[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tthe0:AAS80932.1

[Show Plain Result]


## Summary of Sequence Search
    1::283
    4::276     5e-15  23%  280 aa  Y1491_THETN RecName: Full=UPF0230 protein TTE1491;
    2::281     4e-13  29%  288 aa  Y1903_DEIRA RecName: Full=UPF0230 protein DR_1903;
    4::273     2e-12  28%  281 aa  Y2509_CLOPE RecName: Full=UPF0230 protein CPE2509;
    2::279     2e-12  22%  283 aa  YITS_BACSU RecName: Full=UPF0230 protein yitS;
    2::218     2e-10  26%  283 aa  Y3627_BACHD RecName: Full=UPF0230 protein BH3627;
  142::277     6e-10  34%  288 aa  Y1468_THEMA RecName: Full=UPF0230 protein TM_1468;
    2::278     7e-10  23%  281 aa  Y1986_DEIRA RecName: Full=UPF0230 protein DR_1986;
    7::232     1e-09  31%  279 aa  Y1438_STAAR RecName: Full=UPF0230 protein SAR1438;
    5::232     2e-09  22%  295 aa  Y326_MYCGE RecName: Full=UPF0230 protein MG326;
    7::232     2e-09  31%  279 aa  Y1460_STAAC RecName: Full=UPF0230 protein SACOL1460;
    7::232     2e-09  31%  279 aa  Y1425_STAAM RecName: Full=UPF0230 protein SAV1425;
    7::232     2e-09  31%  279 aa  Y1368_STAAS RecName: Full=UPF0230 protein SAS1368;
    7::232     2e-09  31%  279 aa  Y1315_STAAW RecName: Full=UPF0230 protein MW1315;
    7::232     2e-09  31%  279 aa  Y1258_STAAN RecName: Full=UPF0230 protein SA1258;
    5::276     2e-09  25%  283 aa  Y2658_LISIN RecName: Full=UPF0230 protein lin2658;
  153::279     3e-09  28%  286 aa  Y2003_STRP8 RecName: Full=UPF0230 protein spyM18_2003;
  153::279     3e-09  28%  286 aa  Y1936_STRP1 RecName: Full=UPF0230 protein SPy_1936/M5005_Spy1650;
  153::279     3e-09  28%  286 aa  Y1667_STRP3 RecName: Full=UPF0230 protein SpyM3_1667/SPs1668;
  153::279     3e-09  28%  286 aa  Y1658_STRP6 RecName: Full=UPF0230 protein M6_Spy1658;
    4::197     6e-09  23%  280 aa  Y1624_CLOAB RecName: Full=UPF0230 protein CA_C1624;
    5::276     2e-08  22%  283 aa  Y2514_LISMO RecName: Full=UPF0230 protein lmo2514;
  158::281     3e-08  43%  281 aa  Y2569_STRCO RecName: Full=UPF0230 protein SCO2569;
    2::274     3e-08  22%  281 aa  DEGV_BACSU RecName: Full=Protein degV;
    4::204     5e-08  23%  279 aa  Y1977_LISIN RecName: Full=UPF0230 protein lin1977;
    4::274     9e-08  21%  279 aa  Y1310_CLOPE RecName: Full=UPF0230 protein CPE1310;
    3::205     1e-07  29%  288 aa  YU230_STAAU RecName: Full=UPF0230 protein;
    3::205     1e-07  29%  288 aa  Y812_STAAC RecName: Full=UPF0230 protein SACOL0812;
    3::205     1e-07  29%  288 aa  Y803_STAAR RecName: Full=UPF0230 protein SAR0803;
    3::205     1e-07  29%  288 aa  Y749_STAAM RecName: Full=UPF0230 protein SAV0749;
    3::205     1e-07  29%  288 aa  Y714_STAAS RecName: Full=UPF0230 protein SAS0714;
    3::205     1e-07  29%  288 aa  Y711_STAAW RecName: Full=UPF0230 protein MW0711;
    3::205     1e-07  29%  288 aa  Y704_STAAN RecName: Full=UPF0230 protein SA0704;
