_STAAR RecName: Full=Ornithine aminotransferase 2;       
   28::248     1e-16  31%  403 aa  ARGD_VIBCH RecName: Full=Acetylornithine aminotransferase;       
   31::253     1e-16  31%  395 aa  ARGD_METAC RecName: Full=Acetylornithine aminotransferase;       
   12::229     1e-16  35%  386 aa  ARGD_LISMO RecName: Full=Acetylornithine aminotransferase;       
   59::268     2e-16  32%  439 aa  OAT_MOUSE RecName: Full=Ornithine aminotransferase, mitochondrial; 
   23::232     2e-16  29%  399 aa  OAT_BREBN RecName: Full=Ornithine aminotransferase;       
   59::268     2e-16  34%  439 aa  OAT_BOVIN RecName: Full=Ornithine aminotransferase, mitochondrial; 
   23::249     2e-16  33%  396 aa  OAT_BACCQ RecName: Full=Ornithine aminotransferase;       
   23::231     2e-16  33%  396 aa  OAT_BACC3 RecName: Full=Ornithine aminotransferase;       
   23::231     2e-16  33%  396 aa  OAT_BACAN RecName: Full=Ornithine aminotransferase;       
   23::231     2e-16  33%  396 aa  OAT_BACAC RecName: Full=Ornithine aminotransferase;       
   23::231     2e-16  33%  396 aa  OAT_BACAA RecName: Full=Ornithine aminotransferase;       
   15::236     2e-16  33%  392 aa  ASTC_CAUCR RecName: Full=Succinylornithine transaminase;       
   24::250     2e-16  33%  398 aa  OAT_OCEIH RecName: Full=Ornithine aminotransferase;       
   59::286     2e-16  33%  439 aa  OAT_HUMAN RecName: Full=Ornithine aminotransferase, mitochondrial; 
   24::229     2e-16  44%  404 aa  ARGD_MYCLE RecName: Full=Acetylornithine aminotransferase;       
   23::242     2e-16  32%  403 aa  ARGD_BRUSU RecName: Full=Acetylornithine aminotransferase;       
   23::242     2e-16  32%  403 aa  ARGD_BRUME RecName: Full=Acetylornithine aminotransferase;       
   50::298     3e-16  36%  470 aa  RHBA_RHIME RecName: Full=Diaminobutyrate--2-oxoglutarate
   23::249     4e-16  34%  396 aa  OAT2_STAS1 RecName: Full=Ornithine aminotransferase 2;       
   68::296     4e-16  36%  451 aa  ARGD_ALNGL RecName: Full=Acetylornithine aminotransferase,
   29::238     5e-16  30%  414 aa  OAT_PLACH RecName: Full=Ornithine aminotransferase;       
   29::231     6e-16  33%  405 aa  ARGD_SALTY RecName: Full=Acetylornithine/succinyldiaminopimelate
   38::271     6e-16  32%  427 aa  ARGD_ANASP RecName: Full=Acetylornithine aminotransferase;       
   85::326     6e-16  35%  514 aa  AGT2_BOVIN RecName: Full=Alanine--glyoxylate aminotransferase 2,
   32::261     8e-16  29%  416 aa  OAT_DICDI RecName: Full=Probable ornithine aminotransferase;       
   29::231     1e-15  33%  405 aa  ARGD_SALTI RecName: Full=Acetylornithine/succinyldiaminopimelate
   55::268     1e-15  34%  441 aa  ARGD_SCHPO RecName: Full=Probable acetylornithine aminotransferase,
   23::249     2e-15  29%  396 aa  OAT_STACT RecName: Full=Ornithine aminotransferase;       
   29::238     2e-15  34%  414 aa  OAT_PLAYO RecName: Full=Ornithine aminotransferase;       
   29::256     2e-15  32%  414 aa  OAT_PLAFD RecName: Full=Ornithine aminotransferase;       
   29::256     2e-15  32%  414 aa  OAT_PLAF7 RecName: Full=Ornithine aminotransferase;       
   40::274     2e-15  32%  429 aa  ARGD_SYNY3 RecName: Full=Acetylornithine aminotransferase;       
   29::249     2e-15  32%  406 aa  ARGD_SHIFL RecName: Full=Acetylornithine/succinyldiaminopimelate
   85::326     2e-15  34%  514 aa  AGT2_PONAB RecName: Full=Alanine--glyoxylate aminotransferase 2,
   21::235     3e-15  40%  424 aa  Y1815_ARCFU RecName: Full=Uncharacterized aminotransferase AF_1815;
   23::249     3e-15  29%  396 aa  OAT_STAEQ RecName: Full=Ornithine aminotransferase;       
   23::231     3e-15  30%  397 aa  OAT_MACCJ RecName: Full=Ornithine aminotransferase;       
   29::231     3e-15  35%  406 aa  ARUC_PSEAE RecName: Full=Succinylornithine
   28::230     3e-15  32%  405 aa  ARGD_YERPE RecName: Full=Acetylornithine/succinyldiaminopimelate
   29::231     3e-15  32%  406 aa  ARGD_ECOLI RecName: Full=Acetylornithine/succinyldiaminopimelate
   29::231     3e-15  32%  406 aa  ARGD_ECOL6 RecName: Full=Acetylornithine/succinyldiaminopimelate
   23::249     4e-15  29%  396 aa  OAT_STAES RecName: Full=Ornithine aminotransferase;       
   23::231     5e-15  32%  396 aa  OAT_BACCR RecName: Full=Ornithine aminotransferase;       
    9::240     5e-15  33%  399 aa  ARGD_AGRT5 RecName: Full=Acetylornithine aminotransferase;       
   41::267     5e-15  31%  494 aa  AGT2L_DROME RecName: Full=Alanine--glyoxylate aminotransferase
   34::252     7e-15  28%  401 aa  OAT_BACSU RecName: Full=Ornithine aminotransferase;       
   29::231     7e-15  32%  406 aa  ARGD_ECO57 RecName: Full=Acetylornithine/succinyldiaminopimelate
   25::228     9e-15  32%  394 aa  OAT1_STAAW RecName: Full=Ornithine aminotransferase 1;       
   25::228     9e-15  32%  394 aa  OAT1_STAAS RecName: Full=Ornithine aminotransferase 1;       
   25::228     9e-15  32%  394 aa  OAT1_STAAN RecName: Full=Ornithine aminotransferase 1;       
   25::228     9e-15  32%  394 aa  OAT1_STAAM RecName: Full=Ornithine aminotransferase 1;       
   25::228     9e-15  32%  394 aa  OAT1_STAAC RecName: Full=Ornithine aminotransferase 1;       
   85::326     9e-15  33%  514 aa  AGT2_HUMAN RecName: Full=Alanine--glyoxylate aminotransferase 2,
   33::282     1e-14  35%  449 aa  OAPT_PSEPU RecName: Full=Omega-amino acid--pyruvate
   14::265     1e-14  32%  423 aa  ECTB_STRAW RecName: Full=Diaminobutyrate--2-oxoglutarate
    6::231     1e-14  36%  386 aa  ARGD_BACCR RecName: Full=Acetylornithine aminotransferase;       
   23::230     2e-14  31%  400 aa  OAT_EXISA RecName: Full=Ornithine aminotransferase;       
   23::228     2e-14  32%  394 aa  OAT1_STAAR RecName: Full=Ornithine aminotransferase 1;       
   26::232     2e-14  35%  408 aa  ARGD_XANCP RecName: Full=Acetylornithine aminotransferase;       
   28::230     2e-14  33%  403 aa  ARGD_PHOLL RecName: Full=Acetylornithine/succinyldiaminopimelate
   18::330     2e-14  27%  398 aa  ARGD_NEIMB RecName: Full=Acetylornithine aminotransferase;       
   18::219     3e-14  31%  397 aa  ARGD_NEIMA RecName: Full=Acetylornithine aminotransferase;       
   12::208     3e-14  34%  384 aa  ARGD_LISIN RecName: Full=Acetylornithine aminotransferase;       
   19::220     3e-14  30%  387 aa  ARGD_CLOAB RecName: Full=Acetylornithine aminotransferase;       
   40::277     3e-14  33%  450 aa  YHXA_BACSU RecName: Full=Uncharacterized aminotransferase yhxA;    
   31::337     4e-14  29%  459 aa  PAT_ECOL6 RecName: Full=Putrescine aminotransferase;       
   32::240     4e-14  35%  411 aa  ARGD_YARLI RecName: Full=Acetylornithine aminotransferase,
   31::337     6e-14  29%  459 aa  PAT_KLEP3 RecName: Full=Putrescine aminotransferase;       
    7::258     6e-14  29%  427 aa  ECTB_WOLSU RecName: Full=Diaminobutyrate--2-oxoglutarate
    6::263     6e-14  32%  418 aa  ARGD_PROMM RecName: Full=Acetylornithine aminotransferase;       
   21::266     8e-14  32%  433 aa  DGDA_BURCE RecName: Full=2,2-dialkylglycine decarboxylase;       
   80::298     8e-14  35%  477 aa  AGT22_ARATH RecName: Full=Alanine--glyoxylate aminotransferase 2
   31::337     1e-13  29%  459 aa  PAT_ESCF3 RecName: Full=Putrescine aminotransferase;       
   78::337     1e-13  29%  465 aa  PAT_ENTS8 RecName: Full=Putrescine aminotransferase;       
   31::337     1e-13  29%  459 aa  PAT_ECO8A RecName: Full=Putrescine aminotransferase;       
   25::247     1e-13  36%  393 aa  ARGD_HAEDU RecName: Full=Acetylornithine aminotransferase;       
   31::337     1e-13  29%  459 aa  PAT_KLEP7 RecName: Full=Putrescine aminotransferase;       
   12::265     1e-13  34%  420 aa  ARGD_SYNPX RecName: Full=Acetylornithine aminotransferase;       
   31::337     2e-13  29%  459 aa  PAT_ECOSM RecName: Full=Putrescine aminotransferase;       
   31::337     2e-13  29%  459 aa  PAT_ECOLU RecName: Full=Putrescine aminotransferase;       
   31::337     2e-13  29%  459 aa  PAT_ECOL5 RecName: Full=Putrescine aminotransferase;       
   28::233     2e-13  33%  411 aa  OAT_BORPE RecName: Full=Ornithine aminotransferase;       
   28::233     2e-13  33%  411 aa  OAT_BORPA RecName: Full=Ornithine aminotransferase;       
   28::233     2e-13  33%  411 aa  OAT_BORBR RecName: Full=Ornithine aminotransferase;       
   14::265     2e-13  33%  420 aa  ECTB_STRCH RecName: Full=Diaminobutyrate--2-oxoglutarate
   31::337     2e-13  29%  459 aa  PAT_ECOUT RecName: Full=Putrescine aminotransferase;       
   31::337     2e-13  29%  459 aa  PAT_ECOSE RecName: Full=Putrescine aminotransferase;       
   31::337     2e-13  29%  459 aa  PAT_ECOLC RecName: Full=Putrescine aminotransferase;       
   31::337     2e-13  29%  459 aa  PAT_ECOK1 RecName: Full=Putrescine aminotransferase;       
   31::337     2e-13  29%  459 aa  PAT_ECO81 RecName: Full=Putrescine aminotransferase;       
   31::337     2e-13  29%  459 aa  PAT_ECO5E RecName: Full=Putrescine aminotransferase;       
   31::337     2e-13  29%  459 aa  PAT_ECO57 RecName: Full=Putrescine aminotransferase;       
   31::337     2e-13  29%  459 aa  PAT_ECO55 RecName: Full=Putrescine aminotransferase;       
   31::337     2e-13  29%  459 aa  PAT_ECO45 RecName: Full=Putrescine aminotransferase;       
   31::337     2e-13  29%  459 aa  PAT_ECO27 RecName: Full=Putrescine aminotransferase;       
   31::337     2e-13  29%  459 aa  PAT_ECO24 RecName: Full=Putrescine aminotransferase;       
   24::247     2e-13  37%  400 aa  ARGD_MYCTU RecName: Full=Acetylornithine aminotransferase;       
   24::247     2e-13  37%  400 aa  ARGD_MYCBO RecName: Full=Acetylornithine aminotransferase;       
   31::337     3e-13  29%  459 aa  PAT_SHIFL RecName: Full=Putrescine aminotransferase;       
   31::337     3e-13  29%  459 aa  PAT_SHIF8 RecName: Full=Putrescine aminotransferase;       
   27::256     3e-13  32%  431 aa  ARGD_BIFLO RecName: Full=Acetylornithine aminotransferase;       
   64::337     4e-13  28%  459 aa  PAT_SALAR RecName: Full=Putrescine aminotransferase;       
   78::337     4e-13  29%  459 aa  PAT_CITK8 RecName: Full=Putrescine aminotransferase;       
   20::238     4e-13  32%  399 aa  ARGD_RHILO RecName: Full=Acetylornithine aminotransferase;       
    6::230     5e-13  33%  386 aa  ARGD_BACAN RecName: Full=Acetylornithine aminotransferase;       
   78::337     6e-13  29%  459 aa  PAT_SHISS RecName: Full=Putrescine aminotransferase;       
   78::337     6e-13  29%  459 aa  PAT_SHIBS RecName: Full=Putrescine aminotransferase;       
