[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tthe0:AAS81022.1

[Show Plain Result]


## Summary of Sequence Search
    1::434
    1::430       0.0  82%  430 aa  SRP54_THEAQ RecName: Full=Signal recognition particle
    3::430     e-102  50%  446 aa  SRP54_BACSU RecName: Full=Signal recognition particle
    1::443     4e-97  50%  525 aa  SRP54_MYCTU RecName: Full=Signal recognition particle
    1::443     4e-97  50%  525 aa  SRP54_MYCBO RecName: Full=Signal recognition particle
    1::422     1e-89  45%  453 aa  SRP54_ECOLI RecName: Full=Signal recognition particle
    1::422     1e-89  45%  453 aa  SRP54_ECOL6 RecName: Full=Signal recognition particle
    1::422     1e-89  45%  453 aa  SRP54_ECO57 RecName: Full=Signal recognition particle
    3::430     2e-89  42%  516 aa  SRP54_STRMU RecName: Full=Signal recognition particle
    1::422     9e-89  44%  462 aa  SRP54_HAEIN RecName: Full=Signal recognition particle
    1::443     1e-85  45%  521 aa  SRP54_MYCLE RecName: Full=Signal recognition particle
    1::405     2e-85  44%  454 aa  SRP54_AQUAE RecName: Full=Signal recognition particle
    1::440     9e-84  39%  449 aa  SRP54_RICCN RecName: Full=Signal recognition particle
    1::412     1e-83  43%  485 aa  SRP54_SYNE7 RecName: Full=Signal sequence-binding protein;
    1::440     1e-82  39%  449 aa  SRP54_RICFE RecName: Full=Signal recognition particle
    1::440     1e-82  41%  449 aa  SRP54_RICBR RecName: Full=Signal recognition particle
    1::440     1e-82  39%  449 aa  SRP54_RICPR RecName: Full=Signal recognition particle
    1::419     9e-82  41%  482 aa  SRP54_SYNY3 RecName: Full=Signal recognition particle
   77::505     2e-80  41%  564 aa  SR54C_ARATH RecName: Full=Signal recognition particle 54 kDa
    1::439     2e-77  38%  449 aa  SRP54_RICTY RecName: Full=Signal recognition particle
    1::432     2e-74  37%  451 aa  SRP54_BUCAI RecName: Full=Signal recognition particle
    2::427     7e-71  38%  440 aa  SRP54_METAC RecName: Full=Signal recognition 54 kDa
    1::428     2e-70  40%  448 aa  SRP54_HELPJ RecName: Full=Signal recognition particle
    4::433     3e-70  36%  448 aa  SRP54_THEON RecName: Full=Signal recognition 54 kDa
    1::428     2e-69  40%  448 aa  SRP54_HELPY RecName: Full=Signal recognition particle
    2::430     7e-68  36%  443 aa  SRP54_METBF RecName: Full=Signal recognition 54 kDa
    1::440     6e-67  36%  444 aa  SRP54_METST RecName: Full=Signal recognition 54 kDa
    1::421     1e-66  37%  450 aa  SRP54_BUCAP RecName: Full=Signal recognition particle
    4::433     2e-66  35%  448 aa  SRP54_PYRKO RecName: Full=Signal recognition 54 kDa
    2::430     3e-66  36%  443 aa  SRP54_METMA RecName: Full=Signal recognition 54 kDa
    2::433     1e-65  33%  443 aa  SRP54_PYRFU RecName: Full=Signal recognition 54 kDa
    4::433     4e-65  34%  448 aa  SRP54_THEGJ RecName: Full=Signal recognition 54 kDa
    2::412     7e-65  37%  444 aa  SRP54_METTP RecName: Full=Signal recognition 54 kDa
    1::445     7e-65  36%  445 aa  SRP54_METS3 RecName: Full=Signal recognition 54 kDa
    4::426     1e-64  36%  433 aa  SRP54_PYRAR RecName: Full=Signal recognition 54 kDa
    1::429     1e-64  35%  450 aa  SRP54_METM7 RecName: Full=Signal recognition 54 kDa
    1::420     1e-64  36%  450 aa  SRP54_BUCBP RecName: Full=Signal recognition particle
    1::421     2e-64  34%  450 aa  SRP54_METVS RecName: Full=Signal recognition 54 kDa
   12::426     3e-64  37%  433 aa  SRP54_PYRIL RecName: Full=Signal recognition 54 kDa
    1::429     3e-64  34%  450 aa  SRP54_METMP RecName: Full=Signal recognition 54 kDa
    5::436     4e-64  37%  447 aa  SRP54_SULIN RecName: Full=Signal recognition 54 kDa
    2::433     6e-64  33%  443 aa  SRP54_PYRAB RecName: Full=Signal recognition 54 kDa
    1::429     8e-64  34%  450 aa  SRP54_METM5 RecName: Full=Signal recognition 54 kDa