  162::226     3e-07  37%  283 aa  Y304_CLOPE RecName: Full=UPF0230 protein CPE0304;
    4::204     3e-07  22%  279 aa  Y1863_LISMO RecName: Full=UPF0230 protein lmo1863;
  140::234     6e-07  28%  281 aa  Y948_CLOAB RecName: Full=UPF0230 protein CA_C0948;
   76::202     4e-06  31%  212 aa  Y1608_THEMA RecName: Full=UPF0230 protein TM_1608;
  161::280     5e-06  31%  287 aa  Y500_DEIRA RecName: Full=UPF0230 protein DR_0500;
  141::280     2e-05  26%  281 aa  YQAC_LACLA RecName: Full=UPF0230 protein yqaC;
  163::283     6e-05  28%  291 aa  Y026_CLOPE RecName: Full=UPF0230 protein CPE0026;
  142::237     9e-05  26%  280 aa  Y1709_STRP8 RecName: Full=UPF0230 protein spyM18_1709;
  142::237     9e-05  26%  280 aa  Y1698_STRP1 RecName: Full=UPF0230 protein SPy_1698/M5005_Spy1391;
  142::237     9e-05  26%  280 aa  Y1478_STRP3 RecName: Full=UPF0230 protein SpyM3_1478/SPs0389;
  142::237     9e-05  26%  280 aa  Y1140_STRP6 RecName: Full=UPF0230 protein M6_Spy1440;
  150::282     3e-04  25%  289 aa  YTEA_LACLA RecName: Full=UPF0230 protein yteA;
  162::281     4e-04  22%  282 aa  Y766_MYCPU RecName: Full=UPF0230 protein MYPU_7660;
    7::76      5e-04  33%  140 aa  YP15_STAAU RecName: Full=UPF0230 15.5 kDa protein;
  156::198     5e-04  44%  280 aa  Y2440_MYCBO RecName: Full=UPF0230 protein Mb2440c;
  156::198     5e-04  44%  280 aa  Y2417_MYCTU RecName: Full=UPF0230 protein Rv2417c/MT2490;
   13::117     8e-04  38%  489 aa  DPH2_PONAB RecName: Full=Diphthamide biosynthesis protein
    1::283

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxSSVAFVADSTLGLSPEEAKSLGIHVVPQQVLHRGRSFRDLVEIAPGEVLRLLCSGERLTTSQV
Y1491_THETN     ---------IAIVTDSLSDIPEDLIKTYGIFVVPLTINIDGKSYKDGVDIKKEEFYKLLREGKMPTTTQA
Y1903_DEIRA     ---------IAVTTESTADILPLQLGYSGIHLLPVPLGHQGQVYSER-ELPPDQLVNLITTGEPARTLAI
Y2509_CLOPE     ---------IAIITDSSCDLTIDEIKDYNLNILPLKIIYKDREYNDIFDIKPIDVYENL-HNEVPTTSLC
YITS_BACSU      --------TVHLIADSATDLPRSYFEEKGIGFIPLRVSLGDKEFEDAVTIHADQIFEAMQNGETPKTSQA
Y3627_BACHD     -------TKIAIVTDSTAYLGPKRAKELGVIVVPLSVVFGEEAYQEEVELSSADFYEKLKHEEKLTTSQP
Y1468_THEMA     ----------------------------------------------------------------------
Y1986_DEIRA     --------SIAIVTDSTSDLTPEHLAALGVTGVPLYVLFEGQLYQDGVQLSARQLVEGVRAGKAISTSQP
Y1438_STAAR     ------------VTDSTSDLSKEYLEANNIHVIPLSLTIEGASYVDQVDITSEEFINHIENDEDVKTSQP
Y326_MYCGE      ----------AIITDSTASIKPGEIN--GVYILPLQVIVDGKSFRDGIEIDYDHVHKLLKEGLNISTSLP
Y1460_STAAC     ------------VTDSTSDLSKEYLEANNIHVIPLSLTIEGASYVDQVDITSEEFINHIENDEDVKTSQP
Y1425_STAAM     ------------VTDSTSDLSKEYLEANNIHVIPLSLTIEGASYVDQVDITSEEFINHIENDEDVKTSQP
Y1368_STAAS     ------------VTDSTSDLSKEYLEANNIHVIPLSLTIEGASYVDQVDITSEEFINHIENDEDVKTSQP
Y1315_STAAW     ------------VTDSTSDLSKEYLEANNIHVIPLSLTIEGASYVDQVDITSEEFINHIENDEDVKTSQP
Y1258_STAAN     ------------VTDSTSDLSKEYLEANNIHVIPLSLTIEGASYVDQVDITSEEFINHIENDEDVKTSQP