   78::337     6e-13  29%  459 aa  PAT_ECOLI RecName: Full=Putrescine aminotransferase;       
   78::337     6e-13  29%  459 aa  PAT_ECOHS RecName: Full=Putrescine aminotransferase;       
   78::337     6e-13  29%  459 aa  PAT_ECODH RecName: Full=Putrescine aminotransferase;       
   78::337     6e-13  29%  459 aa  PAT_ECOBW RecName: Full=Putrescine aminotransferase;       
   78::337     6e-13  29%  459 aa  PAT_ECO7I RecName: Full=Putrescine aminotransferase;       
   26::232     6e-13  36%  411 aa  ARGD_XYLFT RecName: Full=Acetylornithine aminotransferase;       
   78::337     8e-13  28%  459 aa  PAT_SALTY RecName: Full=Putrescine aminotransferase;       
   78::337     8e-13  28%  459 aa  PAT_SALTI RecName: Full=Putrescine aminotransferase;       
   78::337     8e-13  28%  459 aa  PAT_SALSV RecName: Full=Putrescine aminotransferase;       
   78::337     8e-13  28%  459 aa  PAT_SALPK RecName: Full=Putrescine aminotransferase;       
   78::337     8e-13  28%  459 aa  PAT_SALPB RecName: Full=Putrescine aminotransferase;       
   78::337     8e-13  28%  459 aa  PAT_SALPA RecName: Full=Putrescine aminotransferase;       
   78::337     8e-13  28%  459 aa  PAT_SALNS RecName: Full=Putrescine aminotransferase;       
   78::337     8e-13  28%  459 aa  PAT_SALHS RecName: Full=Putrescine aminotransferase;       
   78::337     8e-13  28%  459 aa  PAT_SALG2 RecName: Full=Putrescine aminotransferase;       
   78::337     8e-13  28%  459 aa  PAT_SALEP RecName: Full=Putrescine aminotransferase;       
   78::337     8e-13  28%  459 aa  PAT_SALDC RecName: Full=Putrescine aminotransferase;       
   78::337     8e-13  28%  459 aa  PAT_SALA4 RecName: Full=Putrescine aminotransferase;       
   78::337     8e-13  29%  459 aa  PAT_ENT38 RecName: Full=Putrescine aminotransferase;       
   31::252     8e-13  30%  467 aa  AT2L2_MOUSE RecName: Full=Alanine--glyoxylate aminotransferase
   12::219     8e-13  31%  393 aa  ARGD_NITEU RecName: Full=Acetylornithine aminotransferase;       
   20::222     8e-13  31%  393 aa  ARGD_CAMJE RecName: Full=Acetylornithine aminotransferase;       
   78::337     1e-12  28%  459 aa  PAT_SALPC RecName: Full=Putrescine aminotransferase;       
   78::337     1e-12  28%  459 aa  PAT_SALCH RecName: Full=Putrescine aminotransferase;       
   24::250     1e-12  27%  398 aa  OAT_BACHD RecName: Full=Ornithine aminotransferase;       
   18::268     1e-12  29%  426 aa  ECTB_OCEIH RecName: Full=Diaminobutyrate--2-oxoglutarate
   58::286     1e-12  33%  461 aa  ARGD_NEUCR RecName: Full=Acetylornithine aminotransferase,
   13::238     1e-12  28%  393 aa  ARGD1_BORPA RecName: Full=Acetylornithine aminotransferase 1;      
   13::238     1e-12  28%  393 aa  ARGD1_BORBR RecName: Full=Acetylornithine aminotransferase 1;      
   14::265     1e-12  35%  423 aa  ECTB_STRCO RecName: Full=Diaminobutyrate--2-oxoglutarate
   26::246     1e-12  30%  402 aa  ASTC_PHOLL RecName: Full=Succinylornithine transaminase;       
   27::229     1e-12  41%  405 aa  ARGD_CAUCR RecName: Full=Acetylornithine aminotransferase;       
   25::231     1e-12  29%  408 aa  ARGD_BUCAI RecName: Full=Acetylornithine/succinyldiaminopimelate
   37::280     2e-12  29%  453 aa  BIOA_AQUAE RecName: Full=Adenosylmethionine-8-amino-7-oxononanoate
   13::238     2e-12  28%  393 aa  ARGD1_BORPE RecName: Full=Acetylornithine aminotransferase 1;      
   50::342     2e-12  30%  467 aa  AGT2L_CAEEL RecName: Full=Alanine--glyoxylate aminotransferase
   78::296     2e-12  31%  476 aa  AGT21_ARATH RecName: Full=Alanine--glyoxylate aminotransferase 2
   33::245     2e-12  28%  419 aa  ARGD_PROMA RecName: Full=Acetylornithine aminotransferase;       
   23::262     3e-12  29%  426 aa  ECTB_BACSK RecName: Full=Diaminobutyrate--2-oxoglutarate
   25::210     3e-12  34%  375 aa  ARGD_STAEQ RecName: Full=Acetylornithine aminotransferase;       
   29::231     3e-12  29%  404 aa  ARGD_BUCAP RecName: Full=Acetylornithine/succinyldiaminopimelate
   24::263     4e-12  30%  427 aa  ECTB_BACHD RecName: Full=Diaminobutyrate--2-oxoglutarate
   25::210     4e-12  34%  375 aa  ARGD_STAES RecName: Full=Acetylornithine aminotransferase;       
   29::231     4e-12  32%  406 aa  ARGD_PSEPK RecName: Full=Acetylornithine aminotransferase;       
   36::256     4e-12  29%  406 aa  ARGD_LEPIN RecName: Full=Acetylornithine aminotransferase;       
   36::256     4e-12  29%  406 aa  ARGD_LEPIC RecName: Full=Acetylornithine aminotransferase;       
   29::251     5e-12  29%  429 aa  BIOA_ECOLI RecName: Full=Adenosylmethionine-8-amino-7-oxononanoate
   82::301     5e-12  30%  481 aa  AGT23_ARATH RecName: Full=Alanine--glyoxylate aminotransferase 2
   30::252     7e-12  31%  499 aa  AT2L1_MOUSE RecName: Full=Alanine--glyoxylate aminotransferase
   26::232     7e-12  35%  411 aa  ARGD_XYLFA RecName: Full=Acetylornithine aminotransferase;       
   29::231     7e-12  30%  405 aa  ARGD1_PSESM RecName: Full=Acetylornithine aminotransferase 1;      
   37::262     9e-12  29%  415 aa  ARGD_PROMP RecName: Full=Acetylornithine aminotransferase;       
    7::257     1e-11  30%  416 aa  ECTB_VIRPA RecName: Full=Diaminobutyrate--2-oxoglutarate
    9::260     2e-11  31%  435 aa  ECTB_BORPA RecName: Full=Diaminobutyrate--2-oxoglutarate
    9::260     2e-11  31%  435 aa  ECTB_BORBR RecName: Full=Diaminobutyrate--2-oxoglutarate
   24::263     2e-11  31%  436 aa  ECTB_NOCFA RecName: Full=Diaminobutyrate--2-oxoglutarate
   14::263     2e-11  27%  427 aa  ECTB_MARHA RecName: Full=Diaminobutyrate--2-oxoglutarate
   30::253     2e-11  32%  509 aa  AT2L1_XENLA RecName: Full=Alanine--glyoxylate aminotransferase
   31::268     3e-11  29%  429 aa  BIOA_SALTY RecName: Full=Adenosylmethionine-8-amino-7-oxononanoate
   33::271     3e-11  31%  430 aa  BIOA_HAEIN RecName: Full=Adenosylmethionine-8-amino-7-oxononanoate
   19::279     3e-11  32%  455 aa  BIOA_BACSH RecName: Full=Adenosylmethionine-8-amino-7-oxononanoate
   31::254     3e-11  33%  492 aa  AT2L1_DANRE RecName: Full=Alanine--glyoxylate aminotransferase
   26::143     5e-11  42%  408 aa  ARGD_XANAC RecName: Full=Acetylornithine aminotransferase;       
   23::229     5e-11  30%  400 aa  ARGD_CHLTE RecName: Full=Acetylornithine aminotransferase;       
    5::256     6e-11  31%  411 aa  ECTB_VIBCH RecName: Full=Diaminobutyrate--2-oxoglutarate
   52::291     1e-10  29%  448 aa  Y4QG_RHISN RecName: Full=Uncharacterized aminotransferase y4qG;    
   31::252     1e-10  30%  450 aa  AT2L2_HUMAN RecName: Full=Alanine--glyoxylate aminotransferase
   28::266     2e-10  26%  426 aa  ECTB_BACPA RecName: Full=Diaminobutyrate--2-oxoglutarate
   30::252     3e-10  30%  497 aa  AT2L1_BOVIN RecName: Full=Alanine--glyoxylate aminotransferase
   23::242     3e-10  30%  393 aa  ARGD_WOLSU RecName: Full=Acetylornithine aminotransferase;       
   21::261     7e-10  30%  423 aa  ECTB_CHRSD RecName: Full=Diaminobutyrate--2-oxoglutarate
   33::251     7e-10  29%  429 aa  BIOA_ESCVU RecName: Full=Adenosylmethionine-8-amino-7-oxononanoate
   21::261     9e-10  29%  421 aa  ECTB_HALEL RecName: Full=Diaminobutyrate--2-oxoglutarate
   71::267     1e-09  28%  426 aa  OAT_VIGAC RecName: Full=Ornithine aminotransferase;       
   72::282     1e-09  28%  466 aa  ARGD_DEBHA RecName: Full=Acetylornithine aminotransferase,
   30::252     3e-09  30%  499 aa  AT2L1_HUMAN RecName: Full=Alanine--glyoxylate aminotransferase
   28::279     4e-09  31%  459 aa  YGD3_SCHPO RecName: Full=Uncharacterized aminotransferase
   36::250     4e-09  32%  423 aa  ARGD_ASHGO RecName: Full=Acetylornithine aminotransferase,
    1::283     6e-09  24%  399 aa  ARGD_OCEIH RecName: Full=Acetylornithine aminotransferase;       
   36::290     7e-09  29%  461 aa  BIOA_METJA RecName: Full=Adenosylmethionine-8-amino-7-oxononanoate
   42::254     1e-08  27%  425 aa  BIOA_SERMA RecName: Full=Adenosylmethionine-8-amino-7-oxononanoate
   73::275     1e-08  30%  453 aa  ARGD_DICDI RecName: Full=Probable acetylornithine aminotransferase,
   34::389     2e-08  28%  467 aa  Y4UB_RHISN RecName: Full=Uncharacterized aminotransferase y4uB;    
  347::585     3e-08  28%  748 aa  BIOB_BACFN RecName: Full=Biotin synthase;       
   39::253     3e-08  30%  427 aa  ARGD_CANGA RecName: Full=Acetylornithine aminotransferase,
  347::585     4e-08  28%  748 aa  BIOB_BACFR RecName: Full=Biotin synthase;       
   36::250     5e-08  31%  423 aa  ARGD_YEAST RecName: Full=Acetylornithine aminotransferase,
  347::585     8e-08  27%  741 aa  BIOB_BACTN RecName: Full=Biotin synthase;       
   34::277     8e-08  32%  437 aa  BIOA_MYCTU RecName: Full=Adenosylmethionine-8-amino-7-oxononanoate
   34::277     8e-08  32%  437 aa  BIOA_MYCBO RecName: Full=Adenosylmethionine-8-amino-7-oxononanoate
   18::266     8e-08  28%  423 aa  BIOA_CORGL RecName: Full=Adenosylmethionine-8-amino-7-oxononanoate
   28::256     1e-07  26%  456 aa  TPA_BILWA RecName: Full=Taurine--pyruvate aminotransferase;        
   36::250     1e-07  27%  423 aa  ARGD_KLULA RecName: Full=Acetylornithine aminotransferase,
   19::256     1e-06  26%  421 aa  ECTB_VIBPA RecName: Full=Diaminobutyrate--2-oxoglutarate
   13::57      2e-06  47%   71 aa  ARGD_RHOCA RecName: Full=Acetylornithine aminotransferase;       
   82::335     8e-06  26%  500 aa  GABT_HUMAN RecName: Full=4-aminobutyrate aminotransferase,
   29::251     2e-05  30%  432 aa  BIOA_BUCAP RecName: Full=Adenosylmethionine-8-amino-7-oxononanoate
   82::335     4e-05  27%  500 aa  GABT_MOUSE RecName: Full=4-aminobutyrate aminotransferase,
   15::158     8e-05  29%  444 aa  YODT_BACSU RecName: Full=Uncharacterized aminotransferase yodT;    
   82::335     2e-04  26%  500 aa  GABT_RAT RecName: Full=4-aminobutyrate aminotransferase,
  206::324     0.001  31%  495 aa  GABT_DICDI RecName: Full=4-aminobutyrate aminotransferase;       
    1::427

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MEGMERPISEAYFQEAKRHIPGGVSSPVRAFKAVGGTPPFLVRGEGAYVWDADGNRYLDYVMSWGPLILG
GSA_THET2       MEGMERPISEAYFQEAKRHIPGGVSSPVRAFKAVGGTPPFLVRGEGAYVWDADGNRYLDYVMSWGPLILG
GSA_THET8       ---MERPISEAYFQEAKRHIPGGVSSPVRAFKAVGGTPPFLVRGEGAYVWDADGNRYLDYVMSWGPLILG
GSA_AQUAE       --------NEKLYREALQVMPGGVNSPVRAFKAVGGKPIFLVKGRGPRVWDAEGNEYIDFLASWGAIILG
GSA2_BREBN      ---MNREKSTQLFAEAQHYIPGGVNSPVRAFKSVGGNPVYIEKGEGSRIFDVDGNSYIDYIGSWGPLILG
GSA_DEIGD       --------SEALFARAQAVTPGGVNSPVRAFRSVGGTPRFIREAHGAYLTDMDGHRLLDYIGSWGPMILG
GSA_SULAA       --------SKELFKEAQNYLVGGVNSPVRAFKAVGTDPIFIQRGKGSRIWDVDGNEYIDYVLSWGPLILG