    7::437     1e-63  36%  447 aa  SRP54_MYCMY RecName: Full=Signal recognition particle
    2::427     1e-63  35%  439 aa  SRP54_METBU RecName: Full=Signal recognition 54 kDa
   27::436     2e-63  38%  447 aa  SRP54_SULIY RecName: Full=Signal recognition 54 kDa
   27::436     2e-63  38%  447 aa  SRP54_SULIL RecName: Full=Signal recognition 54 kDa
    1::429     2e-63  34%  450 aa  SRP54_METM6 RecName: Full=Signal recognition 54 kDa
   27::436     7e-63  38%  447 aa  SRP54_SULIM RecName: Full=Signal recognition 54 kDa
   27::436     7e-63  38%  447 aa  SRP54_SULIK RecName: Full=Signal recognition 54 kDa
   27::436     7e-63  38%  447 aa  SRP54_SULIA RecName: Full=Signal recognition 54 kDa
    6::429     1e-62  37%  441 aa  SRP54_STAMF RecName: Full=Signal recognition 54 kDa
    5::434     6e-62  36%  444 aa  SRP54_SULAC RecName: Full=Signal recognition 54 kDa
    7::435     6e-62  36%  447 aa  SRP54_HYPBU RecName: Full=Signal recognition 54 kDa
    1::438     1e-61  34%  442 aa  SRP54_METTH RecName: Full=Signal recognition 54 kDa
    2::433     1e-61  33%  443 aa  SRP54_PYRHO RecName: Full=Signal recognition 54 kDa
    2::433     5e-61  35%  455 aa  SRP54_THEVO RecName: Full=Signal recognition 54 kDa
   27::433     5e-61  36%  451 aa  SRP54_METJA RecName: Full=Signal recognition 54 kDa
    5::434     8e-61  35%  445 aa  SRP54_SULTO RecName: Full=Signal recognition 54 kDa
    2::432     8e-61  34%  469 aa  SRP54_HALMA RecName: Full=Signal recognition 54 kDa
    6::405     5e-60  36%  433 aa  SRP54_ARCFU RecName: Full=Signal recognition 54 kDa
    2::411     1e-59  34%  444 aa  SRP54_UNCMA RecName: Full=Signal recognition 54 kDa
    2::419     1e-59  35%  456 aa  SRP54_THEAC RecName: Full=Signal recognition 54 kDa
   23::434     2e-59  37%  450 aa  SRP54_MYCPN RecName: Full=Signal recognition particle
   12::426     1e-58  34%  433 aa  SRP54_PYRAE RecName: Full=Signal recognition 54 kDa
    6::423     2e-58  33%  446 aa  SRP54_METLZ RecName: Full=Signal recognition 54 kDa
    2::434     3e-58  34%  464 aa  SRP54_HALLT RecName: Full=Signal recognition 54 kDa
    2::434     3e-57  36%  466 aa  SRP54_HALWD RecName: Full=Signal recognition 54 kDa
    2::417     1e-56  35%  460 aa  SRP54_HALSA RecName: Full=Signal recognition 54 kDa
    2::417     1e-56  35%  460 aa  SRP54_HALS3 RecName: Full=Signal recognition 54 kDa
   12::426     6e-56  33%  433 aa  SRP54_THENV RecName: Full=Signal recognition 54 kDa
    5::426     1e-55  36%  447 aa  SRP54_METKA RecName: Full=Signal recognition 54 kDa
    2::444     1e-55  35%  465 aa  SRP54_HALVO RecName: Full=Signal recognition 54 kDa
   27::436     2e-55  36%  447 aa  SRP54_SULSO RecName: Full=Signal recognition 54 kDa
    5::434     2e-55  33%  446 aa  SRP54_METS5 RecName: Full=Signal recognition 54 kDa
    2::428     4e-55  32%  487 aa  SRP54_ENTHI RecName: Full=Signal recognition particle 54 kDa
   13::424     5e-55  34%  441 aa  SRP54_AERPE RecName: Full=Signal recognition 54 kDa
    1::421     3e-54  31%  450 aa  SRP54_META3 RecName: Full=Signal recognition 54 kDa
    6::442     6e-54  32%  504 aa  SRP54_MOUSE RecName: Full=Signal recognition particle 54 kDa
    6::442     8e-54  32%  504 aa  SRP54_PONAB RecName: Full=Signal recognition particle 54 kDa
    6::442     8e-54  32%  504 aa  SRP54_MACFA RecName: Full=Signal recognition particle 54 kDa
    6::442     8e-54  32%  504 aa  SRP54_HUMAN RecName: Full=Signal recognition particle 54 kDa
    6::442     8e-54  32%  504 aa  SRP54_CANFA RecName: Full=Signal recognition particle 54 kDa
    6::442     8e-54  32%  504 aa  SRP54_BOVIN RecName: Full=Signal recognition particle 54 kDa
    6::442     2e-53  32%  504 aa  SRP54_RAT RecName: Full=Signal recognition particle 54 kDa protein;
   23::430     1e-52  34%  446 aa  SRP54_MYCGE RecName: Full=Signal recognition particle