Y2658_LISIN     ---------IAVVTDSTTYLPDEVKEQLRINVVPLSVIIDGKSYREGEELSTADFYKKVKEAENFTSSQP
Y2003_STRP8     ----------------------------------------------------------------------
Y1936_STRP1     ----------------------------------------------------------------------
Y1667_STRP3     ----------------------------------------------------------------------
Y1658_STRP6     ----------------------------------------------------------------------
Y1624_CLOAB     ---------IALITDSTSDVDKDMIEKYDIKVLPLRIIYKDKEYIDRVTISPREVYDNLHI-EVPSTSLP
Y2514_LISMO     ---------IAVVTDSTTYLPDEVKEQLRINVVPLSVIIDGKSYREGEELSATDFYRKVKEAENFTSSQP
Y2569_STRCO     ----------------------------------------------------------------------
DEGV_BACSU      --------NIAVVTDSTAYIPKEMREQHQIHMIPLQVVFREETYREEIELDWKSFYEEVKKHNELPTTSQ
Y1977_LISIN     ---------IKIITDSTAGLTLEEAAKWNIEVLYLTVEIDGKVYNPKTDITPEEMVRMAETKELPKSSQP
Y1310_CLOPE     ---------IKIITDSTCDLSKEIIEKYDIDVMPMLINFGEESYLDGVEIKVDSMMERIEREDTLTTAQI
YU230_STAAU     ---------IAVMTDSTSYLSQDLIDKYNIQIAPLSVFDDGKNFTESNEIAIEEFYNKMASSQTITTSQP
Y812_STAAC      ---------IAVMTDSTSYLSQDLIDKYNIQIAPLSVFDDGKNFTESNEIAIEEFYNKMASSQTITTSQP
Y803_STAAR      ---------IAVMTDSTSYLSQDLIDKYNIQIAPLSVFDDGKNFTESNEIAIEEFYNKMASSQTITTSQP
Y749_STAAM      ---------IAVMTDSTSYLSQDLIDKYNIQIAPLSVFDDGKNFTESNEIAIEEFYNKMASSQTITTSQP
Y714_STAAS      ---------IAVMTDSTSYLSQDLIDKYNIQIAPLSVFDDGKNFTESNEIAIEEFYNKMASSQTITTSQP
Y711_STAAW      ---------IAVMTDSTSYLSQDLIDKYNIQIAPLSVFDDGKNFTESNEIAIEEFYNKMASSQTITTSQP
Y704_STAAN      ---------IAVMTDSTSYLSQDLIDKYNIQIAPLSVFDDGKNFTESNEIAIEEFYNKMASSQTITTSQP
Y304_CLOPE      ----------------------------------------------------------------------
Y1863_LISMO     ---------IKIITDSTAGLTLEEAAKWNIDVLYLTVEIDGKVYNPKTDITPEEMVRMAETKELPKSSQP
Y948_CLOAB      ----------------------------------------------------------------------
Y1608_THEMA     ----------------------------------------------------------------------
Y500_DEIRA      ----------------------------------------------------------------------
YQAC_LACLA      ----------------------------------------------------------------------
Y026_CLOPE      ----------------------------------------------------------------------
Y1709_STRP8     ----------------------------------------------------------------------
Y1698_STRP1     ----------------------------------------------------------------------
Y1478_STRP3     ----------------------------------------------------------------------
Y1140_STRP6     ----------------------------------------------------------------------
YTEA_LACLA      ----------------------------------------------------------------------
Y766_MYCPU      ----------------------------------------------------------------------
YP15_STAAU      ------------VTDSTSDLSHEYLKQHNIHVIPLSLTIDGKSYTDQADISSSEYIDHIENDADVKTSQP
Y2440_MYCBO     ----------------------------------------------------------------------