GSA_PERMH       ---MERSLN--LFEEAQRYLVGGVNSPVRAFKSVGMEPLFIQKGKGSRVWDVDGNEYIDYVLSWGPLILG
GSA_DEIDV       --------SEALFERARAVTPGGVNSPVRAFKSVGGVPRFIREAHGAYLTDMDDTRYVDYIGSWGPMILG
GSA_SOLUE       --------SEELFRRAVEKIPGGVNSPVRAFRSVGGQPVFIARGQGSHLFDVDGNEYIDYVGSWGPLILG
GSA_SULSY       ---MNNQKSKELFQEAQKYLVGGVNSPVRAFKAVEADPIFIKKGKGCRIWDVDDNEYIDYVLSWGPLILG
GSA_THISH       --------SHDLFKAAQRHIPGGVNSPVRAFKGVGGDPVFIQRAEGAYMYDADGKRYIDYVGSWGPMIAG
GSA_HAHCH       -------ISEELFSRAQQHIPGGVNSPVRAFRGVGGAPVFFSKGEGAYLYDEDGKRYIDYVGSWGPMILG
GSA_ACIBL       -------------KRAEALIPGGVNSPVRAFRAVGGEPPILVRGEGARVFDADGNGYIDYVLSWGPLILG
GSA_DESAP       --------SAQMFAEAQKYMPGGVNSPVRAFKAVGGDPIFFLRGEGALLFDVDGNRYIDYVASWGPLILG
GSA_RUBXD       -------------ERAVRRMPGGVNSPVRAFRSVGGDPLFMERGEGPRIFDADGNAYIDYVMSYGPLLLG
GSA_THEYD       ---MKTTKSKKLYKQALKLMPGGVNSPVRAFKAVGGNPLFIAKAKGSKIYDVDGNEYIDYVLSWGPLILG
GSA_NOSP7       --------SQEVFAAAQNLMPGGVSSPVRAFKSVGGQPIVFDRVKGAYIWDVDGNQYIDYVGTWGPAICG
GSA_DEIRA       --------SEALFVRARAVTPGGVNSPVRAFRSVGGVPRFIASAQGAYLTDADGARYLDYIGSWGPMILG
GSA_SALPK       --------SENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_SALPA       --------SENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_SALPC       --------SENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_SALCH       --------SENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_CARHZ       ------------FSEAKKVIPGGVNSPVRAFKSVGLNPVFIERGEGSKIYDIDGNCYIDYVGSWGPLILG
GSA_ANADF       ---MKTELSEKLFAKAQTLFPGGVNSPVRAFRGVGGTPRFIARGKGSHLFDVDGNDYVDYVLSWGPMIVG
GSA_ENTS8       --------SENLFAAARELIPGGVNSPVRAFTGVGGTPLFIERADGAYLYDADGKAYIDYVGSWGPMVLG
GSA_DESHD       --GFQDQRSKEAFARANGVLPGGVNSPVRAFKSVGREPIFIAKGQGARLWDIDGNSYLDYVLSWGPLILG
GSA_KLEP7       --------SENLYHAARELIPGGVNSPVRAFTGVGGTPLFIERADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_ENT38       --------SENLYSAARELIPGGVNSPVRAFTGVGGTPLFIERADGAFLYDVDGKAYIDYVGSWGPMVLG
GSA_SALAR       --------SENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAWLYDVDGKAYIDYVGSWGPMVLG
GSA_SALTY       --------SENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_DESHY       --GFQDQRSKEAFARANGVLPGGVNSPVRAFKSVGREPIFIAKGQGARLWDIDGNSYLDYVLSWGPLILG
GSA_THERP       --------SGSLWDAARQFFPGGVNSPVRAFRAVGEEPVVAVRGEGAYLIDADGRRFLDYICSWGALLAG
GSA_SALHS       --------SENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_KLEP3       --------SENLYHAARELIPGGVNSPVRAFTGVGGTPLFIERADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_AZOVD       --------SETLFANAQKHIPGGVNSPVRAFRGVGGTPLFFKHAEGAYVIDEDDKRYVDYVGSWGPMILG
GSA_SYNJA       --------SRQIFARAQQLMPGGVSSPVRAFKSVGGDPVVFDRVAGAYAWDVDGNQYIDYIGSWGPAIVG
GSA_GLOVI       --------SHRLFAEAQQLMPGGVNSPVRAFKSVGSEPVFIERAEGAYLWDVDGNRYIEYINTWGPSIVG
GSA2_GEOTN      MRSYER--SKAAYEEAVTLMPGGVNSPVRAFKSVGMTPIFMARGQGAKIYDIDGNEYIDYVLSWGPLILG
GSA_PSEA7       --------SETLFSNAQKHIPGGVNSPVRAFKSVGGTPLFFKHAEGAYVLDEDDKRYVDYVGSWGPMILG
GSA_ANAVT       --------SQEIFAAAQNLMPGGVSSPVRAFKSVGGQPIVFDHVKGAYIWDVDGNQYIDYVGTWGPAICG
GSA_ACTSZ       --------STALFQRARQVIPGGVNSPVRAFKGVGGTPVFIQKAAGAYITDTDGKQYIDYVGSWGPMVLG
GSA_CYAA5       --------SEDIFAAAQKLMPGGVSSPVRAFKSVGGQPIVFDHVKGAYIWDVDGNQYIDYVGTWGPAICG
GSA_MARMS       --------SEDLYARAQHRIPGGVNSPVRAFNGVGGTPIFFQRGEGAYVYDEDKKRYIDYVGSWGPMILG
GSA_ANASP       --------SQEIFAAAQNLMPGGVSSPVRAFKSVGGQPIVFDHVKGAYIWDVDGNQYIDYVGTWGPAICG
GSA_SHEB9       --------SEALFEQAKKTIPGGVNSPVRAFNGVGGSPLFIEKANGAYIYDADGKAYIDYVGSWGPMILG
GSA_SHEB8       --------SEALFEQAKKTIPGGVNSPVRAFNGVGGSPLFIEKANGAYIYDADGKAYIDYVGSWGPMILG
GSA_SHEB5       --------SEALFEQAKKTIPGGVNSPVRAFNGVGGSPLFIEKANGAYIYDADGKAYIDYVGSWGPMILG
GSA_SHEB2       --------SEALFEQAKKTIPGGVNSPVRAFNGVGGSPLFIEKANGAYIYDADGKAYIDYVGSWGPMILG
GSA_PROMH       --------SETLYNLAQQVIPGGVNSPVRAFNGVGGTPLFIERANGAYIYDADGRAYLDYVGSWGPMVLG
GSA2_GEOKA      MRSYER--SKTAYEEAVKLMPGGVNSPVRAFKSVGMTPIFMARGQGAKIYDIDGNEYIDYVLSWGPLILG
GSA_PSEAB       --------SETLFNNAQKHIPGGVNSPVRAFKSVGGTPLFFKHAEGAYVLDEDDKRYVDYVGSWGPMILG
GSA_SHESW       --------SEALFEQAKKTIPGGVNSPVRAFNGVGGSPLFIEKANGAYIYDADGKAYIDYVGSWGPMILG
GSA_SHEPC       --------SEALFEQAKKTIPGGVNSPVRAFNGVGGSPLFIEKANGAYIYDADGKAYIDYVGSWGPMILG
GSA_PSEPK       --------SEALFAQAQKHIPGGVNSPVRAFKSVGGTPLFFKHAEGAYVVDEDDKRYVDYVGSWGPMILG
GSA_DESRM       --------SEEMFEQAQRIIPGGVNSPVRAFKSVGMNPPFIARANGSRMWDVDGNEYIDYICSWGPQILG
GSA_PSEAE       --------SETLFNNAQKHIPGGVNSPVRAFKSVGGTPLFFKHAEGAYVLDEDDKRYVDYVGSWGPMILG
GSA_PSEA8       --------SETLFNNAQKHIPGGVNSPVRAFKSVGGTPLFFKHAEGAYVLDEDDKRYVDYVGSWGPMILG
GSA_MOOTA       ------PRSAAAFAEAVKLMPGGVNSPVRAFKSVGLTPPFIQRGEGAYLYDIDGHKYIDYVSSWGPLILG
GSA_SHESR       --------SEALFEQAKKTIPGGVNSPVRAFNGVGGSPLFIEKADGAYIYDADGKAYIDYVGSWGPMILG
GSA_RUTMC       --------SETLFAQAKTVIPGGVNSPVRAFNGVGGSPIFFTRGEGAYLFDEDDKKYIDYVASWGSMILG
GSA_PSEP1       --------SEALFAQAQKHIPGGVNSPVRAFKSVGGTPLFFKHAEGAYVVDEDDKRYVDYVGSWGPMILG
GSA_CELJU       --------SEELFLQAQKHIPGGVNSPVRAFKAVGGTPVFFEKALGAYIWDADGKRYIDYVQSWGPMVLG
GSA_ALKOO       --------SQELMTRAKRVIPGGVNSPVRAFNAVGGCPRFIKSASGAYIQDVEGNSYIDYIGSWGPMILG
GSA_SYNJB       --------SKQVFARAQSLMPGGVSSPVRAFKSVGGDPVVFDRVSGAYAWDVDGNQYIDYIGSWGPAIVG
GSA_PSEU5       --------SETLFASAQTHIPGGVNSPVRAFRSVGGTPLFLKHAEGAYVIDEDDKRYVDYVGSWGPMILG
GSA_PSEF5       --------SETLFANAQKHIPGGVNSPVRAFKSVGGTPLFFKHAEGAYVTDEDDKRYVDYVGSWGPMILG
GSA_HYDS0       ------------FELAKKYMPGGVSSPVRAFKSVGAEPIVVNRGFGAFVEDIEGKKYIDYMLSFGPLILG
GSA_PSEPG       --------SEDLFAKAQKHIPGGVNSPVRAFKSVGGTPLFFKHAEGAYVVDEDDKRYVDYVGSWGPMILG
GSA_CITK8       --------SENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_SHEFN       --------SEVLFEQAKKTIPGGVNSPVRAFNGVGGSPLFIEKADGAYIFDADGKKYIDYVGSWGPMILG
GSA_PSEU2       --------SETLFANAQKHIPGGVNSPVRAFKSVGGTPLFFKHAAGAYVTDEDDKRYVDYVGSWGPMILG
GSA_EDWI9       --------SERLYEQAKTLIPGGVNSPVRAFTGVGGTPLFIERADGAHLYDADGKAYIDYVGSWGPMILG
GSA_CYAP8       --------SEEIFAAAQKLMPGGVSSPVRAFKSVGGQPIVFDRVKGAYIWDVDGNQYIDYVGTWGPAICG
GSA_YERPY       --------SENLYAQAQQLIPGGVNSPVRAFTGVGGIPLFIERADGAYLFDVDGKAYIDYVGSWGPMILG
GSA_YERPS       --------SENLYAQAQQLIPGGVNSPVRAFTGVGGIPLFIERADGAYLFDVDGKAYIDYVGSWGPMILG
GSA_YERPP       --------SENLYAQAQQLIPGGVNSPVRAFTGVGGIPLFIERADGAYLFDVDGKAYIDYVGSWGPMILG
GSA_YERPN       --------SENLYAQAQQLIPGGVNSPVRAFTGVGGIPLFIERADGAYLFDVDGKAYIDYVGSWGPMILG
GSA_YERPG       --------SENLYAQAQQLIPGGVNSPVRAFTGVGGIPLFIERADGAYLFDVDGKAYIDYVGSWGPMILG
GSA_YERPE       --------SENLYAQAQQLIPGGVNSPVRAFTGVGGIPLFIERADGAYLFDVDGKAYIDYVGSWGPMILG
GSA_YERPB       --------SENLYAQAQQLIPGGVNSPVRAFTGVGGIPLFIERADGAYLFDVDGKAYIDYVGSWGPMILG
GSA_YERPA       --------SENLYAQAQQLIPGGVNSPVRAFTGVGGIPLFIERADGAYLFDVDGKAYIDYVGSWGPMILG
GSA_YERP3       --------SENLYAQAQQLIPGGVNSPVRAFTGVGGIPLFIERADGAYLFDVDGKAYIDYVGSWGPMILG
GSA_TOLAT       --------SEQLFTAAQQSIPGGVNSPVRAFNGVGGTPRFIAKADGAYLFDVDGNRYIDYVGSWGPMLLG
GSA_PSEPW       --------SESLFAQAQKHIPGGVNSPVRAFKSVGGTPLFFKHAEGAYVVDEDDKRYVDYVGSWGPMILG
GSA_PROMM       --------SQAIFSAAQRLMPGGVSSPVRAFRSVGGQPIVFDRVKGAYAWDVDGNRFIDYIGSWGPAICG
GSA_IDILO       --------SEELYTKAQISIPGGVNSPVRAFNGVGGSPIFFESAEGAYMIDADGKRYIDYVGSWGPMILG
GSA_SHESM       --------SEALFEQAKKTIPGGVNSPVRAFNGVGGSPLFIEKADGAYIYDADGKAYIDYVGSWGPMILG
GSA_SHESA       --------SEALFEQAKKTIPGGVNSPVRAFNGVGGSPLFIEKADGAYIYDADGKAYIDYVGSWGPMILG
GSA_ECOLC       --------SENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_ECO8A       --------SENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_ECO55       --------SENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_ECO24       --------SENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_BRANA       --------SEEAFNAAKNLMPGGVNSPVRAFKSVGGQPVLIDSVKGSKMWDIDGNEYIDYVGSWGPAIIG
GSA_PELCD       --------SHQFFERARKVIPGGVNSPVRAFKAVGRQPLFIERAEGCTLVDADGNRYIDYVGSWGPMIVG
GSA_ERWCT       --------SESLYAAAQQLIPGGVNSPVRAFNGVGGTPLFIERADGAYLYDVDEQAYIDYVGSWGPMVLG
GSA_PSEFS       --------SETLFANAQKHIPGGVNSPVRAFKSVGGTPLFFKHAEGAYVTDEDDKRYVDYVGSWGPMILG
GSA_SHEON       --------SEALFEQAKKTIPGGVNSPVRAFNGVGGSPLFIEKADGAYIYDADGKAYIDYVGSWGPMILG
GSA_ACIC5       -------------ERAERLLPGGVDSPVRAFRAVGGEPPFLVKAEGACLWDADGNQYLDYFGSWGPMILG
GSA_SYNE7       --------SDEIFAAAQKLMPGGVSSPVRAFKSVGGQPIVFDRVKDAYAWDVDGNRYIDYVGTWGPAICG
GSA_SORC5       ------------FDRAAAVLPGGVNSPVRAFRAVGGDPLFIARAQGARLFDADGAEYIDYVGSWGPAILG
GSA_SHELP       --------SETLFEQAKKTIPGGVNSPVRAFNGVGGSPRFIEKADGAYIYDADGKAYIDYVGSWGPMILG
GSA_PHOLL       --------SDILYSQAKQLIPGGVNSPVRAFNGVGGTPLFIKHADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_SHEDO       --------SEALFEQAKKTIPGGVNSPVRAFNGVGGSPLFIEKADGAYIFDADGNKYIDYVGSWGPMILG
GSA_PSEA6       --------SEQLFARAQKHIPGGVNSPVRAFRAVGGTPPFIEKADGPYLYDADGKQYIDYVQSWGPMVLG
GSA_HAEPS       --------SQSLFEKAQRVIPGGVNSPVRAFKGVGGTPVFIDSAKGAYITDSEGKRYIDYVGSWGPMVLG
GSA_CHRVO       ------------FERGKQVIPGGVNSPVRAFGQVGGTPRFVARAEGAYFWDADGKQYLDYVGSWGPAIVG
GSA_ECOUT       --------SENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_ECOL6       --------SENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_ECOL5       --------SENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_ECOK1       --------SENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_ECO45       --------SENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_ECO27       --------SENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA2_BACLD      --------SKAAFEEAQRVMPGGVNSPVRAFKSVNMDPIFMERGKGSKIYDIDGNEYIDYVLSWGPLILG
GSA1_ARATH      --------SEEAFNAAKNLMPGGVNSPVRAFKSVGGQPVLIDSVKGSKMWDIDGNEYIDYVGSWGPAIIG
GSA_PROM3       --------SQAIFSAAQRLMPGGVSSPVRAFRSVGGQPIVFDRVKGAYAWDVDGNRFIDYIGSWGPAICG
GSA_HELMI       --------SEQLFAEAKTLIPGGVNSPVRAFKSVGRNPVFIERAEGAYLYDVDGNKYVDYVGSWGPMIVG
GSA_VESOH       --------SEVLFAQARTVISGGVNSPVRAFNGVGGNPIFFTRGKGAYLFDVDGNKYIDYVASWGPMILG
GSA_PSEE4       --------SEALFAQAQKHIPGGVNSPVRAFKSVGGTPLFFKHAEGAYVIDEDDKRYVDYVGSWGPMILG
GSA_ECO81       --------SENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_SYNP6       --------SDEIFAAAQKLMPGGVSSPVRAFKSVGGQPIVFDRVKDAYAWDVDGNRYIDYVGTWGPAICG
GSA_SHISS       --------SENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_PSEPF       --------SETLFANAQKHIPGGVNSPVRAFKSVGGTPLFFKHAEGAYVTDEDDKRYVDYVGSWGPMILG
GSA_PSE14       --------SETLFANAQKHIPGGVNSPVRAFKSVGGTPLFFKHAAGAYVTDEDDKRYVDYVGSWGPMILG
GSA_MARAV       --------SETLFEQAQKYIPGGVNSPVRAFRGVGGTPVFFKHAEGAYLYDEDDRRYIDFIGSWGPMILG
GSA_ECO7I       --------SENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_CLONN       MKELKHTKSEAMFKEAVKYIPGGVNSPVRAFGSVGLNPIFIDRAKGSKIYDVDGNEYIDYICSWGPLILG
GSA_BACSU       --------SKTAFKEAQKLMPGGVNSPVRAFKSVDMDPIFMERGKGSKIFDIDGNEYIDYVLSWGPLILG