    2::413     2e-52  33%  431 aa  SRP54_PYRCJ RecName: Full=Signal recognition 54 kDa
    2::446     2e-52  32%  451 aa  SRP54_ACIAM RecName: Full=Signal recognition 54 kDa
    2::417     1e-51  34%  466 aa  SRP54_NATPD RecName: Full=Signal recognition 54 kDa
    5::440     3e-51  32%  495 aa  SR542_ARATH RecName: Full=Signal recognition particle 54 kDa
   17::441     4e-51  34%  499 aa  SRP54_GEOCY RecName: Full=Signal recognition particle 54 kDa
   33::427     3e-49  33%  541 aa  SRP54_YEAST RecName: Full=Signal recognition particle subunit
    2::438     2e-48  37%  536 aa  SRP54_YARLI RecName: Full=Signal recognition particle 54 kDa
    5::434     2e-47  31%  495 aa  SR543_ARATH RecName: Full=Signal recognition particle 54 kDa
    2::417     1e-46  33%  522 aa  SRP54_SCHPO RecName: Full=Signal recognition particle 54 kDa
    5::434     4e-46  31%  499 aa  SR542_SOLLC RecName: Full=Signal recognition particle 54 kDa
    5::434     1e-45  33%  496 aa  SR541_SOLLC RecName: Full=Signal recognition particle 54 kDa
   22::431     7e-44  33%  493 aa  SR543_HORVU RecName: Full=Signal recognition particle 54 kDa
  106::439     1e-43  35%  556 aa  SRP54_CANAL RecName: Full=Signal recognition particle 54 kDa
    6::420     2e-40  31%  542 aa  SRP54_DICDI RecName: Full=Signal recognition particle 54 kDa
    5::432     2e-40  29%  479 aa  SR541_ARATH RecName: Full=Signal recognition particle 54 kDa
    2::438     6e-40  29%  534 aa  SRP54_ASPNG RecName: Full=Signal recognition particle 54 kDa
  267::486     3e-35  42%  497 aa  FTSY_ECOLI RecName: Full=Cell division protein ftsY;
    5::434     5e-34  28%  497 aa  SR542_HORVU RecName: Full=Signal recognition particle 54 kDa
    5::434     5e-34  28%  497 aa  SR541_HORVU RecName: Full=Signal recognition particle 54 kDa
   90::366     4e-33  32%  369 aa  DOCK_SULAC RecName: Full=Probable signal recognition particle
  115::302     1e-32  41%  304 aa  FTSY_THEAQ RecName: Full=Cell division protein ftsY;
  123::410     2e-32  38%  421 aa  FTSY_NEIMC RecName: Full=Cell division protein ftsY homolog;
  123::410     2e-32  38%  421 aa  FTSY_NEIMB RecName: Full=Cell division protein ftsY homolog;
  123::410     2e-32  38%  421 aa  FTSY_NEIMA RecName: Full=Cell division protein ftsY homolog;
  259::492     4e-32  40%  504 aa  FTSY_SYNY3 RecName: Full=Cell division protein ftsY homolog;
  119::415     8e-32  37%  416 aa  FTSY_NEIGO RecName: Full=Cell division protein ftsY homolog;
  156::395     9e-31  35%  409 aa  Y291_METJA RecName: Full=Probable signal recognition particle
  211::399     9e-31  41%  414 aa  FTSY_HAEIN RecName: Full=Cell division protein ftsY homolog;
  251::460     2e-30  39%  461 aa  FTSY_AQUAE RecName: Full=Cell division protein ftsY homolog;
  133::313     1e-29  41%  329 aa  FTSY_BACSU RecName: Full=Cell division protein ftsY homolog;
  146::336     2e-26  36%  351 aa  FTSY_MYCHO RecName: Full=Cell division protein ftsY homolog;
  102::303     3e-26  32%  303 aa  FTSY_RICCN RecName: Full=Cell division protein ftsY homolog;
  151::339     5e-26  35%  351 aa  FTSY_BUCAP RecName: Full=Cell division protein ftsY homolog;
   69::303     1e-25  31%  303 aa  FTSY_RICFE RecName: Full=Cell division protein ftsY homolog;
   36::303     2e-25  27%  303 aa  FTSY_RICTY RecName: Full=Cell division protein ftsY homolog;
  102::303     2e-24  32%  303 aa  FTSY_RICBR RecName: Full=Cell division protein ftsY homolog;
   88::280     2e-24  35%  293 aa  FTSY_HELPY RecName: Full=Cell division protein ftsY homolog;
   88::280     2e-24  35%  293 aa  FTSY_HELPJ RecName: Full=Cell division protein ftsY homolog;
  137::326     3e-24  36%  346 aa  FTSY_MYCGE RecName: Full=Cell division protein ftsY homolog;
  102::303     5e-24  30%  303 aa  FTSY_RICPR RecName: Full=Cell division protein ftsY homolog;
  137::326     1e-23  34%  348 aa  FTSY_MYCPN RecName: Full=Cell division protein ftsY homolog;