Y2417_MYCTU     ----------------------------------------------------------------------
DPH2_PONAB      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           APEDLRKLYEALLXXXXXXXXXXXXXXXXXXXDTAKKVAQAFGERVKXXXXXXXXXXXXXXXXXXXXXXX
Y1491_THETN     SPVEFMEVFEDLLKSFDYVIAIILTSKFSGTYQSAVIARDMVDKRIEVIDSRHFTLGNGMLVLKAARMAV
Y1903_DEIRA     DDEVVARTFEAALQGSKSGRLVHVASGSRFTPEVAARVAGQFGVRVQVIDGGTVSYALGVQALHAAHLAD
Y2509_CLOPE     SPDYINSVLDKLEAEGYTHXXXXXXXXXXXXTFNAARIEERSSFKYYLFDSKIIGYPLGSIVIKAAEFVK
YITS_BACSU      SPQTIKNVFLQYAETGDPALYIAFSSGLSGTYQTAVMIANEVKEELRVIDSKCASLGYGLAVRHAADLCI
Y3627_BACHD     AVGLFVETFERLAKEGFEVVISIHLSSKISGTYQSALTAGSMVEGIEVIGYDSGISCEPQANFVAEAAKL
Y1468_THEMA     ----------------------------------------------------------------------
Y1986_DEIRA     SPAEFAQAYAQALEHADEVLSLHISGQLSGTVGSARLAAQEFGGRVTVVDTHTVTLGLGLQVLRAAELVR
Y1438_STAAR     AIGEFISAYEELGKDXXXXXXXXXXXXXXXTFNTAYQASQMVDANVTVIDSKSISFGLGYQIQHLVELVK
Y326_MYCGE      RQSDLLKIFEEIKTKYDRFIFLPLSKGLSGTYDMLVQLAKELSEQNKDKEFLVFETSDIAISLKWLVEDI
Y1460_STAAC     AIGEFISAYEELGKDXXXXXXXXXXXXXXXTYNTAYQASQMVDANVTVIDSKSISFGLGYQIQHLVELVK
Y1425_STAAM     AIGEFISAYEELGKDXXXXXXXXXXXXXXXTYNTAYQASQMVDANVTVIDSKSISFSLGYQIQHLVELVK
Y1368_STAAS     AIGEFISAYEELGKDXXXXXXXXXXXXXXXTYNTAYQASQMVDANVTVIDSKSISFGLGYQIQHLVELVK
Y1315_STAAW     AIGEFISAYEELGKDXXXXXXXXXXXXXXXTYNTAYQASQMVDANVTVIDSKSISFGLGYQIQHLVELVK
Y1258_STAAN     AIGEFISAYEELGKDXXXXXXXXXXXXXXXTYNTAYQASQMVDANVTVIDSKSISFSLGYQIQHLVELVK
Y2658_LISIN     APGEFIQLFEKL--KEQGFDTVISIHLSSGISGTFQNAASADGLNVVAYDSELSCMAQGMFAVKAAEMAL
Y2003_STRP8     ----------------------------------------------------------------------
Y1936_STRP1     ----------------------------------------------------------------------
Y1667_STRP3     ----------------------------------------------------------------------
Y1658_STRP6     ----------------------------------------------------------------------
Y1624_CLOAB     SMGDMESLYEKLEAEGYTHVIGVTISSNLSGTYNSLKLVSEGHENIKSFIFDSRSITMGEGAIIKECGEM
Y2514_LISMO     APGEFIHLFENL--KEQGFDTVISIHLSSGISGTFQNAASAEGLNVVAYDSELSCMAQGMFAVKAAEMAL
Y2569_STRCO     ----------------------------------------------------------------------
DEGV_BACSU      PPEELGKSYDAVISIHLSSGISGTFSSAAAADSMVDNIVYPFDSEISCLAQGFYALKAAELIKNGASSP-
Y1977_LISIN     AIGSFVEAYEKYTAEGYEILSIHLTEKLSGTVNAARQAADMVGNITVVDCDYTARGQAFQVLKAAEMAQA
Y1310_CLOPE     VPTRFIEKYKGYLEEGYKVISIHISSNMSGTYQSACLATELESDDIVVIDSRNVTVGLGLIILKAARLIE
YU230_STAAU     AIGEWITKYEMLRDQGYTDIIVICLXXXXXXXXXXXXXAGEMVEGVNVHAFDSKLAAMIEGCYVLRAIEM
Y812_STAAC      AIGEWITKYEMLRDQGYTDIIVICLXXXXXXXXXXXXXAGEMVEGVNVHAFDSKLAAMIEGCYVLRAIEM
Y803_STAAR      AIGEWITKYEMLRDQGYTDIIVICLXXXXXXXXXXXXXAGEMVEGVNVHAFDSKLAAMIEGCYVLRAIEM
Y749_STAAM      AIGEWITKYEMLRDQGYTDIIVICLXXXXXXXXXXXXXAGEMVEGVNVHAFDSKLAAMIEGCYVLRAIEM
Y714_STAAS      AIGEWITKYEMLRDQGYTDIIVICLXXXXXXXXXXXXXAGEMVEGVNVHAFDSKLAAMIEGCYVLRAIEM