GSA_XYLFM       ---MNHSRSHALFVQAQTRIPGGVNSPVRAFRSVGGEPFFVARADGPYLFDVDGHRYIDYVGSWGPMIVG
GSA_SHESH       --------SDELFEQAKKTIPGGVNSPVRAFNGVGGSPRFIEKADGAYIYDADGKAYIDYVGSWGPMILG
GSA_MANSM       --------SNTLFSRAQQVIPGGVNSPVRAFKGVGGTPVFIQKAKGAYIWDTDDKQYVDYVGSWGPMILG
GSA_HORVU       --------SEEIFNAAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDVDGNEYIDYVGSWGPAIIG
GSA_ECO5E       --------SENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_ECO57       --------SENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_XYLFT       ---MNHSRSHALFVQAQTRIPGGVNSPVRAFRSVGGEPFFVARADGPYLFDVDGHRYIDYVGSWGPMIVG
GSA_XYLF2       ---MNHSRSHALFVQAQTRIPGGVNSPVRAFRSVGGEPFFVARADGPYLFDVDGHRYIDYVGSWGPMIVG
GSA_PELPB       --------SAELFEKAKKFIPGGVNSPVRAFKSVGGTPVYMAKGSGAYMTDVDGNTYLDYVGSWGPFILG
GSA_SOYBN       --------SEEAFAAAKELMPGGVNSPVRAFKSVGGQPIVIDSVKGSRMWDIDGNEYIDYVGSWGPAIIG
GSA_PSESM       --------SETLFANAQKHIPGGVNSPVRAFKSVGGTPLFFKHAAGAYVTDEDDKRYVDYVGSWGPMILG
GSA_AERS4       --------SDQLFEQARQTIPGGVNSPVRAFNGVGGTPRFIDHADGAYLYDVDGQAYVDYIGSWGPMLLG
GSA_SALEP       --------SENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_HALHL       ------------FQQARELIPGGVNSPVRAFKGVGGEPIFFERGEGPYMWDVDGKRYVDYVCSWGPLVAG
GSA_CLOTH       --------SKLLFERAKKVIPGGVNSPVRAFGAVGGYPPFIKKAKGARIYDADGNEYIDYVGSWGPMILG
GSA_BURXL       --------NETLFERAQRTIPGGVNSPVRAFRSVGGTPRFIERAQGAYFWDADGQRYIDYIGSWGPMILG
GSA_SYNR3       --------SDALFTAAQQLMPGGVNSPVRAFRSVGGQPIVFDRVEGAYAWDVDGNRYIDYIGSWGPAICG
GSA_SERP5       --------SESLYAQAKQVIPGGVNSPVRAFNGVGGVPLFIERADGAYLFDVDGKAYIDYVGSWGPMVLG
GSA_SALPB       --------SENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_SALNS       --------SENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_SALG2       --------SENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_ECOSE       --------SENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_ECOLU       --------SENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_ECOHS       --------SENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_DESAA       --------SKELFARACKTIPGGVNSPVRACGSVGTDPCFIARGQGSAIFDADGKQYIDYIGSWGPLILG
GSA_CYAP4       --------SEEIFAAAQKLMPGGVNSPVRAFKSVGGNPIVFDRVEGAYVWDVDGNQYIDYVGSWGPAICG
GSA_ORYSJ       --------SEEIFNAAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSRMWDVDGNEYIDYVGSWGPAIIG
GSA_ECOLI       --------SENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_ECODH       --------SENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_ECOBW       --------SENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_CYAP7       ---------EEIFTAAQKLMPGGVSSPVRAFKSVGGQPIVFDHVEGAYIWDVDNNQYIDYVGTWGPAICG
GSA2_BACHD      --------SSAAFNRAKPLMPGGVNSPVRAFKSVNMDPVFMERGKGANIYDIDGNEYIDYVLSWGPLILG
GSA1_GEOTN      --------SEQLYEEALRHIVGGVNSPSRSYKAVGGGAPVVMRAQGAYFWDVDGNKYIDYLAAYGPIITG
GSA_HAES1       --------SATLFSRAQQVIPGGVNSPVRAFKGVGGTPVFIEKANGAYIFDTEGKQYIDYVGSWGPMILG
GSA_CHLPB       --------SAELFEKAKQFIPGGVNSPVRAFKSVGGTPIFMAKGQGAYMTDVDGNTYLDYVGSWGPFILG
GSA_ECOSM       --------SENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA2_BACA2      --------SKAAFKEAQKLMPGGVNSPVRAFKSVDMDPIFMQRGKGSKIFDIDGNEYIDYVLSWGPLILG
GSA_MYXXD       ---MNHAHSQALFARAQARIPGGVNSPVRAFRGVGGDPVFFREGAGAWLTDVDGNRYVDLVGSWGPLILG
GSA1_CLOPH      --------SEELFKEALKVIPGGVNSPVRAFGSVGESPRFIKRAEGAHLYDVDGKEYIDYICSWGPMILG
GSA_TOBAC       --------SEEAFSKAKELMPGGVNSPVRAFKSVGGQPIIIDSVKGSRMRDIDGNEYIDYVGSWGPAIIG
GSA_CHLL2       --------SAELFELAKKFIPGGVNSPVRAFKSVGGTPIYMAKGEGAYMTDVDGNTYLDYVGSWGPFILG
GSA_PSEMY       --------SEILFANAQKHIPGGVNSPVRAFRSVGGTPLFFKHAEGAYVVDEDDKRYVDYVGSWGPMILG
GSA_SHEAM       --------SETLFEQAKKTIPGGVNSPVRAFNGVGGTPRFIEKADGAYIYDADGKAYIDYVGSWGPMILG
GSA_ESCF3       --------SENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_AERHH       --------SDQLFEQARQTIPGGVNSPVRAFNGVGGTPRFIDHADGAYLYDVDGQAYVDYIGSWGPMLLG
GSA_ACTPJ       --------SEQLFEKAQKVIPGGVNSPVRAFKGVGGTPVFIQKAEGAYITDSDGKKYIDYVGSWGPMVLG
GSA2_ANOFW      MRSYER--SKAAYAEAVKLMPGGVNSPVRAFKAVKMDPIFMARGKGSKIYDIDGNEYIDYVLSWGPLILG
GSA_YERE8       --------SESLYAQAKQLIPGGVNSPVRAFTGVGGVPLFIERADGAYLFDVDGKAYIDYVGSWGPMVLG
GSA_SYNY3       --------SEEIFAAAQHLMPGGVSSPVRAFKSVGGQPIVFDRVEGAQIWDVDGNQYIDYVGTWGPAICG
GSA_SHIFL       --------SENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_SHIF8       --------SENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_MICAN       --------SKEIFTAAQKLMPGGVSSPVRAFKSVGGQPIVFESVKGAYIRDVDGNEYIDYVGTWGPAICG
GSA_ERWT9       --------SENLYAQAQQLIPGGVNSPVRAFNGVGGVPLFIERANGAYLYDADGKAYIDYVGSWGPMVLG
GSA_ACTP7       --------SEQLFEKAQKVIPGGVNSPVRAFKGVGGTPVFIQKAEGAYITDSDGKKYIDYVGSWGPMVLG
GSA_THIDA       --------NEALFEASQKVIPGGVNSPVRAFRSVGGTPVFFSRARGSRVWDADGREYIDYVGSWGPAILG
GSA_CLOPE       ------------FEESKKYMPGGVNSPVRSFGSVGINPPVIKSGKGAMIKDENGNEYIDFVLAWGPMILG
GSA_CLOBB       ------------FEESKKYMPGGVNSPVRCFKEMGMNPPVIKSGKGVIIKDEDGKEYIDFVLAWGPLLLG
GSA_XYLFA       ---MNHSRSHTLFVQAQTRIPGGVNSPVRAFRSVGGEPFFVARADGPYLFDVDGHRYIDYVGSWGPMIVG
GSA_TRIEI       --------SEEIFAAAQKLMPGGVSSPVRAFKSVGGQPIVFDRVQGAYIWDVDGNQYIDYVGTWGPAICG
GSA_SHIBS       --------SENLYSAARELLPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_SHIB3       --------SENLYSAARELLPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_SALTI       --------SENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_SALSV       --------SENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_SALDC       --------SENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_PASMU       --------SLSLFQRAQHRIPGGVNSPVRAFKGVGGTPIFIEKAQGAYLYDTEGNQYIDYVGSWGPMILG
GSA_CLOBA       ------------FEESKKYMPGGVNSPVRCFKEMGMNPPVIKSGKGVIIRDEDGKEYIDFVLAWGPLLLG
GSA_AZOSB       --------NEALFSRAQRSIPGGVNSPVRAFRSVGGTPRFIERAEGARVWDADGKAYIDYVGSWGPAIAG
GSA_SHIDS       --------SENLYSAARELIPSGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_PSYIN       -------ISNQLFDRAQAIIPGGVNSPARAFNGVGGDPLFIEKAQGAYIYDVDKKSYIDYVGSWGPMILG
GSA_HAES2       --------SATLFYRAQQVIPGGVNSPVRAFKGVGGTPVFIEKANGAYIFDIEGKQYIDYVGSWGPMILG
GSA_GEOLS       --------SHTLFDQARRIIPGGVNSPVRAFKSVGADPLFIKRASGSKIFDEDNNTYIDYVGSWGPMILG
GSA_FLAPJ       --------SSQLFLEAEKVIPGGVNSPVRAFKSVGGTPIFAKSAKGAYVYDEDGNRFVDYINSWGPMILG
GSA_ALHEH       --------SHELFERARQHIVGGVNSPVRAFTGVGGEPPFIARAEGPYLYDEDGNRYVDYVCSWGPMVAG
GSA1_GEOKA      --------SEQLYKEALQHIVGGVNSPSRSYKAVGGGAPVVMRAQGAYFWDVDGNKYIDYLAAYGPIIAG
GSA_PECCP       --------SESLYAAAQQLIPGGVNSPVRAFNGVGGTPLFIERADGAYLYDADEQAYIDYVGSWGPMVLG
GSA_GEOUR       --------SELLFQEAQKAIPGGVNSPVRAFKSVGTDPLFIEKASGSRIYDVDGNEFIDYVGSWGPMILG
GSA_CLOAB       ------------FEESKEYMPGGVNSPVRAYMDLNIDPPIIKSGKDSHLFDEEGKEYIDFIEAWGPMILG
GSA_CHLCH       ------------FEKAKKFIPGGVNSPVRAFKSVGGTPIYMAKGSGAYMTDVDGNTYLDYVGSWGPFILG
GSA_ALKMQ       --------SQKLFEASQEVIPGGVNSPVRAFSSVGMNPPFIKRGKGAYIYDEDGNKYIDYVGSWGPLILG
GSA_ACIBC       ------PKQEQLFKQASKHIPGGVNSPVRAFNGVGGTPVFIEKAKGAYLWDVDGKRYVDYVGSWGPMILG
GSA2_ARATH      --------SEEAFNAAKNLMPGGVNSPVRAFKSVGGQPVVMDSAKGSRIRDIDGNEYIDYVGSWGPAIIG
GSA_SODGM       --------SASLYAEAQQLIPGGVNSPVRAFNGVGGTPLFIASADGARLTDADGNSYIDYVGSWGPMVLG
GSA_PELLD       --------SAELFEKAKKFIPGGVNSPVRAFKSVGGNPIFMAKGQGAYMTDVDGNTYLDYVGSWGPFILG
GSA_NEIM0       --------NEILFDRAKAIIPGGVNSPVRAFGSVGGVPRFIKKAEGAYVWDENGTRYTDYVGSWGPAIVG
GSA_CLOP1       ------------FEESKKYMPGGVNSPVRSFGSVGINPPVIKSGKGAMIKDENGNEYIDFVLAWGPMILG
GSA_ACIBY       ------PKQEQLFKQASKHIPGGVNSPVRAFNGVGGTPVFIEKAKGAYLWDVDGKRYVDYVGSWGPMILG
GSA_ACIBT       ------PKQEQLFKQASKHIPGGVNSPVRAFNGVGGTPVFIEKAKGAYLWDVDGKRYVDYVGSWGPMILG
GSA_ACIBS       ------PKQEQLFKQASKHIPGGVNSPVRAFNGVGGTPVFIEKAKGAYLWDVDGKRYVDYVGSWGPMILG
GSA_ACIB5       ------PKQEQLFKQASKHIPGGVNSPVRAFNGVGGTPVFIEKAKGAYLWDVDGKRYVDYVGSWGPMILG
GSA_ACIB3       ------PKQEQLFKQASKHIPGGVNSPVRAFNGVGGTPVFIEKAKGAYLWDVDGKRYVDYVGSWGPMILG
GSA_SALA4       --------SENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLG
GSA_PROA2       --------SAELFEKAKQFIPGGVNSPVRAFKSVGGTPIYMAKGQGAYMTDVDGNTYLDYVGSWGPFILG
GSA_VIBVY       --------SAELYQKAQQTIPGGVNSPVRAFNGVGGSPIFVERADGAFIFDADGKAYIDYVGSWGPMILG
GSA_VIBVU       --------SAELYQKAQQTIPGGVNSPVRAFNGVGGSPIFVERADGAFIFDADGKAYIDYVGSWGPMILG
GSA_SYNS3       --------SEAIFSAAKALMPGGVSSPVRAFKSVGGQPIVFDRVKGPYAWDVDGNKYVDYIGSWGPAICG
GSA_METCA       --------STTLFADACRFIPGGVNSPVRAFRGVGGTPVFVDRAEGPYVYGVDGKAYIDYVGSWGPMILG
GSA_CLOK5       --------NDKIFEESKLYMPGGVNSPVRAFKDVPLNPPVIKKGRGAYIYDEDGNEYIDFVCSWGPMILG
GSA_CLOK1       --------NDKIFEESKLYMPGGVNSPVRAFKDVPLNPPVIKKGRGAYIYDEDGNEYIDFVCSWGPMILG
GSA_BURPP       --------NETLFERAQRTIPGGVNSPVRAFRSVGGTPRFIERAQGPYFWDADGQRYIDYIGSWGPMILG
GSA_AKKM8       --------SAQLFSRARSVIPGGVNSPVRAFRNVDGDPFFVQSAKGAYITDADGRQLIDYIGTWGPAILG
GSA_ACTP2       --------SEQLFEKAQKVIPGGVNSPVRAFKGVGGTPVFIQKAEGAYITDSDGKKYIDYVGSWGPMVLG
GSA_THEEB       --------SQEIFAAAQKLMPGGVSSPVRAFKSVGGQPIVFDHVKGAHIWDVDGNQYIDYVGSWGPAIVG
GSA_VIBCM       --------SAELYQKAQTTIPGGVNSPVRAFNGVGGSPIFIDRADGALIFDADGKAYIDYVGSWGPMILG
GSA_VIBCH       --------SAELYQKAQTTIPGGVNSPVRAFNGVGGSPIFIDRADGALIFDADGKAYIDYVGSWGPMILG
GSA_VIBC3       --------SAELYQKAQTTIPGGVNSPVRAFNGVGGSPIFIDRADGALIFDADGKAYIDYVGSWGPMILG
GSA_SYNWW       ------------FARAREYIPGGVNSPVRAFKAVGNNPLFIKEGHGSKIYDVDGNEYIDYVCSWGPLILG
GSA_SYNPX       --------SQAIFGAAQGLMPGGVSSPVRAFKSVGGQPIVFDRVKGPYAWDVDGNKYIDYIGSWGPAICG
GSA1_STAES      -------------EQAEKLMPGGVNSPVRAFKSVDTPAIFMDHGEGSKIYDIDGNEYIDYVLSWGPLILG
GSA1_STAEQ      -------------EQAEKLMPGGVNSPVRAFKSVDTPAIFMDHGEGSKIYDIDGNEYIDYVLSWGPLILG
GSA_PELTS       -KGFDRSVS--LYRQACKVIPGGVNSPVRAFKAVGLNPVFVKKGEGARIYDFDDNEYIDYVCSWGPLILG
GSA1_STAAB      --------SEEAMKVAETLMPGGVNSPVRAFKSVDTPAIFMDHGKGSKIYDIDGNEYIDYVLSWGPLILG
GSA_SYNPW       --------SQELFSAAQALMPGGVSSPVRAFRSVGGQPLVFDRVKGPYAWDVDGNKYIDYIGSWGPAICG
GSA_PSEHT       -------ISQDLFARAQASIPGGVNSPVRAFNGVGGTPLFITKAEGAFTFDADGNRYIDYVGSWGPMIMG
GSA_METFK       --------NQQLFEQSQTLIPGGVNSPVRAFGSVGGTPVFFKRGLGARLWDEDGKEYIDYVGSWGPMILG
GSA_CHLTE       --------SAELFEKAKKFIPGGVNSPVRAFKSVGGTPIYMAKGQGAYMTDVDGNTYLDYVGSWGPFILG
GSA_ALTMD       --------SEALFTRAQKTIPGGVNSPVRAFKAVGGTPRFITKADGAYMWDADGKQYIDYIQSWGPMILG
GSA_VIBPA       --------SSELYQKAQQTIPGGVNSPVRAFNGVGGSPLFIERADGALIFDADGRAYIDYVGSWGPMILG
GSA_SACD2       ------------FENAQQYIPGGVNSPVRAFKAVGGEPVFIKRAKGAYLYDINDKRYVDYVLSWGPMILG
GSA_GEOBB       ---MQNSRSTKLFQQALQSIPGGVNSPVRAFRSVGSDPLFIKKAAGPRIYDEDGNAFIDYVGSWGPMILG
GSA2_EXISA      --------SQEAFEQARPLMPGGVNSPVRAYKSVGMTPIFAERGEGSRVYDIDGNEYIDYVLSWGPLILG
GSA1_STAAU      --------SEEAMKVAETLMPGGVNSPVRAFKSVDTPAIFMDHGKGSKIYDIDGNEYIDYVLSWGPLILG
GSA1_STAAT      --------SEEAMKVAETLMPGGVNSPVRAFKSVDTPAIFMDHGKGSKIYDIDGNEYIDYVLSWGPLILG