  251::421     4e-21  36%  430 aa  FTSY_MYCLE RecName: Full=Cell division protein ftsY homolog;
  183::391     4e-21  33%  397 aa  FTSY_BUCBP RecName: Full=Cell division protein ftsY homolog;
  195::367     1e-20  34%  378 aa  FTSY_BUCAI RecName: Full=Cell division protein ftsY homolog;
  286::422     1e-18  38%  422 aa  FTSY_MYCTU RecName: Full=Cell division protein ftsY homolog;
  286::422     1e-18  38%  422 aa  FTSY_MYCBO RecName: Full=Cell division protein ftsY homolog;
  328::619     6e-16  33%  639 aa  SRPR_BOVIN RecName: Full=Signal recognition particle receptor
  325::616     1e-15  33%  636 aa  SRPR_MOUSE RecName: Full=Signal recognition particle receptor
  327::618     1e-15  33%  638 aa  SRPR_HUMAN RecName: Full=Signal recognition particle receptor
  414::596     4e-15  31%  615 aa  SRPR_DICDI RecName: Full=Signal recognition particle receptor
  402::595     2e-14  34%  614 aa  SRPR_DROME RecName: Full=Signal recognition particle receptor
  327::618     3e-14  31%  638 aa  SRPR_CANFA RecName: Full=Signal recognition particle receptor
  302::602     9e-12  30%  621 aa  SRPR_YEAST RecName: Full=Signal recognition particle receptor
  223::374     1e-11  36%  437 aa  FLHF_PSEPU RecName: Full=Flagellar biosynthesis protein
  347::501     3e-10  29%  547 aa  SRPR_SCHPO RecName: Full=Signal recognition particle receptor
  222::402     5e-08  29%  429 aa  FLHF_PSEAE RecName: Full=Flagellar biosynthesis protein
  234::425     8e-08  27%  455 aa  FLHF_HELPJ RecName: Full=Flagellar biosynthesis protein
  279::474     2e-07  30%  484 aa  FLHF_CAMJE RecName: Full=Flagellar biosynthesis protein
  238::429     2e-07  27%  459 aa  FLHF_HELPY RecName: Full=Flagellar biosynthesis protein
  218::404     9e-07  29%  437 aa  FLHF_TREPA RecName: Full=Flagellar biosynthesis protein
  174::240     1e-06  38%  388 aa  FLHF_BORBU RecName: Full=Flagellar biosynthesis protein
   46::87      6e-04  38%  237 aa  YWQD_BACSU RecName: Full=Tyrosine-protein kinase ywqD;       
   12::57      7e-04  41%  207 aa  KTHY_DINSH RecName: Full=Thymidylate kinase;       
    1::434

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MFQQLAARLQEAIDRLRGRGRITEEDLKGTLREIRRALIEADVNLXXXXXXXXXXXXXXLGRKVLESLTP
SRP54_THEAQ     MFQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVARDFVERVREEALGKQVLESLTP
SRP54_BACSU     -FEGLADRLQQTISKIRGKGKVSEQDVKEMMREVRLALLEAXXXXXXXXXXXXXXSERAVGQDVMKSLTP
SRP54_MYCTU     MFESLSDRLTAALQGLRGKGRLTDADIDATTREIRLALLEADVSLPVVRAFIHRIKERARGAEVSSALNP
SRP54_MYCBO     MFESLSDRLTAALQGLRGKGRLTDADIDATTREIRLALLEADVSLPVVRAFIHRIKERARGAEVSSALNP
SRP54_ECOLI     MFDNLTDRLSRTLRNISGRGRLTEDNVKDTLREVRMALLEADVALPVVREFINRVKEKAVGHEVNKSLTP
SRP54_ECOL6     MFDNLTDRLSRTLRNISGRGRLTEDNVKDTLREVRMALLEADVALPVVREFINRVKEKAVGHEVNKSLTP
SRP54_ECO57     MFDNLTDRLSRTLRNISGRGRLTEDNVKDTLREVRMALLEADVALPVVREFINRVKEKAVGHEVNKSLTP
SRP54_STRMU     -FESLTERLQGVFKNLRGKRKLSEKDVQEVTKEIRLALLEADVALPVVKEFIKRVRKRAVGHEVIDTLDP
SRP54_HAEIN     MFENLSDRLSKTLRNITGKGRLTEDNIKETLREVRMALLEADVALPVVREFIAKVKESALGEEVNKSLTP
SRP54_MYCLE     MFESLSNRLTGVIQGLRGKGRLTDADIEATTREIRLALFEADVSLPVVRAFVHRIKERARGTEVSAALNP
SRP54_AQUAE     MLELLTEKFSHALEKLTNARKITEKNINQTLREIRLALLEADVDYQVAKDFIKRIREKVVGKEVPKNLSP
SRP54_RICCN     MFKTLTQNLTKIFDKLVSSGILTEAQIDAAMRDIRVALLESDVALPVIKDFIAEVKQKALGQEVIKSVSP
SRP54_SYNE7     MFDALAERLEQAWTKLRGQDKISESNVQEALKEVRRALLEADVNLGVVKEFIAQVQEKAVGTQVISGIRP
SRP54_RICFE     MFKTLTQNLTKIFDKLVSSGILTEAQIDAAMRDIRVALLESDVALPVIKDFIAEVKQKALGQEVIKSVSP
SRP54_RICBR     MFKTLTQNLMKIFDRLVSSGLLTEEQIDAALRDIRVALLESDVALPVIKNFVAEVKQKALGQEVIKSVSP
SRP54_RICPR     MFKTLTQNLTKIFDKLVNSGILTENQIDTAMRDVRVALLESDVALPVIKGFIEEVKQKALGQEVIKSVSP
SRP54_SYNY3     MFDALADRLEDAWKKLRGQDKISESNIKEALQEVRRALLAADVNLQVVKGFIKDVEQKALGADVISGVNP
SR54C_ARATH     MFGQLTGGLEAAWSKLKGEEVLTKDNIAEPMRDIRRALLEADVSLPVVRRFVQSVSDQAVGMGVIRGVKP
SRP54_RICTY     MFKTLTQNLTKIFDRLVNSGILTENQIDTAMRDVRVALLESDVALPVIKGFIAEVKQKALGQEVIKSVSP