Y711_STAAW      AIGEWITKYEMLRDQGYTDIIVICLXXXXXXXXXXXXXAGEMVEGVNVHAFDSKLAAMIEGCYVLRAIEM
Y704_STAAN      AIGEWITKYEMLRDQGYTDIIVICLXXXXXXXXXXXXXAGEMVEGVNVHAFDSKLAAMIEGCYVLRAIEM
Y304_CLOPE      ----------------------------------------------------------------------
Y1863_LISMO     AIGSFVEAYEKYTAEGYEILSIHLTEKLSGTVNAARQAADMVGNITVVDCDYTARGQAFQVLKAAEMAQS
Y948_CLOAB      ----------------------------------------------------------------------
Y1608_THEMA     ----------------------------------------------------------------------
Y500_DEIRA      ----------------------------------------------------------------------
YQAC_LACLA      ----------------------------------------------------------------------
Y026_CLOPE      ----------------------------------------------------------------------
Y1709_STRP8     ----------------------------------------------------------------------
Y1698_STRP1     ----------------------------------------------------------------------
Y1478_STRP3     ----------------------------------------------------------------------
Y1140_STRP6     ----------------------------------------------------------------------
YTEA_LACLA      ----------------------------------------------------------------------
Y766_MYCPU      ----------------------------------------------------------------------
YP15_STAAU      PIGRFIETYEQL----------------------------------------------------------
Y2440_MYCBO     ----------------------------------------------------------------------
Y2417_MYCTU     ----------------------------------------------------------------------
DPH2_PONAB      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           XXXXWEHLEEALAPYRERVRGYVLPATLDYLHRSGRIGGLQRFVGGLLRILPVLEVREGRVHPGPRVRGF
Y1491_THETN     EGASKEEIVSTVYETIPRIRGIMVFDSLDYLYRGGRLSRTQSIIGGILNVKPILTNEDGELKVIDKVRGQ
Y1903_DEIRA     QGADFGQIXXXXXXXXXXXXXXFAVESLDFLRVNGRIGNVAAFIGNWLGLRPLLAVEAGEVVSKARVRGQ
Y2509_CLOPE     EGKSFEEIIEALSIIREATTGFYTLNTLEYLRRGGRIGKVAGTVGDLLHLKPIISVDEGAYTTIAKARGR
YITS_BACSU      NGNTIQEIETSVKNFCSQLEHIFTVDDLTYLARGGRISKTSAFVGGLLNIKPLLQMEDGKLVPLEKIRGQ
Y3627_BACHD     VKEGADHLDEV----KKRTNALFVVHDLSHLHRGGRLNAAQLVVGSLLKIKPILHFEDGSIVPLEKVRTE
Y1468_THEMA     -------IEEVLKKLDERMKNKDFKANFDYLVKGGRVSKFQGFVGNLLKIRVCLHIENGELIPYRKVRGD
Y1986_DEIRA     AGQSVPQIVQTLERVYPQADLRFTVDTLDFLRLNGRIXXXXXXXXXXXNIKPLLXXXXXXXXXXXXXXXQ
Y1438_STAAR     EGVSTSEIVKKLNHLRENIKLFVVIGQLNQLIKGGRISKTKGLIGNLMKIKPIGTLDDGRVHNARTQNSS
Y326_MYCGE      KALVDQTIKAKVESHKQNILSAVTLKNLVQMRKGGRISGLKKFITTLLRVKPIILFDKGVNTLGAKVFSF
Y1460_STAAC     EGVSTSEIVKKLNHLRENIKLFVVIGQLNQLIKGGRISKTKGLIGNLMKIKPIGTLDDGRVHNARTQNSS
Y1425_STAAM     EGVSTSEIVKKLNHLRENIKLFVVIGQLNQLIKGGRISKTKGLIGNLMKIKPIGTLDDGRVHNARTQNSS
Y1368_STAAS     EGVSTSEIVKKLNHLRENIKLFVVIGQLNQLIKGGRISKTKGLIGNLMKIKPIGTLDDGRVHNARTQNSS
Y1315_STAAW     EGVSTSEIVKKLNHLRENIKLFVVIGQLNQLIKGGRISKTKGLIGNLMKIKPIGTLDDGRVHNARTQNSS
Y1258_STAAN     EGVSTSEIVKKLNHLRENIKLFVVIGQLNQLIKGGRISKTKGLIGNLMKIKPIGTLDDGRVHNARTQNSS