GSA1_STAAN      --------SEEAMKVAETLMPGGVNSPVRAFKSVDTPAIFMDHGKGSKIYDIDGNEYIDYVLSWGPLILG
GSA1_STAAM      --------SEEAMKVAETLMPGGVNSPVRAFKSVDTPAIFMDHGKGSKIYDIDGNEYIDYVLSWGPLILG
GSA1_STAAE      --------SEEAMKVAETLMPGGVNSPVRAFKSVDTPAIFMDHGKGSKIYDIDGNEYIDYVLSWGPLILG
GSA1_STAAC      --------SEEAMKVAETLMPGGVNSPVRAFKSVDTPAIFMDHGKGSKIYDIDGNEYIDYVLSWGPLILG
GSA1_STAA9      --------SEEAMKVAETLMPGGVNSPVRAFKSVDTPAIFMDHGKGSKIYDIDGNEYIDYVLSWGPLILG
GSA1_STAA8      --------SEEAMKVAETLMPGGVNSPVRAFKSVDTPAIFMDHGKGSKIYDIDGNEYIDYVLSWGPLILG
GSA1_STAA3      --------SEEAMKVAETLMPGGVNSPVRAFKSVDTPAIFMDHGKGSKIYDIDGNEYIDYVLSWGPLILG
GSA1_STAA2      --------SEEAMKVAETLMPGGVNSPVRAFKSVDTPAIFMDHGKGSKIYDIDGNEYIDYVLSWGPLILG
GSA1_STAA1      --------SEEAMKVAETLMPGGVNSPVRAFKSVDTPAIFMDHGKGSKIYDIDGNEYIDYVLSWGPLILG
GSA_PROM4       -------LSQAVFNAAQDLMPGGVSSPVRAFKSVNGDPIVFDRVKGPYAWDLDGNRFIDYVGSWGPAICG
GSA_NITEU       --------NQQLFERSRQYIPGGVNSPVRAFKSVGGTPVFFQRGQGAYFWDVEGKSYIDYVGSWGPLILG
GSA_NEIMF       --------NEILFDRAKAIIPGGVNSPVRAFGSVGGVPRFIKKAEGAYVWDENGTRYTDYVGSWGPAIVG
GSA_DESPS       ---MESLKSKKLFAEAKKVIPGGVNSPVRACLSVGCDPLFIERAEGSYIYDADGQKYLDFVNSWGPMIMG
GSA_BURP8       ------PSNQELFERAQKTIPGGVNSPVRAFRSVGGTPRFIERAQGAYFWDAEGKRYIDYIGSWGPMIVG
GSA_ACIAD       ------------FEQASKHIPGGVNSPVRAFNGVGGTPVFIKKAQGAYLWDEDDKRYVDYVGSWGPMILG
GSA_SHEPW       --------SDELFEQAKKTIPGGVNSPVRAFNGVGGSPRFIEKADGAYIFDADGKKYIDYVGSWGPMILG
GSA1_STAAW      --------SEEAMKVAETLMPGGVNSPVRAFKSVDTPAIFMDHGKGSKIYDIDGNEYIDYVLSWGPLILG
GSA1_STAAS      --------SEEAMKVAETLMPGGVNSPVRAFKSVDTPAIFMDHGKGSKIYDIDGNEYIDYVLSWGPLILG
GSA1_STAAR      --------SEEAMKVAETLMPGGVNSPVRAFKSVDTPAIFMDHGKGSKIYDIDGNEYIDYVLSWGPLILG
GSA_ANAD2       ---MKTELSQKLFEKANDLFPGGVNSPVRAFKGVGGTPRFISRAKGSHIFDVDGNDYVDYVLSWGPMIVG
GSA_PSYCK       --------NEQLFAQARKHIPGGVNSPVRAFAGVGGTPIFMHRANGSKIYDTEDNAYIDYVGSWGPMILG
GSA_PELPD       ---MKQDRSSALFQQARQSIPGGVNSPVRAFKSVGSDPLFIQSASGCTITDVDGNTFIDYVGSWGPMIVG
GSA_ANASK       ---MKTELSQKLFEKANDLFPGGVNSPVRAFKGVGGTPRFISRAKGSHIFDVDGNDYVDYVLSWGPMIVG
GSA_SHEPA       --------SDELFEQAKKTIPGGVNSPVRAFSGVGGSPRFIEKADGAYIFDADGKKYIDYVGSWGPMILG
GSA_BORPE       ------------FDRACRSIPGGVNSPVRAFRSVGGTPRFIQRAQGPYVWDAEGKQYIDYVGSWGPAILG
GSA_ACIF5       --------SHALFHMAQQCIPGGVNSPVRAFRGVGGDPIFIDHAEGPFFWDVEGKRYLDYVGSWGPMIHG
GSA_ACIF2       --------SHALFHMAQQCIPGGVNSPVRAFRGVGGDPIFIDHAEGPFFWDVEGKRYLDYVGSWGPMIHG
GSA1_ANOFW      --------SEQLYQEALEHIVGGVNSPSRSYKAVGGGAPVVMRAQGAYFWDVDGNKYIDYLAAYGPIITG
GSA_SYNFM       ---MTRDRSNLLYEDAGRFIPGGVNSPVRSGRAVGTNPIFIREAKGCYLWDEDGNRYVDFVASWGPLIVG
GSA_SHEHH       --------SDELFEQAKKTIPGGVNSPVRAFSGVGGSPRFIEKADGAYIFDADGKKYIDYVGSWGPMILG
GSA_NITOC       --------SDNLFRRAQAHIPGGVNSPVRAFKGVGGEPVFFVRGEGAYLYDVDDNRYIDYVNSWGPLIVG
GSA_BORBR       ------------FDRACRSIPGGVNSPVRAFRSVGGTPRFIQRAQGPYVWDAEGKQYIDYVGSWGPAILG
GSA_VIBHB       --------SSELYQKAQQTIPGGVNSPVRAFNGVGGSPLFIERADGALIFDADGKAYIDYVGSWGPMILG
GSA_PROMA       --------SQAVFHAAQELMPGGVSSPVRAFKSVNGDPIVFDRVKGAYAWDLDGNRFIDYVGSWGPAICG
GSA_PROM1       --------SEEIFGAAKNLMPGGVSSPVRAFKSVEGDPIVFDRVKGPYAWDVDGNRYIDYVGSWGPAICG
GSA_CHRSD       --------SAQLFEQACRHIPGGVNSPVRAFKGMERAPVFVERAQGAYLYDVEGQRYIDYVGSWGPLITG
GSA_ALCBS       ---MPRKHSEQLFRQAQKHIPGGVNSPVRAFKSVGGTPVFFHSARGAHLFDEDDNKYIDYVGSWGPMILG
GSA2_BACSK      ------------FKEAQPLMPGGVNSPVRAFKSVGMNPVYMKEGKGAKIKDIDGNEYIDYVLSWGPLILG
GSA_RALEH       --------NQQLFDRAQQTIPGGVNSPVRAFRSVGGTPRFITRAEGAYMWDADGQRYIDYIGSWGPMIVG
GSA_POLSQ       ----KRDQNEVLFERAQKTIPGGVNSPVRAFRQVGGTPRFISKAKGPYFWDAENKRYIDLIMSWGPMIAG
GSA2_LYSSC      --------SKQAYAEAVQLMPGGVNSPVRAFKSVNMDPIFMESGHGAIIKDIDGNEYIDYVLSWGPLILG
GSA_SYNSC       --------SQAIFGAAQALMPGGVSSPVRAFKSVGGQPIVFDRVKGPYAWDVDGNKYIDYIGSWGPAICG
GSA_PROMT       --------SEEIFGAAKNLMPGGVSSPVRAFKSVEGDPIVFDRVKGPYAWDVDGNRYIDYVGSWGPAICG
GSA_TERTT       ------------FARAQKTIPGGVNSPVRAFKAVGGEPVFIDHAKGAYVYDIHGKRYVDYVLSWGPMLLG
GSA_DESAH       ---METTRSEALFKEAAKFIPGGVNSPVRACGSVGGSPLFIQKAEGSKIIDADGNVYIDYVGSWGPMILG
GSA1_LISIN      --------SEKAFKEAKKVLPGGVNSPVRAFNSVDASPVFMDHGKGAYITDVDGNEYIDYVLSWGPLILG
GSA_SYNS9       --------SQAIFGAAQGLMPGGVSSPVRAFKSVGGQPIVFDRVKGPYAWDVDGNKYIDYIGSWGPAICG
GSA_SYNAS       ---MTKSLSEQLFETAEGLLPGGVNSPVRAFRAVGGVPRFIDRAEGSRIYDIDGREYIDYVGSWGPMILG
GSA_NITSB       --------SEAAYKEALRYIPGGVDSPVRAFKSVGGVPPFIDRGEGAFLYDIDGNRYIDYVQSWGPLIFG
GSA_CHLT3       --------SAALFERAKKVIPGGVNSPVRAFNSVGGTPVFVTKGEGARMIDVDGNSYIDYVGSWGPFILG
GSA1_STACT      --GYEKSI-EAY-KKAEQLMPGGVNSPVRAFKSVDMPAIFMDHGKGSKIYDIDGNEYIDYVLSWGPLILG
GSA1_BACWK      --------SEALHKEALEHIVGGVNSPSRSFKAVGGSPVAMERGKGAYFWDVDGNKYIDYLAAYGPIITG
GSA_BORPA       ------------FDRACRSIPGGVNSPVRAFRSVGGTPRFIQRAQGPYVWDAEGKQYIDYVGSWGPAILG
GSA_SALRD       --------SRRFYERAQHSIPGGVNSPARAFDSVGGTPLFIERAEGAYLEDADANEYLDYVGSWGPMIFG
GSA2_BACP2      --------SKQAFEEAQHLMPGGVNSPVRAFKSVNTDPIFMERGKGAKIYDIDGNEYIDYVLSWGPLILG
GSA_SYNP2       --------SEEIFSAAQKLMPGGVSSPVRAFKSVGGQPIVFDRVKGSRVWDVDGNEYIDYVGTWGPAICG
GSA_SOLLC       -------------------MPGGVNSPVRAFKSVGGQPIIIDSVKGSRMRDIDGNEYIDYVGSWGPAIIG
GSA_METI4       ---MDFVLSEKLWKEAQEIFPGGVNSPVRSFQSVGGFPFYVSRAKGSKITDVDGNDYTDYVCSWGALIHG
GSA2_BACCR      --------SIAAFEEAQDLMPGGVNSPVRAFKSVGMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHG
GSA2_BACC4      --------SIAAFEEAQDLMPGGVNSPVRAFKSVGMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHG
GSA_PROM0       --------SEEIFSAAQELMPGGVSSPVRAFKSVGGQPIVFDRVKGPFAWDIDGNRYIDYIGSWGPAICG
GSA_CHLP8       --------SAELFEKAKKFIPGGVNSPVRAFKSVGGTPIYMAKGQGAYMTDVDGNTYLDYVGSWGPFILG
GSA2_BACCQ      --------SIAAFEEAQDLMPGGVNSPVRAFKSVGMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHG
GSA2_BACC7      --------SIAAFEEAQDLMPGGVNSPVRAFKSVGMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHG
GSA1_BACC2      --------SIAAFEEAQDLMPGGVNSPVRAFKSVGMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHG
GSA1_BACAC      --------SEALHKEALEHIVGGVNSPSRSFKAVGGGAPIAMRGKGAYFWDVDGNKYIDYLAAYGPIITG
GSA_PROMP       --------SEEVFSSALELMPGGVSSPVRAFKSVGGQPIVFDRVKGPYAWDIDGNRYIDYIGSWGPAICG
GSA_NATTJ       --------SQKYFKTACDLMPGGVNSPARAFSSVESDPLFIKDGSGSKVYDVDDNEYIDYVASYGPLILG
GSA1_BACHK      --------SEALHKEALEHIVGGVNSPSRSFKAVGGGAPVAMRGKGAYFWDVDGNKYIDYLAAYGPIITG
GSA1_BACAN      --------SEALHKEALEHIVGGVNSPSRSFKAVGGGAPIAMRGKGAYFWDVDGNKYIDYLAAYGPIITG
GSA1_BACAA      --------SEALHKEALEHIVGGVNSPSRSFKAVGGGAPIAMRGKGAYFWDVDGNKYIDYLAAYGPIITG
GSA_NEIMB       --------NEILFDRAKAIIPGGVNSPVRAFGSVGGVPRFIKKAEGAYVWDENGTRYTDYVGSWGPAIVG
GSA2_BACHK      --------SIAAFEEAQDLMPGGVNSPVRAFKSVGMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHG
GSA2_BACCZ      --------SIAAFEEAQDLMPGGVNSPVRAFKSVGMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHG
GSA2_BACC3      --------SIAAFEEAQDLMPGGVNSPVRAFKSVGMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHG
GSA2_BACC2      --------SEALHKEALEHIVGGVNSPSRSFKAVGGGAPVAMRGKGAYFWDVDGNKYIDYLAAYGPIITG
GSA2_BACC0      --------SIAAFEEAQDLMPGGVNSPVRAFKSVGMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHG
GSA2_BACAH      --------SIAAFEEAQDLMPGGVNSPVRAFKSVGMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHG
GSA1_BACCR      --------SEALHKEALEHIVGGVNSPSRSFKAVGGGAPVAMRGKGAYFWDVDGNKYIDYLAAYGPIITG
GSA1_BACC4      --------SEALHKEALEHIVGGVNSPSRSFKAVGGGAPVAMRGKGAYFWDVDGNKYIDYLAAYGPIITG
GSA1_BACC3      --------SEALHKEALEHIVGGVNSPSRSFKAVGGGAPVAMRGKGAYFWDVDGNKYIDYLAAYGPIITG
GSA1_BACAH      --------SEALHKEALEHIVGGVNSPSRSFKAVGGGAPVAMRGKGAYFWDVDGNKYIDYLAAYGPIITG
GSA_PROVI       --------SAELFEKAKKFIPGGVNSPVRAFKSVGGNPIFMAKGQGAYMTDVDGNTYLDYVGSWGPFILG
GSA_GRAFK       --------SSQLFADAQKVIPGGVNSPVRAFKAVGGEPIFIEKAEGAYIYDEDGNKLIDYINSWGPLILG
GSA2_BACC1      --------SIAAFEEAQDLMPGGVNSPVRAFKSVGMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHG
GSA1_BACCZ      --------SEALHKEALEHIVGGVNSPSRSFKAVGGGAPVAMRGKGAYFWDVDGNKYIDYLAAYGPIITG
GSA1_BACC0      --------SEALHKEALEHIVGGVNSPSRSFKAVGGGAPIAMRGKGAYFWDVDGNKYIDYLAAYGPIITG
GSA_COLP3       --------SEQLFEQAQKIIPGGVNSPVRAFNGVGGTPCFIKRAQGXXXXXXXXXXXXXXVGSWGPMILG
GSA1_BACP2      --------SEKLHQEALEHIVGGVNSPSRSYKAVGGSPVAMEKGEGAYFWDVDGNRYIDYLAAYGPIITG
GSA1_BACCN      --------SEALHKEALEHIVGGVNSPSRSFKAVGGSPVAMERGKGAYFWDVDGNKYIDYLAAYGPIITG
GSA_RALPJ       --------SAALFERAQKTIPGGVNSPVRAFRSVGGIPRFIAKAAGPYLWDADGTRYIDYVGSWGPMIVG
GSA_RALME       --------NQQLFDRAQQTIPGGVNSPVRAFRSVGGTPRFITRAEGAYMWDADGQRYIDYIGSWGPMIVG
GSA2_STAS1      --------SEKAMAKAEELMPGGVNSPVRAFKSVDTPAIFMDHGEGSRIYDIDGNEYIDYVLSWGPLILG
GSA2_BACAN      --------SIAAFEEAQDLMPGGVNSPVRAFKSVGMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHG
GSA2_BACAC      --------SIAAFEEAQDLMPGGVNSPVRAFKSVGMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHG
GSA2_BACAA      --------SIAAFEEAQDLMPGGVNSPVRAFKSVGMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHG
GSA1_BACCQ      --------SEALHKEALEHIVGGVNSPSRSFKAVGGGAPVAMRGKGAYFWDVDGNKYIDYLAAYGPIITG
GSA1_BACC7      --------SEALHKEALEHIVGGVNSPSRSFKAVGGGAPVAMRGKGAYFWDVDGNKYIDYLAAYGPIITG
GSA1_BACC1      --------SEALHKEALEHIVGGVNSPSRSFKAVGGGAPVAMRGKGAYFWDVDGNKYIDYLAAYGPIITG
GSA_PROMS       --------SEEIFSAAQQLMPGGVSSPVRAFKSVGGQPIVFDRVKGPFAWDIDGNRYIDYIGSWGPAICG
GSA_NEIG1       --------NEILFDRAKAIIPGGVNSPVRAFGSVGGVPRFIKKAEGAYVWDENGTRYTDYVGSWGPAIVG
GSA1_LISW6      -------------------LPGGVNSPVRAFNSVDATPVFMDHGKGAYITDIDGNEYIDYVLSWGPLILG
GSA1_BACA2      -------------KEALEHIVGGVNSPSRSYKAVGGSPVAMEKANGAYFWDVDGNQYIDYLAAYGPIITG
GSA1_BACLD      ---MQHTQSEKLHEEALQHIVGGVNSPSRSYKAVGGSPVAMERGSGAYFWDVDGNKYIDYLAAYGPIITG
GSA_VIBF1       --------SAELFAKAQDKIPGGVNSPVRAFAGVGGSPIFVERADGPLIFDADGKAYIDYVGSWGPMILG
GSA_PHOPR       ------------FAKAQKIIPGGVNSPVRAFAGVGGSPLFIERADGAYIFDADGKAYIDYVGSWGPMILG
GSA1_BACSK      ---MNRKTSESLYQEAQHVIVGGVNSPSRAYKGVGGTPVFMERGEGAYFYDVDGNRYIDYLAAYGPIITG
GSA_LACRJ       MSKLDTTKSKIAFKEAQKYMPGGVNSPVRAFKNVGGDPLFIDHGKDEYIYDIDGNKYIDYVLSWGPLILG
GSA_LACRD       MSKLDTTKSKIAFKEAQKYMPGGVNSPVRAFKNVGGDPLFIDHGKDEYIYDIDGNKYIDYVLSWGPLILG
GSA_DELAS       ------------FERAKAVIPGGVNSPVRAFNAVGGTPRFVRRAQGAHFWDENAQQFTDYIGSWGPMILG
GSA_BORPD       ------------FDRACRSIPGGVNSPVRAFRSVGGTPRFIKRAQGPYVWDEEDTRYIDYVGSWGPAILG
GSA_VIBFM       --------SAELFAKAQDKIPGGVNSPVRAFAGVGGSPIFVERADGPLIFDADGKAYIDYVGSWGPMILG
GSA_HERA2       --------SSAAFERAQALLPGGVNSPVRAFRGVGGVPRFIDHGAGAYLYDIDGNQYIDYVLSWGPLILG
GSA_NEIMA       --------NEILFDRAKAVIPGGVNSPVRAFGSVGGVPRFIKKAEGAYVWDENGTRYTDYVGSWGPAIVG
GSA_NEIG2       --------NEILFDRAKAIIPGGVNSPVRAFGSVGGVPRFIKKAEGAYVWDENGTRYTDYVGSWGPAIVG
GSA_CLOTE       ------------FKESEKYMPGGVNSPVRAFSNASINPPIIKKGLGSRIVDEEGKEYIDFVASWGPMILG