SRP54_BUCAI     MFNNLTQRLSDSLKKILNKGRLTEENIKETIREVRKALLEADVALSVIKKFIENVKKKSIGHEINKSLTP
SRP54_METAC     VMEKLGDSLQGALKKLIGAGRIDERTVNEVVKDIQRALLQADVNVKLVMGMSQRIKERAMKEEPPAGMNP
SRP54_HELPJ     MFQALSDGFKNALNKIRFQD--DEKALDRALDELKKTLLKNDVHHKVARELL----------KKVESQTK
SRP54_THEON     --EKLGKALNNALRKLARSSTVDEATIKEVVRDIQRALIQADVNVRLVLDLTKRIEKRALEEEPPTGVSK
SRP54_HELPY     MFQALSDGFKNALNKIRFQD--DEKALDRALDELKKTLLKNDVHHKVARELL----------KKVESQTK
SRP54_METBF     VMEKLGDSLQGALKKLIGAGRIDERTVNEVVKDIQRALLQADVNVKLVMGMSQRIKERAMKEAPPAGMNP
SRP54_METST     MLEGLSESLTQTMKKLAGMSIIDKKTLKDVTKDIQRALIQSDVNVKVVFGLTKKIEKRALEEELPKGLSP
SRP54_BUCAP     MFNNLTERLSQSLRKIINKGRLTEENIKDTIREVRKALLEADVTLSVIKKFIQNVSKKAIGHEINKSLTP
SRP54_PYRKO     --EKLGQALNSALKKLARSSTVDEATIKEIVRDIQRALLQADVNVKLVLQLTKQIQKRALEEEPPAGVSK
SRP54_METMA     VMEKLGDSLQGALKKLIGAGRIDERTVNEVVKDIQRALLQADVNVKLVMGMSQRIKERAMKEDPPAGMNP
SRP54_PYRFU     VLDNLGKALANTLKKIARASSVDEALIKELVRDIQRALIQADVNVRLVLQLTREIQRRALEEKPPAGISK
SRP54_THEGJ     --EKLGKALNSALRKLARSSTVDEALIREVVRDIQRALIQSDVNVRLVLQLTKRIQERALNEKPPAGVSP
SRP54_METTP     VLDNLGGSLRGALKKIASATRVDKALVDDAVRDIQRALLQADVNVKLVMSLSNRIRERALNEKPPAGMNP
SRP54_METS3     MLGNLGENLTKTMKKLVGISVIDKKTIEEVVKEIQRALIQSDVNIALVLDLSKKIKKRALEEEPPKGITP
SRP54_PYRAR     ----LTELFSKLVEKIRDVEYIDEATLQEIAREIQRTLLKADVPLDLVKTFTDNAVKRIREEKPPAGIPP
SRP54_METM7     MLDKLGQNLSEALNKIKNATFVDKKLVKEVIKDIQKALIQSDVNVKLVFNMSKEIERKAIEEAPPKGLSK
SRP54_BUCBP     MFNNLTQRFLKIIKKISNKGRLTEKNIKETLREIRIALLEADVALPVVKNFIPSIQKSVIGNQVNKSLTP
SRP54_METVS     MLDKLGQNLSEALNKIKNATFVDKKLVKEVIKDIQKALIQSDVNVKLVFNMSKEIERKAIEEAPPKGFSK
SRP54_PYRIL     ------------VEKIRGVSYIDEATLQELSREIQRALLKADVPLDMVKTFTENAVKRMREEKPPAGIPP
SRP54_METMP     MLDKLGQNLSDALNKLKNATFVDKKLVKEVIKDIQKALIQSDVNVKLVFNMSKEIERKAIDEAPPKGLSK
SRP54_SULIN     --------IRDAVRKFLTRSTPYEKAVDEFIKELQKSLISSDVNVKLVFSLTAKIKERLNKEKPPSVLER
SRP54_PYRAB     VLDSLGKALSNALKKIARAGSVDEALVKEVVRDIQRALIQADVNVRLVLKLTKEIQRRALEEKPPAGISK
SRP54_METM5     MLDKLGQNLSDALNKIKNATFVDKKLVKEVIKDIQKALIQSDVNVKLVFNMSKEIERKAIEEAPPKGLSK
SRP54_MYCMY     ----LSKRMQKSIEKNMKNSTLNEENIKETLKEIRLSLLEADVNIEAAKEIINNVKQKALGGYISEGASA
SRP54_METBU     VMDKLGSSLQDALKKLVGAGRIDEKTVTEVVKDIQRALLQADVNVKLVMQMSSHIKERALKEEVPPGMNP
SRP54_SULIY     ------------------------------IKELQKSLISSDVNVKLVFSLTAKIKERLNKEKPPSVLER
SRP54_SULIL     ------------------------------IKELQKSLISSDVNVKLVFSLTAKIKERLNKEKPPSVLER
SRP54_METM6     MLDKLGQNLSEALNKIKNATFVDKKLVKEVIKDIQKALIQSDVNVKLVFNMSKEIERKAIEEAPPKGLSK
SRP54_SULIM     ------------------------------VKELQKSLISSDVNVKLVFSLTAKIKERLNKEKPPSVLER
SRP54_SULIK     ------------------------------VKELQKSLISSDVNVKLVFSLTAKIKERLNKEKPPSVLER
SRP54_SULIA     ------------------------------VKELQKSLISSDVNVKLVFSLTAKIKERLNKEKPPSVLER
SRP54_STAMF     --------VRKALSRLSGKGDY-ERAVKEFIRDLQKELIKADVNVKLVLELTKKIRERALKEEPPPGITR
SRP54_SULAC     --------LRDAVRKFLGSSDY-EKAVNEFIKELQIILIKADVNVRLVKDLTDRIKKRITEEKPPSAIEK
SRP54_HYPBU     --------IRRAVSKLLKRSGPYENIVNEFIRDLQRALISADVNVRLVFNLTKRIRERALKEQPPPGLSR
SRP54_METTH     MLGNLGRSLSKTMKKLAGMTIVDEEVVREVIKDIQRALIQSDVNIKLVFNLSKSIEERALNEEPPKGITP
SRP54_PYRHO     VLDSLGRALSNALKKIARAGSVDEALVKEVVRDIQRALLQADVNVRLVLKLTKEIQRRALEEKPPAGISK
SRP54_THEVO     VLESLSSSLRETIRKITGSTYIDKNTVKEISKDLQRILLKADVNVQTVLNITKEMERRALEEKPPVGMAH
SRP54_METJA     --------------------------IKEVIKDIQRALIQADVNVKLVLKMSKEIERRALEEKTPKGLSK
SRP54_SULTO     --------LKDAVRKFLGSSNY-DKAVNDFIKELQISLIKSDVNVKLVSNLTQKIKDRLEKEKPPTAIER
SRP54_HALMA     VLDDLGSSLRGTLDDLRGKSRLSEEDIEDIVKEIQRSLLQADVDVGLVQDLSNSIETRALDEEPPAGTTP
SRP54_ARCFU     --------LKEVARKIAGSSSIDKKFVEEMVKEIQRALIKADVNVRQVKEISDAIKKRALSEDVLPALNA
SRP54_UNCMA     VLDNLGTSLKDALRKIANSGKIDKEVIDEVVKDIQRAMIQADVNVKLVMKLSSTIKNRALTEAPPAGMNS
SRP54_THEAC     VLESFSASLRETIRKITGSSYIDKETVKEISKDLQRILLKADVNVKTVLQVTKEMERRALEEKPPAGMAH
SRP54_MYCPN     ---------------------ISETDVQAVLKEIRIXXXXXXXXXXXXKNFIKAIREQTVGQTVEPGQDL