Y2658_LISIN     ANEPLERIISELDKIKKAQDAYFMVDDLNNLQRGGRLNGAQALVGSLLQIKPILHFNDKQIVLFEKVRTQ
Y2003_STRP8     ---------EAVIP---RLRTYFLVDDLFHLMRGGRLSKGSAFLGSLASIKPLLWIEEGKLVPIAKIRGR
Y1936_STRP1     ---------EAVIP---RLRTYFLVDDLFHLMRGGRLSKGSAFLGSLASIKPLLWIEEGKLVPIAKIRGR
Y1667_STRP3     ---------EAVIP---RLRTYFLVDDLFHLMRGGRLSKGSAFLGSLASIKPLLWIEEGKLVPIAKIRGR
Y1658_STRP6     ---------EAVIP---RLRTYFLVDDLFHLMRGGRLSKGSAFLGSLASIKPLLWIEEGKLVPIAKIRGR
Y1624_CLOAB     ILQGFDYIVEKMPKMRENIKVYYIVDTLKYLIKGGRIGKVSGTVGQLLDIKPIISINEEGVY--------
Y2514_LISMO     ANEPLDQIIQKLDKIKQAQDAYFMVDDLNNLQRGGRLNGAQALVGSLLQIKPILHFNDKQIVLFEKVRTQ
Y2569_STRCO     ---------------------YFYVDTLDYLRRGGRIGAAQALFGSALAVKPLLQLEGGRIEPLEKVRTA
DEGV_BACSU      -----EDIIKELEEMKKTVRAYFMVDDLAHLQRGGRLSSAQAFIGSLLKVKPILHFDNKVIVPFEKIRTR
Y1977_LISIN     GDYSVEEIHAAINDIRDKTKLYIVVVTLDNLIKGGRVGRMQGFLGSLLNIKLIAKLTDGQLEEETKVR--
Y1310_CLOPE     SGITLEDLEKEILEYRNHIKSTIAFESLDNLVRGGRLSKGKALFVSALGIKLMLNVLDGEMNVQGKIRGT
YU230_STAAU     VEEGYEQIIDDLTNMREHTGAYLIVDDLKNLQKSGRITGAQAWVGTLLKMKPVLKFEDGKIIPEEKVR--
Y812_STAAC      VEEGYEQIIDDLTNMREHTGAYLIVDDLKNLQKSGRITGAQAWVGTLLKMKPVLKFEDGKIIPEEKVR--
Y803_STAAR      VEEGYEQIIDDLTNMREHTGAYLIVDDLKNLQKSGRITGAQAWVGTLLKMKPVLKFEDGKIIPEEKVR--
Y749_STAAM      VEEGYEQIIDDLTNMREHTGAYLIVDDLKNLQKSGRITGAQAWVGTLLKMKPVLKFEDGKIIPEEKVR--
Y714_STAAS      VEEGYEQIIDDLTNMREHTGAYLIVDDLKNLQKSGRITGAQAWVGTLLKMKPVLKFEDGKIIPEEKVR--
Y711_STAAW      VEEGYEQIIDDLTNMREHTGAYLIVDDLKNLQKSGRITGAQAWVGTLLKMKPVLKFEDGKIIPEEKVR--
Y704_STAAN      VEEGYEQIIDDLTNMREHTGAYLIVDDLKNLQKSGRITGAQAWVGTLLKMKPVLKFEDGKIIPEEKVR--
Y304_CLOPE      -----------------------VPGTLENLKKGGRIGGAAALFGKMLKINPILTVKEGAVVVMDKVRTK
Y1863_LISMO     GDYSVEEIHAKINDIRDKTKLYIVVVTLDNLIKGGRVGRMQGFLGSLLNIKLIAKLTDGQLEEETKVR--
Y948_CLOAB      ----FDEIVKAIPEIRKKIHLFFVVGTLDYLKKGGRIGKIAGTIGKLLNIKPIVSVDDNGVYYADKVRGR
Y1608_THEMA     -----EDLERVVQEANERIKIRFSVLEFDYLMKSGRVKAITGMLGNLIKIHPILSIEDGELRVVAKKRGL
Y500_DEIRA      --------------------------TLEYLRRGGRIGTVAAALGGLLNLKPVVMVKTGTYVNAGRARSY
YQAC_LACLA      --------EEIIAKFEEQRRAYMLVDDLHWLAKGGRLSNGAAVLGTLLNIKPVLTFTEGKVEVFEKVRTV
Y026_CLOPE      ---------------------YFTVDSLDHLKRGGRISSTAAAIGSLLSIKPMLYVNDGELHNFAKAKGR
Y1709_STRP8     ----FEEVVKQITAYQQKTRLIFVLAKVDNLVKNGRLSKLVGKVIGLLNIRMVGKANKGTLELLQKARGQ
Y1698_STRP1     ----FEEVVKQITAYQQKTRLIFVLAKVDNLVKNGRLSKLVGKVIGLLNIRMVGKANKGTLELLQKARGQ
Y1478_STRP3     ----FEEVVKQITAYQQKTRLIFVLAKVDNLVKNGRLSKLVGKVIGLLNIRMVGKANKGTLELLQKARGQ
Y1140_STRP6     ----FEEVVKQITAYQQKTRLIFVLAKVDNLVKNGRLSKLVGKVIGLLNIRMVGKANKGTLELLQKARGQ
YTEA_LACLA      ---------EVLSDIIPRLQSRFMVDDLNHLARGGRIPKAVALVGTMANIKPLLDVPEGRLRQVTKVRGK
Y766_MYCPU      --------------------------TLDYLVKGGRISGVKKFILTKLKLFPIIQSYTNNSIAGLK-RTF
YP15_STAAU      ----------------------------------------------------------------------
Y2440_MYCBO     -------------------------ARLDNLRRSGRISGAKAWLGTALALKPLLSVDDGKLVLVQRVR--