GSA1_LISMF      -------------------LPGGVNSPVRAFNSVDASPVFMDHGKGAYITDVDGNEYIDYVLSWGPLILG
GSA1_LISMC      -------------------LPGGVNSPVRAFNSVDASPVFMDHGKGAYITDVDGNEYIDYVLSWGPLILG
GSA_SHEWM       --------SDELFEQAKKTIPGGVNSPVRAFNGVGGSPRFIDKADGAYIYDADGKAYIDYVGSWGPMILG
GSA_JANMA       --------NDQLFARAQLSTPGGVNSPVRAFRSVGGTPRFITKAEGPYFWDADDRRYIDYIGSWGPAIVG
GSA1_EXISA      -----RQSSDALYQDALTHIVGGVNSPSRSFKAVGGAPVYMERGEGAYFYDVDGNRYIDYLAAYGPIITG
GSA2_BACCN      ------------FEEAQDLMPGGVNSPVRAFKSVGMNPLFMEQGKGSKVYDIDGNEYIDYVLSWGPLIHG
GSA1_LISMO      -------------------LPGGVNSPVRAFNSVDASPVFMDHGKGAYITDVDGNEYIDYVLSWGPLILG
GSA_DECAR       --------NQQLFERAQRHIPGGVNSPVRAFRSVGGTPCFFQKGVGAKVQDADGKWYTDYVGSWGPMILG
GSA2_BACWK      --------SIAAFEEAQNLMPGGVNSPVRAFKSVGMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHG
GSA_PROM9       --------SEEIFSAAQELMPGGVSSPVRAFKSVGGQPIVFDRVKGPFAWDIDGNRYIDYIGSWGPAICG
GSA_CLOB8       ------------FKESEEYMPGGVNSPVRAFKGVNLNPPIIKSGKGVIIKDEEDNEYIDFVLAWGPLILG
GSA2_LISMH      -------------------LPGGVNSPVRAFNSVDASPVFMDHGKGAYITDIDGNEYIDYVLSWGPLILG
GSA_PROM5       --------SEEVFSSALKLMPGGVSSPVRAFKSVGGQPIVFDRVKGPFAWDVDGNRYIDYIGSWGPAICG
GSA_NITEC       --------NQQLFERSRQYIPGGVNSPVRAFKSVGGTPIFFQRGQGACFWDVEGKSYIDYVGSWGPLILG
GSA1_EXIS2      ----KRPTSESLYEVAQKCIVGGVNSPSRSYKAVGGAPVYMERGEGAYFYDVDGNRYIDYLAAYGPIITG
GSA_PSYA2       --------NEQLFAQACKHIPGGVNSPVRAFAGVGGTPIFMHRANGSKIYDTEDNAYIDYVGSWGPMILG
GSA_GEOSF       ------------FKQAQNSIPGGVNSPVRAFKSVGRDPLFIKKASGCKIEDVDGNQFIDFVGSWGPMILG
GSA_BORA1       ------------FERASRSIPGGVNSPVRAFRSVGGTPRFIKRALGPHIWDADGKQYIDYLGSWGPAILG
GSA_XANOR       ---MNHSRSHALFAQAQTVLPGGVNSPVRAFKSVGGEPFFVARADGSYLFDVDGNRYIDYVGSWGPMIAG
GSA_XANOP       ---MNHSRSHALFAQAQTVLPGGVNSPVRAFKSVGGEPFFVARADGSYLFDVDGNRYIDYVGSWGPMIAG
GSA_XANOM       ---MNHSRSHALFAQAQTVLPGGVNSPVRAFKSVGGEPFFVARADGSYLFDVDGNRYIDYVGSWGPMIAG
GSA_VIBSL       --------SAELYEKAQQTIPGGVNSPVRAFNGVGGSPIFVERADGPLIFDADGKAYIDYVGSWGPMILG
GSA_RALEJ       --------NQQLFDRAQQTIPGGVNSPVRAFRSVGGTPRFITCAEGAYMWDADGQRYIDYIGSWGPMIVG
GSA_HAMD5       --------SNKLYDLAQCFIPGGVNSPVRAFQGVDGKPFFVEKAGGAYLYDVDGRAYIDYVGSWGPMILG
GSA_ACAM1       --------SEEIFAAAQKLMPGGVSSPVRAFKSVGGQPIVFDRVKGAHVWDVDGNQYIDYVGTWGPAICG
GSA_GEMAT       ---------------ARMRFPGGVNSPVRAFRGVGGEPFVAARGKGARIWDVDGNEYFDYVLSWGPLVLG
GSA_POLNS       --------NEALFERAQKTIPGGVNSPVRAFRQVGGIPRFVAKAKGSYFWDANDQRYIDLIMSWGPMIVG
GSA_CUPTR       --------NQQLFDRAQQTIPGGVNSPVRAFRSVGGTPRFITRAEGPYMWDADGQRYIDYIGSWGPMIVG
GSA_CLOCE       --------SNGLFDRAKKVIPGGVNSPVRAFRAVDLNPLFISRAKGSKLYDVEEREYIDYVCSWGPMILG
GSA_THICR       --------SHTLFEAAQAHIPGGVNSPVRAFKGVGGDPVFFESAKGAYLTDADGKQYIDYVASWGPAILG
GSA_GEOMG       --------SKELFAKAQEIIPGGVNSPVRAFKSVGAEPVFIKKASGSTXXXXXXXXXXXXVGSWGPMILG
GSA_METPP       ------------FERARRSIPGGVNSPVRAFRAVGGTPRFIARADGAYLWDADGKRYIDYIGSWGPMILG
GSA_FLAJ1       --------SSQLFAEAEKVIPGGVNSPVRAFKAVGGTPIFVKSAKGAYLYDEDGNKLIDYINSWGPMVLG
GSA_ROSCS       --------SESLFAEARSLFPGGVNSPVRAFRAVGGAPRFIARGEGAFLVDVDGNRYIDYVLSWGPLILG
GSA_GEOSL       --------SKDLFTQAQEFIPGGVNSPVRAFKSVGADPLFIKKAFGCTITDADNNSYIDYVGSWGPMILG
GSA2_OCEIH      ------------YKEAVDLMPGGVNSPVRAFKSVGMNPIFMKEGKGSKIVDIDNNEYIDYVLSWGPLILG
GSA_PROM2       --------SEEIFSAAQQLMPGGVSSPVRAFKSVGGQPIVFDRVKGPFAWDIDGNRYIDYIGSWGPAICG
GSA_CHLPD       --------SAELFEKAKQFIPGGVNSPVRAFKSVGGTPIYMAKGRGAYLTDVDGNSYLDYVGSWGPFILG
GSA_PSYWF       --------NEQLFLQAKKHIPGGVNSPVRAFAGVGGTPVFMHKAAGSKIYDTEDNEYIDYVGSWGPMILG
GSA_SULNB       --------SIAAFEEAYKVIPGGVDSPVRAFSGVEGTPPFIERGEGAYLFDIDGNRYIDYVQSWGPLIFG
GSA_NITMU       --------NQQLFEQSQKFIPGGVNSPVRAFKSVGGTPVFFRKGEGAYAWDADDKSYIDYVGSWGPLILG
GSA_DESDG       ---MER--SRNLFERAQKLIPGGVNSPVRACLSVDSAPVFVERGQGSKLYSVDGREYIDFVESWGPLLLG
GSAB_BACSU      --------------EALQHIVGGVNSPSRSYKAVGGSPVAMEKASGAYFWDVDGNKYIDYLAAYGPIITG
GSA_RALSO       --------SVSLFERAQKTIPGGVNSPVRAFRSVGGTPRFIAKAAGPYLWDADGTRLIDYVGSWGPMIVG
GSA_CLOPS       ------------FEESKKYMPGGVNSPVRSFGSVGINPPVIKSGKGAMIKDENGNEYIDFVLAWGPMILG
GSA_ROSS1       ---MKTTRSESLFAEAQSLFPGGVNSPVRAFRAVGGTPRFIARGEGALIFDVDGNRYIDYVLSWGPLIAG
GSA2_EXIS2      --------SKAAFERALPLMPGGVNSPVRAYKSVGMTPIFAERAQGSRLYDIDGKEYIDYVLSWGPMILG
GSA_STRMK       ---MNHDQSHALFSRAQQLLPGGVNSPVRAFKSVGGEPFFVERADGAYLYDVDGNRYIDYVGSWGPMIVG
GSA_POLNA       ----------ALFERAQKLIPGGVNSPVRAFKAVGGTPRFIQRAQGAYFWDADGQRYIDYIGSWGPMILG
GSA_HERAR       --------NEILFARAQKSTPGGVNSPVRAFRSVGGTPRFITRAEGPYFWDADDRRYIDYIGSWGPAIVG
GSA_BURTA       --------NQTLFERAQRTIPGGVNSPVRAFRSVGGTPRFVARAQGAYFWDADGKRYIDYIGSWGPMIVG
GSA_BURCJ       --------NQILFERAQKTIPGGVNSPVRAFRSVGGTPRFVARAQGPYFWDADGKQYIDYIGSWGPMIVG
GSA1_LYSSC      ---MNHAKSEAVHAEALQHIVGGVNSPSRSYKAVGGSPVAMVRGKGAYFWDVDGNRYIDYLAAYGPIVTG
GSA1_BACHD      ---MNRSRSESLFQKAQSLIVGGVNSPSRSFKAVGGAPVFMEKAKGAYFWDVDGNQYIDYLAAYGPIITG
GSA_ALISL       --------SAELFAKAQEKIPGGVNSPVRAFAGVGGSPIFIERADGPLIFDADGKAYIDYVGSWGPMILG
GSA_LEGPH       --------SSDLFHKAQTIIPGGVNSPVRAFKGVGGEPVFFKSGKGAYLTDVDDKQYIDYVGSWGPLILG
GSA_ANADE       ---MKTELSQKLFEKANDLFPGGVNSPVRAFKGVGGTPRFIARAKGSHIXXXXXXXXXXXXLSWGPMIVG
GSA_NAUPA       ------------FEEAKKYIVGGVNSPVRAFKSVGGEPPFIEKGEGAYIYDINGNKYLDYIQSWGPLIFG
GSA1_MACCJ      ---MDYSKSKQAFKEAVNLMPGGVNSPVRAFKSVDMDPIFMERGKGSKIYDIDGNEYIDYVLSWGPLILG
GSA_CHLRE       --------SEEIFKEAQELLPGGVNSPVRAFRSVGGGPIVFDRVKGAYCWDVDGNKYIDYVGSWGPAICG
GSA_AZOSE       --------NETLFQRAQKSIPGGVNSPVRAFRSVGGTPRFISRAEGARVWDADGKAYVDYVGSWGPAIAG
GSA_FRAP2       ---MENKISQSLFQEALQYIPGGVNSPVRAFKSVGQEPRFIKSAKGAYLYDVDWNKYIDYIGSWGPMILG
GSA2_MACCJ      --------SEAIQNRANAAILGGVNSPSRSYKAVGGAPVVMARGEGAYFYDVDGNKYIDYLAAYGPIITG
GSA_OPITP       -------VSDSLFERAKQLMPGGVNSPVRAFRSVGGAPFFVKAARGATLVTADDQELIDFVCTWGPAIHG
GSA_FRATT       --------SQILFAEAQQYIPGGVNSPVRAFKSVGQEPRFIKFAKGAYLYDVDWNKYIDYIGSWGPMILG
GSA_FRAT1       --------SQILFAEAQQYIPGGVNSPVRAFKSVGQEPRFIKFAKGAYLYDVDWNKYIDYIGSWGPMILG
GSA_DIAST       ------------FERAKALIPGGVNSPVRAFRAVGGTPRFITRAQGAYMWDANGQRFIDYIGSWGPMILG
GSA_MAGSM       --------SASLFQQAAGLIPGGVNSPVRAFKSVGGIPPFIREAAGAMMTDEDGKSYIDYVGSWGPMILG
GSA_LEGPC       --------SSDLFHKAQTIIPGGVNSPVRAFKGVGGEPVFFKSGKGAYLTDVDDKQYIDYVGSWGPLILG
GSA_LARHH       --------NQQLFERAKHVIPGGVNSPVRAFGSVGGSPRFIKRAQGAYMWDADDRRLIDYIGSWGPMILG
GSA_WOLSU       ---MERINSINDFNEAKQVIPGGVNSPVRAFRAVGGTPPFIKEAKGSYLVDEDGNRYIDFVQSWGPLLFG
GSA_ACISJ       ------------FERAKALIPGGVNSPVRAFRAVGGTPRFITRAQGAYMWDANGQRFIDYIGSWGPMILG
GSA_STRM5       ---MNHDQSHALFSRAQQLLPGGVNSPVRAFKSVGGEPFFVERADGAYLYDVDGNRYIDYVGSWGPMIVG
GSA_LEGPA       --------SSDLFHKAQTIIPGGVNSPVRAFKGVGGEPVFFKSGKGAYLTDVDDKQYIDYVGSWGPLILG
GSA_THEAB       ------------FEIAKKYMPGGVNSPVRAFKSVEMEPIFVKSAKKSKLIDINNKEYIDYIQSWGALILG
GSA_FRATN       --------SQILFAEAQQYIPGGVNSPVRAFKSVGQEPRFIKFAKGAYLYDVDWNKYIDYIGSWGPMILG
GSA_COXB2       --------SAALFNKAQNYMPGGVNSPVRAFGAVGGVPRFIKKASGPYLIDVDEKKYIDYVGSWGPMILG
GSA_FRATW       --------SQILFAEAQQYIPGGVNSPVRAFKSVGQEPRFIKFAKGAYLYDVDWNKYIDYIGSWGPMILG
GSA2_CLOPH      --------SEQLFERAVKHLPGGVNSPVRAFLSVGGSPRFIESADGAYIYDVDGNKYIDYINSWGPMILG
GSA_LEGPL       --------SSDLFHKAQTIIPGGVNSPVRAFKGVGGEPVFFKSGKGAYLTDVDDKQYIDYVGSWGPLILG
GSA_BURS3       --------NQILFERAQKTIPGGVNSPVRAFRSVGGTPRFVARAQGPYFWDADGKQYIDYIGSWGPMIVG
GSA_DESOH       ---MNQTRSKALFKEAAVLIPGGVNSPVRAGKAVGTTPLFIDRAQGAEIVDADGNVYIDYIGSWGPMILG
GSA_ACIAC       ------------FERAKALIPGGVNSPVRAFRAVGGTPRFVQRAQGAYFWDANGQRFIDYIGSWGPMILG
GSA_BURA4       --------NQILFERAQKTIPGGVNSPVRAFRSVGGTPRFVSRAQGPYFWDADGKQYIDYIGSWGPMIVG
GSA_RHOBA       ------PKSVAAFQRASALMPGGVNSPARAFGAVGGTPLFIERAEGPYLYDIDGNRYIDYIGSWGPMILG
GSA_FRATM       --------SQILFAEAQQYIPGGVNSPVRAFKSVGQEPRFIKFAKGAYLYDVDWNKYIDYIGSWGPMILG
GSA_BURVG       --------NQILFERAQKTIPGGVNSPVRAFRSVGGTPRFVARAQGPYFWDADGKQYIDYIGSWGPMIVG
GSA_BURCM       --------NQILFERAQKTIPGGVNSPVRAFRSVGGTPRFVSRAQGPYFWDADGKQYIDYIGSWGPMIVG
GSA_FRATO       --------SQILFAEAQQYIPGGVNSPVRAFKSVGQEPRFIKFAKGAYLYDVDWNKYIDYIGSWGPMILG
GSA_FRATF       --------SQILFAEAQQYIPGGVNSPVRAFKSVGQEPRFIKFAKGAYLYDVDWNKYIDYIGSWGPMILG
GSA_CYTH3       ---MKNKTSAGLFSRAKEVIPGGVNSPVRAFRAVGGNPLFIKRAHGAYLVDEDDNQYIELINSWGPMILG
GSA_COXBN       --------SAALFNKAQNYMPGGVNSPVRAFGAVGGVPRFIKKASGPYLIDVDEKKYIDYVGSWGPMILG
GSA_COXB1       --------SAALFNKAQNYMPGGVNSPVRAFGAVGGVPRFIKKASGPYLIDVDEKKYIDYVGSWGPMILG
GSA2_STAES      --------SERLQQLSNEYILGGVNSPSRSYKAVGGGAPVVMKGHGAYLYDVDGNKYIDYLQAYGPIITG
GSA2_STAEQ      --------SERLQQLSNEYILGGVNSPSRSYKAVGGGAPVVMKGHGAYLYDVDGNKYIDYLQAYGPIITG
GSA_FRATH       --------SQILFAEAQQYIPGGVNSPVRAFKSVGQEPRFIKFAKGAYLYDVDWNKYIDYIGSWGPMILG
GSA_LEPCP       ---MATPVSSELFERAQRSIPGGVNSPVRAFRAVGGTPRFIARAQGAYMWDAEGKQYIDYIGSWGPMILG
GSA_BURP6       --------NQTLFERAQRTIPGGVNSPVRAFRSVGGTPRFVARAQGAYFWDADGKRYIDYIGSWGPMIVG
GSA1_BREBN      ---MKRERSAQLHEQALDVILGGVNSPSRSFKAVGGGAPVTMRAQGAYFWDVDGNRYIDYLAAYGPIITG
GSA_COXBU       --------SAALFNKAQNYMPGGVNSPVRAFGAVGGVPRFIKKASGPYLIDVDEKKYIDYVGSWGPMILG
GSA_COXBR       --------SAALFNKAQNYMPGGVNSPVRAFGAVGGVPRFIKKASGPYLIDVDEKKYIDYVGSWGPMILG
GSA_BURM1       --------NQILFERAQKTIPGGVNSPVRAFRSVGGTPRFVARAQGPYFWDADGKQYIDYIGSWGPMIVG
GSA_BURCC       --------NQILFERAQKTIPGGVNSPVRAFRSVGGTPRFVARAQGPYFWDADGKQYIDYIGSWGPMIVG
GSA_DICNV       -------MTDSAFTRAARVIPGGVNSPVRAFKSVGGEPIFIARAEGAYLYDVNGRRYIDYVGSYGPMING
GSA1_STAS1      --------SEKLQKLSDEYILGGVNSPSRSYKAVGGGAPVMMRGKGAYLYDVDGNKYIDYLQAYGPIITG
GSA_BURM9       --------NQTLFERAQRTIPGGVNSPVRAFRSVGGTPRFVARAQGAYFWDADGKRYIDYIGSWGPMIVG
GSA_THEM4       ------------FEKAKEFMPGGVNSPVRAFKSVELDPIFVKSAKGSKIKDINNNEYIDYIQSWGALILG
GSA_SULDN       ------------FKEAQNLIPGGVNSPVRAFKSVGGTPLFIANGSGAYLTDIDGNRYVDFVQSWGPLLFG
GSA_BURPS       --------NQTLFERAQRTIPGGVNSPVRAFRSVGGTPRFVARAQGAYFWDADGKRYIDYIGSWGPMIVG
GSA_BURP1       --------NQTLFERAQRTIPGGVNSPVRAFRSVGGTPRFVARAQGAYFWDADGKRYIDYIGSWGPMIVG
GSA_BURMS       --------NQTLFERAQRTIPGGVNSPVRAFRSVGGTPRFVARAQGAYFWDADGKRYIDYIGSWGPMIVG
GSA_BURMA       --------NQTLFERAQRTIPGGVNSPVRAFRSVGGTPRFVARAQGAYFWDADGKRYIDYIGSWGPMIVG
GSA_BURM7       --------NQTLFERAQRTIPGGVNSPVRAFRSVGGTPRFVARAQGAYFWDADGKRYIDYIGSWGPMIVG
GSA_BURCH       --------NQILFERAQKTIPGGVNSPVRAFRSVGGTPRFVARAQGPYFWDADGKQYIDYIGSWGPMIVG
GSA_BURCA       --------NQILFERAQKTIPGGVNSPVRAFRSVGGTPRFVARAQGPYFWDADGKQYIDYIGSWGPMIVG
GSA_CALS8       --------SKEIFDNTKRYIPGGVNSPVRAFKNLSITPPVISKGKGCRIFDIDGNEYIDFVLSWGAMILG
GSA_BURP0       --------NQTLFERAQRIIPGGVNSPVRAFRSVGGTPRFVARAQGAYFWDADGKRYIDYIGSWGPMIVG
GSA_XANAC       ---MNHSRSHALFAQAQTLLPGGVNSPVRAFKSVGGEPFFVARADGPYLFDVDDNRYIDYVGSWGPMIAG
GSA_STRSV       ---MKREHSNQYFTEAQKLFPGGVNSPVRAFKAVGGHPLFIEKASGAYLHDVDGNRYIDYVLSWGPMILG
GSA_CAMLR       ------------FEEACEYIAGGVDSPVRAFASVGSNPLFIKKGKGAYISDIEDNTYIDYVQSWGPLLFG