SRP54_PYRAE     ------------LEKIRGVDYIDEATLQELSREIQRTLLKADVPLDLVKSFTENAVKRIKEEKPPAGIPP
SRP54_METLZ     ----LSNSLKDAMKKLAGKTVIDRAAVDELVRDLQRALLSSDVNVKLVMELSKQIKARSLDEDLPKGINA
SRP54_HALLT     VLDDLGTSLRSSLDKLQGKSRLSESDVEEIVKEIQRSLLSADVDVSLVMELSDSIKTRALEEEPPGGTTA
SRP54_HALWD     VLDNLGSSLRGSLDKLQGKSRLXXXXXXXXXXXXQRSLLSADXXXXXXXXXXXXIEDRATGEEPPAGTSA
SRP54_HALSA     VLDDLGSSLRGTLDTLRGKSRISEEDVDKVVKEIQRSLLQADVDVDLVMDLSESITERSLEEEPPGGTSA
SRP54_HALS3     VLDDLGSSLRGTLDTLRGKSRISEEDVDKVVKEIQRSLLQADVDVDLVMDLSESITERSLEEEPPGGTSA
SRP54_THENV     ------------VEKIRGVSYIDEATLQDLSREIQRALLKADVPLDMVKAFTDAAVKRIKEEKPPAGIPP
SRP54_METKA     -----ADRLAEITKKIKGASIIDEDFVKEVVRDVQRALLEADVDVKLVLELSKRIEKRALEEEPPAGVPK
SRP54_HALVO     VLDNLGSSLRGSLDKLRGKSRLDEDDVQEIVKEIQRXXXXXXXXXXXXXXXXXXIKTRALEEEPPGGTSA
SRP54_SULSO     ------------------------------IKDLQKSLISSDVNVKLVFSLTAKIKERLNKEKPPSVLER
SRP54_METS5     --------IRDAVRKFLGGNTSYEVAVEEFIKDIQKALISSDVQVKLVFSLTNKIKERLKKETPPSNLER
SRP54_ENTHI     VLSQLGSSLVTALRKMTSSTVVDEEVINTLLKEIETSLLGEDVNPIFIRQMVNNIKKKINSEDIPDGIDK
SRP54_AERPE     ---------------LRGGG-VYEKAVDAFVKDLQRELIKADVNVKLVLNVTRRIKERALKEEPPPGVTR
SRP54_META3     MLDKLGSNINNALSKIKNATFVDKKLVKEVIKDIQKALIQADVNVKLVFAMSKEIERKAIYESAPKGLSK
SRP54_MOUSE     ----LGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNK
SRP54_PONAB     ----LGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNK
SRP54_MACFA     ----LGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNK
SRP54_HUMAN     ----LGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNK
SRP54_CANFA     ----LGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNK
SRP54_BOVIN     ----LGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNK
SRP54_RAT       ----LGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNK
SRP54_MYCGE     ---------------------ITEKDVELVLKEIRIXXXXXXXXXXXXKNFIKAIRDKTVGQTIEPGQDL
SRP54_PYRCJ     ---KLSEVFSKLIEKIRGVDYIDEAVLQELSREIQRSLLKADVPLELVKAFTDSAVKRIREEKPPAGIPP
SRP54_ACIAM     ---KLLDNLRDAVRKFLTGSSSYDKAVEDFIKELQKSLISADVNVKLVFSLTNKIKERLKNEKPPTYIER
SRP54_NATPD     VLDDLGSSLRGTLDKLQGKTTLSEDDVEEIVKEIQRXXXXXXXXXXXXXXXXXXIRERALDEEPPAGTTA
SR542_ARATH     ---ELGGRIMSAIQKMNNVTIIDEKALNDCLNEITRALLQSDVSFPLVKEMQTNIKKIVNLEDLAAGHNK
SRP54_GEOCY     ----------------RQRTVINEEVLQAMLKEICTALLEADVNVKLVGKLRQNVRAAIDFEDMGAGLSK
SRP54_YEAST     ------------------------------LKGIVTALLESDVNIALVSKLRNNIRSQLLSENRSEKSTT
SRP54_YARLI     VLEDLGKRINGAFANLSKGGDI-DEALDAMLKEVCSALLESDVNIKLVSQ---------LRQKVKNSVTP
SR543_ARATH     ---ELGGRITRAIQQMSNVTIIDEKALNECLNEITRALLQSDVSFPLVKEMQSNIKKIVNLEDLAAGHNK
SRP54_SCHPO     VFADLGRRLNSALGDFSKATSVNEELVDTLLKNICTALLETDVNVRLVQELRSNIKKKINVSTLPQGING
SR542_SOLLC     ---ELGGSISRALQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVRDMTTNIKKIVNLDDLAAGHNK
SR541_SOLLC     ---QLGGSISRALQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVRDMSTNIKKIVNLEDLAAGHNK
SR543_HORVU     ---------------------VDESVLRECLNEIARALMQSDVRFKTVCDLQANIRKTVNLEALAAGTNK
SRP54_CANAL     ----------------------------------------------------------------------
SRP54_DICDI     ----LGNQLSSALRSLNETTIVNEDTINQLLKEVGNALSKSDVSMSLIIQMRKNIKDKIKLDQMAAGLNK
SR541_ARATH     ---ELGGRITRAIQQMNNVTIIDEKVLNDFLNEITRALLQSDVSFGLVEKMQTNIKKIVNLDDLAAGHNK
SRP54_ASPNG     VLQDLGRRINAAVNDLTRSNNLDEKQFDDMIKEICAALLSADVNVRLVQSLRKSIKSSVNFASLPPAVNK
FTSY_ECOLI      ----------------------------------------------------------------------
SR542_HORVU     ---QLGGSISRALAQMSNATVIDEKVLGECLNEISRALLQSDVQFKMVRDMQTNIRKIVNLETLAAGTNK
SR541_HORVU     ---QLGGSISRALAQMSNATVIDEKVLGECLNEISRALLQSDVQFKMVRDMQTNIRKIVNLETLAAGTNK
DOCK_SULAC      ---------------------IKEDDLNDVIEELRFQLLDSDVSYEVTEKILEDLKNNLIGKKVSXXXXX
FTSY_THEAQ      ----------------------------------------------------------------------
FTSY_NEIMC      -----AARLKQGLTKSRGGGQI-DEDL---YEELETVLITSDMDMEATEYLMKDVRD----RVSLKGLKD