Y2417_MYCTU     -------------------------ARLDNLRRSGRISGAKAWLGTALALKPLLSVDDGKLVLVQRVR--
DPH2_PONAB      ---------------------------------------LQREAGGLLTPLPDLD----RVYELERVAGF


                         .         .         .         +         .         .         .:280
query           AEGIRKVAALFRRDFLEEARVYLAHAENPXXXXXXXXXXXXXXVEVLGALPAGAAVSVHTGPGTVAAFAG
Y1491_THETN     KKAIRWIIDYMKNTGIDEREVGLIHTDK-EEFLNEIEAALRSELEITRFIQAGCGIGTHAGPDAAGVF--
Y1903_DEIRA     AAAVRTLLSAFQHQTGETLRLYCGHTIXXXXXXXXXXXXXXXVYRDLPAHPLGSGLTANVGPGVVAVLAF
Y2509_CLOPE     KQSLKKLASII-LEHLDEGKCNVAMAEEEANQVLDSISSHPNLLK-SQVRAIGAAMGVHAGPGMV-----
YITS_BACSU      KKLFKRIIELMRGDDWSNQTVGISYAANEKATDMKHLIEEAFKPKEIIMHPISSAIGSHAGPGTLAIF--
Y3627_BACHD     KKAWARVKELF-----------------------------------------------------------
Y1468_THEMA     KKAIEALIEKLREDTPEKLRVIGVHADN-EAGVVELLNTLRKSYEVVDEIPMGKVITTHVGPGTV-----
Y1986_DEIRA     KKALADLAEHVRRYVSQHARVFLATVGGEEDRAAVRAQLSDLHFQDMGDHEIGAVVTVHAGPGAVGVALE
Y1438_STAAR     IQYLKKEIAEFIGDH-EIKSVGVAHA--------------------------------------------
Y326_MYCGE      SQAVEKIFGFVKTKFGDNYKI-------------------------------------------------
Y1460_STAAC     IQYLKKEIAEFIGDH-EIKSIGVAHA--------------------------------------------
Y1425_STAAM     IQYLKKEIAEFIGDH-EIKSIGVAHA--------------------------------------------
Y1368_STAAS     IQYLKKEIAEFIGDH-EIKSIGVAHA--------------------------------------------
Y1315_STAAW     IQYLKKEIAEFIGDH-EIKSIGVAHA--------------------------------------------
Y1258_STAAN     IQYLKKEIAEFIGDH-EIKSIGVAHA--------------------------------------------
Y2658_LISIN     KKALKRI-----EDILEVAKAYVIHGNDPEKGETWRKHLESKFPEVEFELSFGPVIGTHLGEGAL-----
Y2003_STRP8     QKAIKEMVAQVEKDIADSTVIVSYTSDQGSAEKLREELLAHENISDVLMMPLGPVISAHVGPNTLAVF--
Y1936_STRP1     QKAIKEMVAQVEKDIADSTVIVSYTSDQGSAEKLREELLAHENISDVLMMPLGPVISAHVGPNTLAVF--
Y1667_STRP3     QKAIKEMVAQVEKDIADSTVIVSYTSDQGSAEKLREELLAHENISDVLMMPLGPVISAHVGPNTLAVF--
Y1658_STRP6     QKAIKEMVAQVEKDIADSTVIVSYTSDQGSAEKLREELLAHENISDVLMMPLGPVISAHVGPNTLAVF--
Y1624_CLOAB     ----------------------------------------------------------------------
Y2514_LISMO     KKALKRIEDILQKAVQNKTKAYVIHGNDLAKGEAWLAQLEAKFPEVTFELSFGPVIGTHLGEGAL-----
Y2569_STRCO     SKAIARLEEI-AADRAGGAPVDIAHHXXXXXXXXXXXXXXXXXVPGLADLEVGAVIGAHTGPGLLGVVVS
DEGV_BACSU      KKAISRIYELLDEDASKRAAVIHANREEEAAKIIEELSAKYPHVEFYNSY-FGAVIGTHLGEGAL-----
Y1977_LISIN     ----------------------------------------------------------------------
Y1310_CLOPE     KKMVKAMIEQFDSIPKKEGEIILVELENEDIYLPIKEYLENNNIEYL-KLPLGCSVAIHSGPKVCALF--
YU230_STAAU     ----------------------------------------------------------------------
Y812_STAAC      ----------------------------------------------------------------------
Y803_STAAR      ----------------------------------------------------------------------
Y749_STAAM      ----------------------------------------------------------------------