GSA_DESVH       --------SSELFERAQQLIPGGVNSPVRACLGVDSEPLFIARAAGSRLHTVDGETFIDFVESWGPMLLG
GSA2_LISIN      ---MDHSMSKKLHDEALLHIVGGVNSPSRSNKGVGGIPVTMERANGAYFYDVDGNKYIDYLAAFGPIITG
GSA_STRCO       ----EAPASQALFDRAAAVTPGGVNSPVRAFRAVGGTPRFMVSGTGPYLTDADGREYVDLVCSWGPMILG
GSA_ARCB4       ---------EAY-TKACEVIPGGVDSPVRAFKSVGGTPPFIKKGKGAYLYDVDGNKYVDFVQSWGPLIFG
GSA_ANATD       --------SKEVFDNTKRYIPGGVNSPVRAFKNLSITPPVISKGKGCRIFDIDGNEYIDFVLSWGAMILG
GSA1_LISMH      ---MDHSMSKKLHDEALLHIVGGVNSPSRSNKGVGGIPVTMERASGAYFYDVDGNKYIDYLAAFGPIITG
GSA_DESVV       --------SSELFERAQQLIPGGVNSPVRACLGVDSEPLFIARAAGSRLHTVDGETFIDFVESWGPMLLG
GSA_XANCH       ---MNHSRSHALFAQAQTLLPGGVNSPVRAFKSVGGEPFFVARADGPYLFDVDDNRYIDYVGSWGPMIAG
GSA_HELPG       ------------FNEAKQVIAGGVNSPVRAFKSVKGTPPFILKGKGAYLYDVDNNHYIDFVQSWGPLIFG
GSA_METAC       --------SRQMYEKAKTLIPGGVSSPVRAIKPY---PFYTASADGSKIRDLDGNEYIDYCLAYGPAVLG
GSA2_LISMC      ---MDHSMSKKLHDEALLHIVGGVNSPSRSNKGVGGIPVTMERASGAYFYDVDGNKYIDYLAAFGPIITG
GSA2_LISMF      ---MDHSMSKKLHDEALLHIVGGVNSPSRSNKGVGGIPVTMERASGAYFYDVDGNKYIDYLAAFGPIITG
GSA2_LISW6      ---MDHSMSKKLHDEALLHIVGGVNSPSRSNKGVGGIPVTMERANGAYFYDVDGNKYIDYLAAFGPIITG
GSA2_LISMO      ---MDHSMSKKLHDEALLHIVGGVNSPSRSNKGVGGIPVTMERASGAYFYDVDGNKYIDYLAAFGPIITG
GSA_XANC5       ---MNHSRSHALFAQAQTLLPGGVNSPVRAFKSVGGEPFFVARADGPYLFDVDDNRYIDYVGSWGPMIAG
GSA_HELPH       ------------FNEAKQVIAGGVNSPVRAFKSVKGTPPFILKGKGAYLYDVDNNHYIDFVQSWGPLIFG
GSA_DESVM       --------SKELFERAQQLIPGGVNSPVRACLGVDSDPLFVAHAKGSHLTTVDGTSFVDYVQSWGPMLLG
GSA_STRGG       ----EAPVSQSLFDRASVVTPGGVNSPVRAFRAVGGTPRFMVSGTGPYLTDADGREYVDLVCSWGPMILG
GSA_ARCFU       --------SRKLYAEALNLMPGGVSSPVRAFKP---HPFYTARGKGSKIYDVDGNAYIDYCMAYGPLVLG
GSA_HELP2       ------------FNEAKQVIAGGVNSPVRAFKSVKGTPPFILKGKGAYLYDVDNNHYIDFVQSWGPLIFG
GSA2_STAHJ      ---------------AENLMPGGVNSPVRAFKSVDTPAIFMDHAKGSRIYDIDGNEYIDYVLSWGPLILG
GSA_XANCP       ---MNHSRSHALFSQAQNLMPGGVNSPVRAFKSVGGEPFFVARADGAYLFDVDGNRYIDYVGSWGPMIAG
GSA_XANCB       ---MNHSRSHALFSQAQNLMPGGVNSPVRAFKSVGGEPFFVARADGAYLFDVDGNRYIDYVGSWGPMIAG
GSA_XANC8       ---MNHSRSHALFSQAQNLMPGGVNSPVRAFKSVGGEPFFVARADGAYLFDVDGNRYIDYVGSWGPMIAG
GSA_HELPJ       ------------FNEAKQVIAGGVNSPVRAFKSVKGTPPFILKGKGAYLYDVDNNHYIDFVQSWGPLIFG
GSA_CHLAD       --------SQANFAAAQAVIPGGVNSPVRAFRGVGGSPIFFERGQGAHIWDVDGNRYIDYVLSWGPLLLG
GSA_METJA       --------SKELFEEAKKYLVGGVNSPVRYFKPY---PFFVEKAKDCYLFDVDGNCYIDYCLAYGPMVLG
GSA_METMA       --------SRQMYEKAKTLIPGGVSSPVRAIKPY---PFYTASANGSKIRDLDGNEYIDYCLAYGPAILG
GSA_FRASN       ------PASDDLFRRAQRVVPGGVNSPVRAFRAVGGTPRFMTSGSGPRLVDADGRTYVDLVCSWGPMILG
GSA_HELAH       ------------FNEAKQVIVGGVNSPVRAFKSVKGTPPFILKGKGAYLYDVDNNHYIDFVQSWGPLIFG
GSA_NOCSJ       --------------------PGGVNSPVRAFNAVGGTPRFIRSARGAWLTDADGNEYVDLICSWGPMLLG
GSA_MYCS2       --------SAQLFADACAVIPGGVNSPVRAFNSVGGTPRFITSAGGYWLTDADGNRYIDLVCSWGPMLLG
GSA_HELPY       ------------FNEAKQVIAGGVNSPVRAFKSVKGTPPFILKGKGAYLYDVDNNHYIDFVQSWGPLIFG
GSA_RHOFD       --------NQILFERAKRVIPGGVNSPVRAFKAVGGTPRFVKRAQGAYFWDANNQRYTDFIGSWGPMILG
GSA_HELPS       ------------FNEAKQVIAGGVNSPVRAFKSVKGTPPFILKGKGAYLYDVDNNHYIDFVQSWGPLIFG
GSA_STRAW       ----EAPVSQTLFERAAAVTPGGVNSPVRAFRAVGGTPRFMVSGNGPYLTDADGRTYVDLVCSWGPMILG
GSA1_STAHJ      --------SERLQQLSNEYILGGVNSPSRSYKAVGGGAPVVMRGHGAYLYDVDGNKFIDYLQAYGPIITG
GSA_POLSJ       ----------ALFERAKKLIPGGVNSPVRAFKAVGGTPRFVQRAQGAYFWDADDQRYIDYIGSWGPMILG
GSA_METBF       --------SRQMYEKAKTLIPGGVSSPVRAIKPY---PFYTASANGSKIKDLDGNEYIDYCLAYGPALLG
GSA1_OCEIH      --------SEKLHQEALQHIVGGVNSPSRAYKAVGGSPVYMERGQGAYFWDVDDNKYIDYLAAYGPIITG
GSA_PROFF       -------VSDELFAEALKVMPGGVSSPVRAYRSVGGTPRFVKRALGSHIVDVDDKRYVDLVCSWGPMIAG
GSA_FUSNN       ------------YKKAVELIPGGVNSPVRAFKSVNREAPFIKKGQGAKIWDEDDNEYIDYICSWGPLILG
GSA_CAMFF       ------------FLEAKTYIPGGVDSPVRAFGSVGSDPVFIDHGNGEFLYDIEGNEYIDYVLSWGPLIFG
GSA2_STACT      ---MEFTESERLQSLSDEYILGGVNSPSRSYKAVGGGAPVVMKGKGQYLYDVDGNRYIDYLQAYGPIITG
GSA2_STAAW      --------SERLQQLSNEYILGGVNSPSRSYKAVGGGAPVVMKGHGAYLYDVDGNKFIDYLQAYGPIITG
GSA2_STAAS      --------SERLQQLSNEYILGGVNSPSRSYKAVGGGAPVVMKGHGAYLYDVDGNKFIDYLQAYGPIITG
GSA2_STAAN      --------SERLQQLSNEYILGGVNSPSRSYKAVGGGAPVVMKGHGAYLYDVDGNKFIDYLQAYGPIIAG
GSA2_STAAM      --------SERLQQLSNEYILGGVNSPSRSYKAVGGGAPVVMKGHGAYLYDVDGNKFIDYLQAYGPIIAG
GSA2_STAA9      --------SERLQQLSNEYILGGVNSPSRSYKAVGGGAPVVMKGHGAYLYDVDGNKFIDYLQAYGPIIAG
GSA2_STAA2      --------SERLQQLSNEYILGGVNSPSRSYKAVGGGAPVVMKGHGAYLYDVDGNKFIDYLQAYGPIIAG
GSA2_STAA1      --------SERLQQLSNEYILGGVNSPSRSYKAVGGGAPVVMKGHGAYLYDVDGNKFIDYLQAYGPIIAG
GSA2_STAAT      --------SERLQQLSNEYILGGVNSPSRSYKAVGGGAPVVMKGHGAYLYDVDGNKFIDYLQAYGPIITG
GSA2_STAAR      --------SERLQQLSNEYILGGVNSPSRSYKAVGGGAPVVMKGHGAYLYDVDGNKFIDYLQAYGPIITG
GSA2_STAAE      --------SERLQQLSNEYILGGVNSPSRSYKAVGGGAPVVMKGHGAYLYDVDGNKFIDYLQAYGPIITG
GSA2_STAAC      --------SERLQQLSNEYILGGVNSPSRSYKAVGGGAPVVMKGHGAYLYDVDGNKFIDYLQAYGPIITG
GSA2_STAAB      --------SERLQQLSNEYILGGVNSPSRSYKAVGGGAPVVMKGRGAYLYDVDGNKFIDYLQAYGPIITG
GSA2_STAA8      --------SERLQQLSNEYILGGVNSPSRSYKAVGGGAPVVMKGHGAYLYDVDGNKFIDYLQAYGPIITG
GSA2_STAA3      --------SERLQQLSNEYILGGVNSPSRSYKAVGGGAPVVMKGHGAYLYDVDGNKFIDYLQAYGPIITG
GSA_METVS       ------------FNESKKYLVGGVNSPVRSFKPF---PFFVKSAKSCFLYDEDGNEFIDYCLAYGPMVLG
GSA_ARTAT       ------PVSDQLFDRARSLMPGGVNSPVRAFGSVGGTPKFMVSAKGAYLTDADGKEYVDLVCSWGPALLG
GSA_METTP       --------SRSLYERAKRLMPGGVSSPVRAIRPY---PFYVKRAEGPYLWDEDGNSFIDYCLAYGPMILG
GSA_LEIXX       ----------AQFGRAQRVIPGGVNSPVRAFRSVGGTPRFMVFANGPYIVDAEGREYVDLVASWGPAILG
GSA_PARUW       ---ISRPISQQIYSNLNRVIPGGVNSPVRACANMGQIPMIIDHAYRDTLVDVDGKTYVDYCGSWGALIHG
GSA_METM5       --------SKELFEESKKYLVGGVNSPVRSFKPF---PFFVKSAKDCFLYDEDGNEFIDYCLAYGPMVLG
GSA_CAMJR       ------------FKEACKFIAGGVNSPVRAFANVQSEPKFISHGKGAYIFDIDGNSYIDYVQSWGPLLFG
GSA_MYCVP       -------LSAKLFADACSVIPGGVNSPVRAFSSVGGTPRFITSANGCWLTDADGNRYVDLVCSWGPMILG
GSA_MYCSS       --------SARLFADACAVIPGGVNSPVRAFNAVGGTPRFITSANGYWLTDADDNRYVDLVCSWGPMILG
GSA_MYCSK       --------SARLFADACAVIPGGVNSPVRAFNAVGGTPRFITSANGYWLTDADDNRYVDLVCSWGPMILG
GSA_MYCSJ       --------SARLFADACAVIPGGVNSPVRAFNAVGGTPRFITSANGYWLTDADDNRYVDLVCSWGPMILG
GSA_METMP       --------SKELFEESKKYLVGGVNSPVRLFKPF---PFFVKSAKDCFLYDEDGNEFIDYCLAYGPMVLG
GSA_CAMJJ       ------------FKEACKFIAGGVNSPVRAFANVQSEPKFISHGKGAYIFDIDGNSYIDYVQSWGPLLFG
GSA_CAMJ8       ------------FKEACKFIAGGVNSPVRAFANVQSEPKFISHGKGAYIFDIDGNSYIDYVQSWGPLLFG
GSA_METM6       --------SKELFEESKKYLVGGVNSPVRSFKPF---PFFVKSAKDCFLYDEDGNEFIDYCLAYGPMVLG
GSA_METM7       --------SRELFEESRKYLVGGVNSPVRSFKPF---PFFVKSAKDCFLYDEDGNEFIDYCLAYGPMVLG
GSA_META3       --------SKKLFEESQKYLVKGVNSPVRYFKPF---PFFVNNAKDYYLVDVDGNKYIDYCLAYGPAVLG
GSA_CHLSY       --------SQADYAAAREVIPGGVNSPVRAFRGVGGIPIFFERGQGAYVWDVDGNRYIDYVLSWGPLLLG
GSA_CHLAA       --------SQADYAAAREVIPGGVNSPVRAFRGVGGIPIFFERGQGAYVWDVDGNRYIDYVLSWGPLLLG
GSA_METBU       --------SKDLFDKARKILPGGVSSPVRAIKPY---PFYTESANGCRIKDVDGNEYIDYCLAYGPNILG
GSA_CAMJE       ------------FKETCKFIAGGVNSPVRAFANVQSEPKFISHGKGAYIFDIDGNSYIDYVQSWGPLLFG
GSA_CAMC5       ------------FSEAKKFIAGGVNSPVRAFGSVGGEPIIIDHGKGAYIYDIEGKKYLDFIQSWGPLIFG
GSA_CAMJD       ------------FKEACKFIAGGVNSPVRAFANVQSEPKFISHGKGAYIFDIDGNSYIDYVQSWGPLLFG
GSA_SYMTH       --------SAALYERAVARIVGGVNSPARSFKSVGGAPVFMARGQGPYLYDVDGNRYIDYIXXXXXXXXX
GSA_ARTS2       ------PRNEALFDRARQLMPGGVNSPVRAFGSVGGTPRFMVSAKGAYLTDADGAEYVDLVCSWGPALLG
GSA_METST       --------SKELFDEAVNYLPGGVNSPVRAYKPY---PFFAKSAKGSKIYDVDGNEYIDYCLGYGPLLFG
GSA_CAMC1       ------------FSEAKKYIPGGVNSPVRAFGSVGGEPVMIDHARGAYLYDVEGKKYLDFIQSWGPLIFG
GSA_CALMQ       ------------FKEALSLFPGGVNSPVRAMKHLP-TPLIVKRAEGAFLYTIDGVKLIDYCMGFGPLILG
GSA_MYCUA       --------SAQLFTDACAVIPGGVNSPVRAFTAVGGTPRFITEAHGCWLTDADGNRYADLVCSWGPMILG
GSA_MYCGI       --------SAKLFADASSVIPGGVNSPVRAFNSVGGTPRFITSAKGCRLTDVDGNQYVDLVCSWGPMILG
GSA_IGNH4       ------------FQIAKNLFPGGVNSPIRA--AVKPYPFYVKKASGATLVTVDGVELIDYVLGYGPLILG
GSA_SALTO       --------SEALFDRACAIVPGGVNSPVRAFRAVGGTPRFIVRGEGPWLYDADGRRYVDLVCSWGPMILG
GSA_NOCFA       -------------------IPGGVNSPVRAFRSVGGTPRFIASADGYTLTDADGNEYVDLVCSWGPMILG
GSA_KOCRD       -------VSQELFDRARRVMPGGVNSPVRAFNSVGGTPPFIAAAKGPYLTDVDGREYVDLVCSWGPALIG
GSA_VEREI       ------------FERAKALIPGGVNSPVRAFKAVGGTPRFVKRARGAYFWDANDQRFIDYIGSWGPMILG
GSA_COREF       -----------WFEKAKMFTPGGVNSPVRAFGSVGGQARFIDRAHGSTLIDVDGNEYVDLVCSWGPMLMG
GSA_CORDI       --------SQELFARAQQFTPGGVNSPVRAFGSVGGHARFIQSAKGSKLYDVDGNEYVDLVCSWGPMLLG
GSA_ACIC1       -------VSAACFERARARIPGGVNSPVRAFRAVGGTPRFIQSGAGPYLVDVDGNRYVDLVCSWGPLILG
GSA_METTH       --------SEELFRRASNVLPGGVSSPVRRFDP---HPFFAAGGSGCLLESVDGESYIDYCLAYGPLILG
GSA_LAWIP       ---MQEESSKELYSKAVKLIPGGVNSPVRACRNVGCEPVFIESAKGAYLTTVDGQELLDFVLSWGAIILG
GSA_THEFY       --------SHELFNRARSVIPGGVNSPVRAFKAVGGTPPFMVSGKGPYLTDADGNTYVDLICSWGPLILG
GSA_MYCLE       -------ISAKLFEDACAVIPGGVNSPVRAFSAVGGTPLFITEARGCWLTDADGRRYVDLVCSWGPMILG
GSA_MYCLB       -------ISAKLFEDACAVIPGGVNSPVRAFSAVGGTPLFITEARGCWLTDADGRRYVDLVCSWGPMILG
GSA_MYCMM       --------SAQLFTDACAVIPGGVNSPVRAFTAVGGTPRFITEAHGCWLTDADGNRYADLVCSWGPMILG
GSA_ARTCA       ------PRNEELFDRARQLMPGGVNSPVRAFGSVGGTPRFMVSAKGPYLMDADGNEYVDLVCSWGPALLG
GSA_HYPBU       ---MPGEVSRSLYEKALTLFPGGVNSPVRA--AVKPYPFYVERAEGPYIYTVDGEKLIDYVLAYGPLILG
GSA_SALAI       -------------------VPGGVNSPVRAFRAVGGTPRFMVRGEGPWLYDADGRRYVDLVCSWGPMILG
GSA_METKA       ----EFPESLELFKRAERVMPGGVSSPVRRFDPY---PFYVERAEGSRLYTVDGHVLIDYCLAFGPLILG
GSA_THEAC       --------SKDLFQRGSSLFPMGVNSPVRYFKDY---PFYVDNASGSRIYDVDGNEYIDYCLAYGPSILG
GSA_PYRAR       ------------FERARQVFPGGVNSPARALKHL---PSSLVAASGPYLY-TDRGRLVDYCMAFGAIILG
GSA_RHOSR       --------SAQLFERADLVIPGGVNSPVRAFHSVGGTPRFIKEASGYTLTDVDGNDYVDLICSWGPMILG
GSA_PYRAE       ------------FERAKSVFPGGVNSPARALKHLP-SPLVAKAASGAYLY-TDRGKLVDYCMAFGAIILG
GSA_METMJ       --------SSELFNRAKTLMPGGVSSPVRAIKPY---PFYVERAAGSHLTTVDGADLIDCCLGYGPLILG
GSA_MYCA1       ------------FDDACAVIPGGVNSPVRAFTAVGGTPPFITAARGCRLTDADGNHYVDLVCSWGPMILG
GSA_HELHP       ------------FNEAKQVIPGGVNSPVRAFGSVGGTPRFIAKGKGAXXXXXXXXXXXXFVQSWGPLIFG
GSA_CORU7       -------------------IPGGVNSPVRAFGSVGGTSPFITSASGSQLQDADGLSYVDLVCSWGPMIHG
GSA_KINRD       ------------FERAAAVIPGGVNSPVRAFRAVGGTPRFTASARGPYLTDADGREYVDLLCSWGPMILG
GSA_MYCPA       ------------FDDACAVIPGGVNSPVRAFTAVGGTPPFITAARGCRLTDADGNHYVDLVCSWGPMILG
GSA_METPE       -----KTVSEDLYQKARGLMPGGVSSPVRA---IAPYPFYTARGSGAVLTTIDGTDLIDCCLAYGPLILG
GSA_RHOOB       --------SAQLFERADLVIPGGVNSPVRAFHSVGGTPRFIREASGYTLTDVDGNDYVDLICSWGPMILG
GSA_METS3       --------SKDLFQESKKFIPGGVSSPVRAFEPY---PFFVKKASGSKIYDVDGNKYIDHCLAYGPLILG
GSA_CORJK       ---------EKAFDRARSLIPGGVNSPVRAFGSVGGTPPFITSAQGSTLHDVDGNSYVDLFCSWGPMIHG