FTSY_NEIMB      -----AARLKQGLTKSRGGGQI-DEDL---YEELETVLITSDMGMEATEYLMKDVRD----RVSLKGLKD
FTSY_NEIMA      -----AARLKQGLTKSRGGGQI-DEDL---YEELETVLITSDMGMEATEYLMKDVRD----RVSLKGLKD
FTSY_SYNY3      --------------------------------------------------------------KLREEALP
FTSY_NEIGO      -----AARLKQGLAKSRGGGQIGED----LYEELETVLITGDMGMEATEYLMKDVR----GRVSLKGLKD
Y291_METJA      -----------------------------------------------------------VGRKISPDDNV
FTSY_HAEIN      ----------------------------------------------------------------------
FTSY_AQUAE      ----------------------------------------------------------------------
FTSY_BACSU      ----------------------------------------------------------------------
FTSY_MYCHO      ----------------------------------------------------------------------
FTSY_RICCN      ----------------------------------------------------------------------
FTSY_BUCAP      ----------------------------------------------------------------------
FTSY_RICFE      ----------------------------------------------------------------------
FTSY_RICTY      -----------------------------TLNELEELLISSDISITVVTHIIEKFKNVKFD-KTIDSDTV
FTSY_RICBR      ----------------------------------------------------------------------
FTSY_HELPY      ----------------------------------------------------------------------
FTSY_HELPJ      ----------------------------------------------------------------------
FTSY_MYCGE      ----------------------------------------------------------------------
FTSY_RICPR      ----------------------------------------------------------------------
FTSY_MYCPN      ----------------------------------------------------------------------
FTSY_MYCLE      ----------------------------------------------------------------------
FTSY_BUCBP      ----------------------------------------------------------------------
FTSY_BUCAI      ----------------------------------------------------------------------
FTSY_MYCTU      ----------------------------------------------------------------------
FTSY_MYCBO      ----------------------------------------------------------------------
SRPR_BOVIN      ---------------LVGSKSLTREDMESVLDKMRDHLIAKNVAADIAVQLCESVANKLEGKVMGTFSTV
SRPR_MOUSE      ---------------LVGSKSLSREDMESVLDKMRDHLIAKNVAADIAVQLCESVANKLEGKVMGTFSTV
SRPR_HUMAN      ---------------LVGSKSLSREDMESVLDKMRDHLIAKNVAADIAVQLCESVANKLEGKVMGTFSTV
SRPR_DICDI      ----------------------------------------------------------------------
SRPR_DROME      ----------------------------------------------------------------------
SRPR_CANFA      ---------------LVGSKSLSREDMESVLDKMRDHLIAKNVAADIAVQLCESVANKLEGKVMGTFSTV
SRPR_YEAST      -----------------GNKTINESDLKSVLEKLTQQLITKNVAPEAADYLTQQVSHDLVGSKTAESLTK
FLHF_PSEPU      ----------------------------------------------------------------------
SRPR_SCHPO      ----------------------------------------------------------------------
FLHF_PSEAE      ----------------------------------------------------------------------
FLHF_HELPJ      ----------------------------------------------------------------------
FLHF_CAMJE      ----------------------------------------------------------------------
FLHF_HELPY      ----------------------------------------------------------------------
FLHF_TREPA      ----------------------------------------------------------------------
FLHF_BORBU      ----------------------------------------------------------------------
YWQD_BACSU      ----------------------------------------------------------------------
KTHY_DINSH      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           AEVVLATVYEALKEALGGEPKHPQLKDRNVWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPA
SRP54_THEAQ     AEVILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPA
SRP54_BACSU     GQQVIKVVQEELTELMGGEESKIAVAKRTVIMMVGLQGAGKTTTSGKLALLRKKHNRKPMLVAADIYRPA
SRP54_MYCTU     AQQVVKIVNEELISILGGETRELAFAKTTVVMLAGLQGSGKTTLAGKLAARLRGQGHTPLLVACDLQRPA