Y714_STAAS      ----------------------------------------------------------------------
Y711_STAAW      ----------------------------------------------------------------------
Y704_STAAN      ----------------------------------------------------------------------
Y304_CLOPE      KRAIDKIVEVVKQDLKEK----------------------------------------------------
Y1863_LISMO     ----------------------------------------------------------------------
Y948_CLOAB      KQSLNRVMEI-AKDITKKCRAYVMHGD-------------------------------------------
Y1608_THEMA     KNVVEKIVQDLKIDGRKMLGLVYAGXXXXXXXXXXXXXXXXXHIERVDIVRLPPTLAVHSGP--------
Y500_DEIRA      RGGIEAVTSQVTRKYGEPLRVGLLYGTHPEDADQALEQLAARHPIVWSRTGVNPVLSVHVGPRALGVAAA
YQAC_LACLA      KKTMSRMKELLLKDAKDPLKVYVIHTRAEDRAQELYDYALSQGFDDVEIVTFGPVIATHLGLNTVAYGIS
Y026_CLOPE      KKSLKMLFQELEKRIVNEQTIFIAHAETLAEMIREKYPVKDILIDYIGIV-----IGSHTGIGTLAVF--
Y1709_STRP8     KKAVSALIEEIQKEGYVGGKVYIAHAQNP-----------------------------------------
Y1698_STRP1     KKAVSALIEEIQKEGYVGGKVYIAHAQNP-----------------------------------------
Y1478_STRP3     KKAVSALIEEIQKEGYVGGKVYIAHAQNP-----------------------------------------
Y1140_STRP6     KKAVSALIEEIQKEGYVGGKVYIAHAQNP-----------------------------------------
YTEA_LACLA      KKAINQLKSLEEMDTAYPRLLISYSGTDEIAQEIKKQAMQKKGISDVDVRPLSPTIVTHTGDGTIAIFS-
Y766_MYCPU      KSSLEKIEFIGGENNFKNYNLKLVHGPSKEMVDGAVEFFKQKGLEFSSIVLASTVIIAHTGPDSISISVV
YP15_STAAU      ----------------------------------------------------------------------
Y2440_MYCBO     ----------------------------------------------------------------------
Y2417_MYCTU     ----------------------------------------------------------------------
DPH2_PONAB      VRGCERVALQFPDQLLGDAVAVAARLEETTGSKMFILGDTAYGVDVLGAEQAGAQAVIHFGPACLSPPAR


                         .         *         .         .         .         .         +:350
query           PRx
Y1491_THETN     ---
Y1903_DEIRA     PR-
Y2509_CLOPE     ---
YITS_BACSU      ---
Y3627_BACHD     ---
Y1468_THEMA     ---
Y1986_DEIRA     P--
Y1438_STAAR     ---
Y326_MYCGE      ---
Y1460_STAAC     ---
Y1425_STAAM     ---
Y1368_STAAS     ---
Y1315_STAAW     ---
Y1258_STAAN     ---
Y2658_LISIN     ---
Y2003_STRP8     ---
Y1936_STRP1     ---
Y1667_STRP3     ---
Y1658_STRP6     ---
Y1624_CLOAB     ---
Y2514_LISMO     ---
Y2569_STRCO     SR-
DEGV_BACSU      ---
Y1977_LISIN     ---
Y1310_CLOPE     ---
YU230_STAAU     ---
Y812_STAAC      ---
Y803_STAAR      ---
Y749_STAAM      ---
Y714_STAAS      ---
Y711_STAAW      ---
Y704_STAAN      ---
Y304_CLOPE      ---
Y1863_LISMO     ---
Y948_CLOAB      ---
Y1608_THEMA     ---
Y500_DEIRA      P--
YQAC_LACLA      PK-
Y026_CLOPE      ---
Y1709_STRP8     ---
Y1698_STRP1     ---
Y1478_STRP3     ---
Y1140_STRP6     ---
YTEA_LACLA      ---
Y766_MYCPU      PK-
YP15_STAAU      ---
Y2440_MYCBO     ---
Y2417_MYCTU     ---
DPH2_PONAB      P--