GSA_PYRIL       ------------FERARGVFPGGVNSPARALKHLAA--PLVAKGSGPYLY-TDRGRLVDYCMAFGAIILG
GSA_CAMHC       ------------FSEALKVIPGGVDSPVRAFKNVGSEPFMVQKGKGAYIYDIEGNKYLDFVQSWGPLIFG
GSA_THENV       ------------FERARGVFPGGVNSPARALKHLAA--PLVANGSGPYLY-TDRGRLVDYCMAFGAIILG
GSA_RENSM       --------SQELFDHARELMPGGVNSPVRAFGSVGGTPRFITSAQGAYLTDADGRDYVDLVCSWGPALLG
GSA_PROAC       ------------FSAAQAVIPGGVDSPVRAYGSVGGVPRFIEKAQGPWIWDAEGTRYVDLVCTWGPALLG
GSA_SULSO       --------SEELWAQAKQLFAGGVNSPVRA--AVKPFPFYVERGKGAYIYTVDGKKFIDYVLGYGPLILG
GSA_PICTO       ------------FSEALKLFPSGVNSPVRFYRPV---PVMFERGRGSRIYDVNGKEYIDYSLGFGPMILG
GSA_THEVO       --------SKELFELAAKLFPMGVNSPVRYFKDY----PFYVKGKGSTILDVDGNKYIDYCLGYGPLILG
GSA_FRASC       ------PASEELFRRAERVVPGGVNSPVRAFRAVGGTPRFMVAGNGPYLTDADGRTYIDLVCSWGPMILG
GSA_MYCA9       ----ETPNSARLFADASTVIPGGVNSPVRAFAAVGGVPRFVRSGAGCWLTDVDDNRYVDLVCSWGPLILG
GSA_RHOE4       --------SARLFERAGNVIPGGVNSPVRAFGSVGGTPRFIREASGYTLTDVDGNNYVDLVSSWGPMILG
GSA_CORA7       -----------WFERATKVTPGGVNSPVRAFGSVGGQARVIARGEGSRLWDIDGNEYVDLVSSYGPMIHG
GSA_UNCMA       ---MKQDHSAQLYDEAKSLFPGGVSSPVRAIKPF---PFFTKSASGSHITDVDGNEYIDCCLAYGPLILG
GSA_TROWT       -----------WFEEAKRFIPGGVNSPVRAYAAVGGTPRFLAKAQGAYVTDIEGREYVDLVSSWGPLILG
GSA_TROW8       -----------WFEEAKRFIPGGVNSPVRAYAAVGGTPRFLAKAQGAYVTDIEGREYVDLVSSWGPLILG
GSA_MYCTU       --------SAQLFEAACSVIPGGVNSPVRAFTAVGGTPRFITEAHGCWLIDADGNRYVDLVCSWGPMILG
GSA_MYCTA       --------SAQLFEAACSVIPGGVNSPVRAFTAVGGTPRFITEAHGCWLIDADGNRYVDLVCSWGPMILG
GSA_MYCBT       --------SAQLFEAACSVIPGGVNSPVRAFTAVGGTPRFITEAHGCWLIDADGNRYVDLVCSWGPMILG
GSA_MYCBP       --------SAQLFEAACSVIPGGVNSPVRAFTAVGGTPRFITEAHGCWLIDADGNRYVDLVCSWGPMILG
GSA_MYCBO       --------SAQLFEAACSVIPGGVNSPVRAFTAVGGTPRFITEAHGCWLIDADGNRYVDLVCSWGPMILG
GSA_CORGB       --------SAEWFEKAQKLTPGGVNSPVRAFGSVGGQARFIEKAHGSTLIDVDGNEYVDLVCSWGPMLMG
GSA_SACEN       ------PRSRELFDRALAVTPGGVNSPVRAFHSVGGTPRFMVRGEGTYLWDADDNRYVDLVSSWGPMING
GSA_PYRCJ       ------------FERAKAVFPGGVNSPARALKHLP-TPLVAKAASGPYLY-TDRGRLVDFCLAFGAIILG
GSA_SULIY       --------SEELWAQARQLFAGGVNSPVRA--AVKPFPFYVERGKGAYIYTVEGNKFIDYVLGYGPLILG
GSA_SULIN       --------SEELWAQARQLFAGGVNSPVRA--AVKPFPFYVERGKGAYIYTVEGNKFIDYVLGYGPLILG
GSA_SULIL       --------SEELWAQARQLFAGGVNSPVRA--AVKPFPFYVERGKGAYIYTVEGNKFIDYVLGYGPLILG
GSA_SULIK       --------SEELWAQARQLFAGGVNSPVRA--AVKPFPFYVERGKGAYIYTVEGNKFIDYVLGYGPLILG
GSA_SULIM       --------SEELWAQARQLFAGGVNSPVRA--AVKPFPFYVERGKGAYIYTVEGNKFIDYVLGYGPLILG
GSA_SULIA       --------SEELWAQARQLFAGGVNSPVRA--AVKPFPFYVERGKGAYIYTVEGNKFIDYVLGYGPLILG
GSA_METB6       --------SEELFSQAKELMPGGVSSPVRAIKPY---PFYTAHAQGAHITTVDGEDLIDCCMAYGPLLLG
GSA_CORGL       --------SAEWFEKAQKLTPGGVNSPVRAFGSVGGQARFIEKAHGSTLIDVDGNEYVDLVCSWGPMLMG
GSA_NITMS       ------------FSDAKKVIPSGVNSPVRYFEPY---PFFTKKANGAYIWDVDNRKLIDFCNGYGALLLG
GSA_METHJ       --------SREYYTIARDLMPGGVSSPVRAIQPY---PFYTVRGSGSRIYTVDGTELIDCCGAYGPLILG
GSA_AERPE       --------SRMLFERTKELFPGGVNSPVRA--AVKPYPFYVKRGEGAYLYTVDGARIVDLVLAYGPLILG
GSA_METS5       -------MSSDLWNKAQAVFAGGVNSPVRA--AVKPFPFYTRSAKGAYLVTEDSRRLIDFVLGYGPLILG
GSA_FRAAA       ------PASEELFRRAERVVPGGVNSPVRAFRAVGGTPRFMVSGNGPYLTDADGRTYVDLVCSWGPMILG
GSA_METLZ       --------SEELFTTAKTCLPGGVSSPVRAIKPY----PFYVKSRGATLETEDGESLVDCCMGYGPLLLG
GSA_WIGBR       ---IKNSITNKLYVEAKKIIPGGVNSPARSFYFVKEIPVIAKRSKGPYIFDVDNNKYIDYICSWGASILG
GSA_SULAC       -------MSEKYWNIASHYFAGGVNSPVRA--AVKPYPFYVERAEGAYLYTADNKQLIDYVLGYGPLILG
GSA_SULTO       -------LSENLWKKALELFAGGVNSPVRA--AVKPYPFYVEKSEGAFLYTIDGQRLIDYVLGYGPLILG
GSA_CHLPN       ------------FEEACQVFPGGVNSPVRACRSVGVTPPIVSSAQGDIFLDTHGREFIDFCGGWGALIHG
GSA_LEPBP       --------SETLFQRSKQVVPGGVHSPVRSFSSVGGTPIFFSEARGAYLKSVEGNDFIDYCLSFGPLLFG
GSA_LEPBA       --------SETLFQRSKQVVPGGVHSPVRSFSSVGGTPIFFSEARGAYLKSVEGNDFIDYCLSFGPLLFG
GSA_LEPIC       --------SEELFERAKKVSPGGVHSPVRSFRSVGGTPVFFASAKGATLTDISGKEYIDYCLSFGPLILG
GSA_LEPIN       --------SEELFERAKKVSPGGVHSPVRSFRSVGGTPVFFASAKGATLTDISGKEYIDYCLSFGPLILG
GSA_DESDA       -------VSRQLFEKAQAVIPGGVNSPVRACHNVDSQPLFIAEAHGCHLTDVDGRQYIDFVLSWGPMILG
GSA_CLAM3       --------SQDLFDRARDVIPGGVNSPVRAFGSVGGTPRMMVKAAGPYVTDADGVEYVDLVNSWGPAILG
GSA_CLAMS       --------SQDLFDRARDVIPGGVNSPVRAFGSVGGTPRMMVRAAGPYVTDADGVEYVDLVNSWGPAILG
GSA_LEPBL       --------SEELFERAKIVSPGGVHSPVRSFRSVGGTPVFFVSANGATLTDVSGKEYVDFCLSFGPLILG
GSA_LEPBJ       --------SEELFERAKIVSPGGVHSPVRSFRSVGGTPVFFVSANGATLTDVSGKEYVDFCLSFGPLILG
GSA_CHLTB       ------------FSKACQYFPGGVNSPVRACRAVNITPPIVARASKEVFIDSLDKTFIDFCGSWGSLIHG
GSA_CHLT2       ------------FSKACQYFPGGVNSPVRACRAVNITPPIVARASKEVFIDSLDKTFIDFCGSWGSLIHG
GSA_BDEBA       ---MHKVTSEELFQRALKVAPGGVHSPVRSFKGLDRAPVFFKKAEGAYLTSVEDKKYIDFCQSFGPLILG
GSA_CHLTA       ------------FSKACQYFPGGVNSPVRACRAVNITPPIVARASKEVFVDSLDKTFIDFCGSWGSLIHG
GSA_HALWD       --------SRALYDRALSVMPGGVNSSVRATQPY---PFFIERGDGATVIDADGTRYLDYVMGYGPLLYG
GSA_CHLTR       ------------FSKACQYFPGGVNSPVRACRAVNITPPIVARASKEVFVDSLDKTFIDFCGSWGSLIHG
GSA_HALLT       ---MNHERSRGLYDRALSVMPGGVNSSVRATMP---HPFFIERGDGGHVIDADGNRYVDWVMGYGPLLYG
GSA_HALMA       -------------------------------------PFFVEKGDGGHVIDADGNRYIDFVMGYGPLLLG
GSA_CHLMU       ------------FSKACQYFPGGVNSPVRACRSVDITPPVVTRASGDFFTDSQGKTYIDFCGSWGSLIHG
GSA_NATPD       --------SRSLYDRALSVLPGGVNSAVRA--APQPYPVFADHGDGGHVIDADGNRYIDWIQGLGPLLLG
GSA_CHLFF       ------------YAEACRYFPGGVNSPIRACLPVRIVPPIVSSACRDIFIDSFGNNFIDFCGSWGSLIHG
GSA_CHLCV       ------------YTEACRYFPGGVNSPIRACIPVGIVPPIVSSASRDVFIDSFGKNFIDFCGSWGSLIHG
GSA_CHLAB       ------------YAEACRYFPGGVNSPIRACIPVGILPPIVSSAHRDIFIDSFGKTFIDFCGSWGSLIHG
GSA1_CENSY      --------SRGLFERARKVIPSGVNSPVRXXXXXXXXXXXXXGGS---IRDADGRKYTDLCNGYGALLLG
GSA_HALSA       ---MNRETSRELYDRSLDVLVGGVNSTVRA--APQPYPTFVQSGDGGHVIDADGNRYIDWVMXXXXXXXX
GSA_HALS3       ---MNRETSRELYDRSLDVLVGGVNSTVRA--APQPYPTFVQSGDGGHVIDADGNRYIDWVMXXXXXXXX
GSA2_CENSY      --------SARIFARSKKYHVGGVSHNIRFYEPY----PFVTRSSGKHLVDVDGNKYVDYWMGHWSLILG
MYCA_BACSU      -------------------------------------PIIAERSDGSRMWDIDGNEYIDITMGFGVNLFG
ARGD_ARCFU      ------------------------------------------RGEGCYVYDVNGKRYLDLVAGIATVSIG
ARGD_PYRAB      ----------------------------------------IVRGEGIYVWDSEGKRYLDLIAGIGVAILG
ARGD_SULTO      ----------------------------------------IVKGEGQYVWDISGTKYLDLHTGIGVAFLG
ARGD_METTH      -------------------------------------PIVLSHGKGATVWDIEGNSYIDCFAGVAVNSIG
ARGD_METKA      -------------------------------------PVTLVPGEGARVWDDEGNEYIDLVAGIAVNVLG
ARGD_PYRFU      ----------------------------------------LVKGEGIYVWDSQGKKYIDLIAGIGVNVLG
ARGD_PYRHO      ----------------------------------------IIKGEGIYVWDDQGRRYVDLIAGIGVAILG
YKAB_BACPF      ----------------------------------------VVKEEGCYYYGVDGVKYLDFTSGIAVTNVG
GABT_BACSU      -----------------------------------GNRSLAVKGEGAELYDLDGRRFIDFAGAIGTLNVG
ARGD_THET8      ----------------------------------------IVRGQGARVWDAEGNEYIDCVGGYGVANLG
ARGD_THET2      ----------------------------------------IVRGQGARVWDAEGNEYIDCVGGYGVANLG
YC7B_SCHPO      ------PKSNDFHCKACDSLPGGNT---RTVLHGAPFPIFIEAGYGSKLRDVDGHEYTDFLNELTAGIYG
GABT_ECOLI      -------------------------------------PIFADRAENCRVWDVEGREYLDFAGGIAVLNTG
ARGD_PYRKO      ----------------------------------------LVRGEGVYVWDEKGRRYLDLIAGIGVNVLG
ARGD_PYRAE      ----------------------------------------IVKGFMQYVWDDKGQRYIDCNTNHGVVFLG
PUUE_ECOLI      ---------------------------------------FAQSAENATLKDVEGNEYIDFAAGIAVLNTG
ARGD_STRCO      -----------------------------------GTPRLLVRGEGARLWDADGKEYLDFVGGIAVNALG
ARGD_STRCL      -----------------------------------GTPGLFVRGEGSTLWDADGTAYTDFVSGLAVNALG
GABT_MYCTU      ----------ASLQQSRREIPGPASQALTHRRAVGVTPVFVARAGGGIVEDVDGNRLIDLGSGIAVTTIG
GABT_MYCBO      ----------ASLQQSRREIPGPASQALTHRRAVGVTPVFVARAGGGIVEDVDGNRLIDLGSGIAVTTIG
ARGD2_BORPE     ---------------------------VNALMEITARPDLVVRGQGSWLEDHAGKRYLDFVQGWAVNTLG
ARGD2_BORPA     ---------------------------VNALMEITACPDLVVRGQGSWLEDHAGKRYLDFVQGWAVNTLG
ARGD2_BORBR     ---------------------------VNALMEITARPDLVVRGQGSWLEDHAGKRYLDFVQGWAVNTLG
ASTC_SALNS      --------------------------------------PFIVRGEGSRLWDQQGKEYIDFAGGIAVNALG
ARGD_VIBVY      -----------------------------------------VKGQGSRIWDQNGNEYIDFAGGIAVSCLG
ARGD_VIBVU      -----------------------------------------VKGQGSRIWDQNGNEYIDFAGGIAVSCLG
ARGD_LACLA      ------------------------------FENYGRLPFSLIKGEDQYLFDDRGNKYLDFTSGIGVMNLG
ARGD_BACSU      ------------------------------FQTYGRWDIDIKKAKGTYVEDQNGKTYLDFIQGIAVSNLG
ARGD_BACHD      ----------------------------------------ITSGKGTKLYDNQGNEYLDFVSGIAVCNLG
ASTC_SALTY      --------------------------------------PFIVRGEGSRLWDQQGKEYIDFAGGIAVNALG
ARGD_MYXXA      --------TDALVQKAKRHLLQNYKQP----------PFVLARGQGARVWDMDGREYLDLIGGIATCALG
ASTC_ECOSE      --------------------------------------PFIVRGEGSRLWDQQGKEYIDFAGGIAVNALG
ASTC_ECOLI      --------------------------------------PFIVRGEGSRLWDQQGKEYIDFAGGIAVNALG
ASTC_ECOLC      --------------------------------------PFIVRGEGSRLWDQQGKEYIDFAGGIAVNALG
ASTC_ECOHS      --------------------------------------PFIVRGEGSRLWDQQGKEYIDFAGGIAVNALG
ASTC_ECODH      --------------------------------------PFIVRGEGSRLWDQQGKEYIDFAGGIAVNALG
ASTC_ECOBW      --------------------------------------PFIVRGEGSRLWDQQGKEYIDFAGGIAVNALG
ASTC_ECO8A      --------------------------------------PFIVRGEGSRLWDQQGKEYIDFAGGIAVNALG
ASTC_ECO24      --------------------------------------PFIVRGEGSRLWDQQGKEYIDFAGGIAVNALG
ARGD_VIBPA      -----------------------------------------VRGKGSRIWDQDDNEYIDFAGGIAVSCLG
ARGD2_BRAJA     -----------------------------------------VRGAGSYLWDDSRKRYLDFVQGWAVNCLG
ASTC_SALPC      --------------------------------------PFIVRGEGSRLWDQQGKEYIDFAGGIAVNALG
ASTC_SALPB      --------------------------------------PFIVRGEGSRLWDQQGKEYIDFAGGIAVNALG
ASTC_SALHS      --------------------------------------PFIVRGEGSRLWDQQGKEYIDFAGGIAVNALG
ASTC_SALG2      --------------------------------------PFIVRGEGSRLWDQQGKEYIDFAGGIAVNALG
ASTC_SALEP      --------------------------------------PFIVRGEGSRLWDQQGKEYIDFAGGIAVNALG
ASTC_SALDC      --------------------------------------PFIVRGEGSRLWDQQGKEYIDFAGGIAVNALG
ASTC_SALA4      --------------------------------------PFIVRGEGSRLWDQQGKEYIDFAGGIAVNALG
ARGD_THETN      -------------------------------------PIMLVKGEGTRVWDSEGNAYLDFVAGIAVNSLG
ARGD_SULSO      ----------------------------------------IIKGEGQYVWDEKNNKYLDMHAGHGVAFLG
ASTC_SALTI      --------------------------------------PFIVRGEGSRLWDQQGKEYIDFAGGIAVNALG
ARGD_THEEB      ----------------------------------GRFPITLVRGEGCRVWDDQGRSYLDFVAGIATCTLG
ASTC_SALPK      -----