SRP54_MYCBO     AQQVVKIVNEELISILGGETRELAFAKTTVVMLAGLQGSGKTTLAGKLAARLRGQGHTPLLVACDLQRPA
SRP54_ECOLI     GQEFVKIVRNELVAAMGEENQTLNLAAQPVVLMAGLQGAGKTTSVGKLGKFLREKHKKKVLVSADVYRPA
SRP54_ECOL6     GQEFVKIVRNELVAAMGEENQTLNLAAQPVVLMAGLQGAGKTTSVGKLGKFLREKHKKKVLVSADVYRPA
SRP54_ECO57     GQEFVKIVRNELVAAMGEENQTLNLAAQPVVLMAGLQGAGKTTSVGKLGKFLREKHKKKVLVSADVYRPA
SRP54_STRMU     SQQIIKIVNEELTAVLGSETAEIEKSSKTIIMMVGLQGAGKTTFAGKLAKLVKEENARPLMIAADIYRPA
SRP54_HAEIN     GQEFLKIVQRELEKAMGNESLNLATQPPAVILMAGLQGAGKTTSVGKLAKFLRERHKKKVLVSADVYRPA
SRP54_MYCLE     AQQIVKIVNEELIGILGGETRQLAFAKTTVVMLAGLQGSGKTTLAGKLAVRLRRQGHTPLLVACDLQRPA
SRP54_AQUAE     AEFVIKTVYEELVDILGGEKA--DLKKGTVLF-VGLQXXXXXXXXXXXANLLKKGGHKVAVSSTDLRRPA
SRP54_RICCN     GQMIIKIIHEEMINLLASSKSETKLKPPVNFLMVGLQGSGKTTASSKLALRLRNQNKKVLLVSLDTYRPA
SRP54_SYNE7     DQQFIKVVYDELVQVMGETPLAQAAKAPTVILMXXXXXXXXXXXXXXXXXHLRKEGRSTLLVATDVYRPA
SRP54_RICFE     GQMIIKIIHEEMINLLASSESETKLKPPVNFLMVGLQGSGKTTASSKLALRLKNQNKKVLLVSLDTYRPA
SRP54_RICBR     GQXXLSSSEDEIKLNLNAKPPVNLL-------MVGLQGSGKTTASGKLALCLKNQNKKVLLVSLDTYRPA
SRP54_RICPR     GQMIIKIIHEEMINLLASTESTTKLKPPVNLLIVGLQGGGKTTASGKLALRLKNQNKKVLLVSLDTYRPA
SRP54_SYNY3     GQQFIKIVYDELVNLMGESPLAQAEQAPTVILMXXXXXXXXXXXXXXXXXXXXXQKRSALMVATDVYRPA
SR54C_ARATH     DQQLVKIVHDELVKLMGGEVSELQFAKSGVILLAGLQGVGKTTVCAKLACYLKKQGKSCMLIAGDVYRPA
SRP54_RICTY     GQMIIKIIHEEMINLLASSESTTKLKPPVNLLMVGLQGGGKTTASGXXXXXXXXXXXXXXXXXXDTYRPA
SRP54_BUCAI     GQEFIKIVKHELIFAMG-EKNHSSIEPPAVILVVGLQGSGKTTSLAXXXXXXXXXXXXXILITSDTYRAA
SRP54_METAC     REHVIRIVYQELMEIIG-KGAEIQLKPQTI-MMVGLQGSGKTTSAAKLARYFQRKGLKAGVVAADTFRPG
SRP54_HELPJ     AQQFLDALEKSLLEILSAKGSSGAQTPPTVVLMAGLQGSGKTTTTAKLAHYLKTKNKKVLLCACDLQRLA
SRP54_THEON     KEHIIKIVYEELTKFLGTEAKPIEIKEKTVLLTVGIQGSGKTTSIAKLARYFQKRGYKVGLVCSDTWRPG
SRP54_HELPY     LNGILDALEKSLLEILSAKGSSGAQTPPTVVLMAGLQGSGKTTTTAKLAHYLKTKNKKVLLCACDLQRLA
SRP54_METBF     REHVIRIVYQELMEIIG-KGAEIQLKPQII-MMVGLQGSGKTTSTAKLARYFQRKGLKAGVVAADTFRPG
SRP54_METST     KEHVMRIVYQELVNLIGEKPEELKINRKPYKIMMGLQGSGKTTTTAKLVKHLKKKGHTSAIVCTDTWRPA
SRP54_BUCAP     GQEFIKIVKNELILSMG-EKNHDSIQPPAIILVVGLQGVGKTTTLVXXXXXXXXXXXXXILVSTDIYRAA
SRP54_PYRKO     KEHIIKIVYEELTKFLGTEAKPLEIKHKTVILTVGIQGSGKTTSVAKLARYLQKRGYKVGVVCSDTWRPG
SRP54_METMA     REHVIRIVYQELMEIIG-KGADIQLKPQTI-MMVGLQGSGKTTSAAKLARYFQRKGLKAGVVAADTFRPG
SRP54_PYRFU     KEHIIKIVYEELTKFLGTEAKPIEIKEKTILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVVCSDTWRPG
SRP54_THEGJ     REHVIKIVYEELTKLLGKEAVPLEIREKTILLTVGIQGSGKTTTIAKLARHLQKRGYKVGLVCTDTWRPG
SRP54_METTP     REHVINIVYQELINLIGRGTDIP-LKKQTI-MLVGLQGSGKTTTAAKLATYFQRRGLRTAVICADTFRAG
SRP54_METS3     REHVITIIYEEMVNLLGGEAPGLDIKPYKILFL-GLQGSGKTTTIGKLCRYLQKKGFNPAVVCTDTWRPA
SRP54_PYRAR     REYLIYVLYEELVKLMGGEQEFKPTKKPYIVLLLGVEGSGKTTTSAKLARYLMKRGYKVGMVETDTIRPA
SRP54_METM7     KEHIVKIVYDELVNLLGETTQKLELSKKSVILLIGIQGSGKTTSAAKLARYIQKKGLRPGLIAADVYRPA
SRP54_BUCBP     GQELIKIVKKELTLILGKENHSLNLSPPAIILMIGLQGSGKTTTTAKLGQLIRTKYKKKVIVTSDIYRLA
SRP54_METVS     KEHIIKIVYDELVKLLGENPQKLELSKKSVILLVGIQGSGKTTSSAKLARYIQKKGMKPALIAADIYRPA
SRP54_PYRIL     REYVLYILYDELVKLLGGEQEFXXXXXXXXXXXXGVEGSGKTTTAAKLARYLVKRGYRVGLVETDTIRPA
SRP54_METMP     KEHIVKIVYDELVKLLGETTQKLELSKKSVILLIGIQGSGKTTSAAKLARYIQKKGLRPGLIAADVYRPA
SRP54_SULIN     KEWFISIVYDELSKLFGGD-KEPNVNPTKLPFLVGVQGSGKTTTAGKLAYFYKRRGYKVGLVAADVYRPA
SRP54_PYRAB     KEHIIKIVYEELTKFLGTEAKPIEIKEKTILLMVGVQGSGKTTTVAKLARHFQKRGYKVGVVCSDTWRPG
SRP54_METM5     KEHIVKIVYDELVKLLGETTQKLELSKKSVILLIGIQGSGKTTSAAKLARYIQKKGLRPGLIAADVYRPA
SRP54_MYCMY     HQQMIKIVHEELVNILGKENAPLDIKKPSVVMMVGLQGSGKTTTXXXXXXXXXXXXXXXXXXXXDIYRPG
SRP54_METBU     REHVIKIVYQELISIVGRSADIP-LKPQTI-MMIGLQXXXXXXXXXXLSRYFQRKGLKPAVICADTFRPG
SRP54_SULIY     KEWFISIVYDELSKLFGGD-KEPNVNPTKLPFLVGVQGSGKTTTAGKLAYFYKRRGYKVGLVAADVYRPA
SRP54_SULIL     KEWFISIVYDELSKLFGGD-KEPNVNPTRLPFLVGVQGSGKTTTAGKLAYFYKRRGYKVGLVAADVYRPA
SRP54_METM6     KEHIVKIVYDELVKLLGETIQKLELSKKSVILLIGIQGSGKTTSAAKLARYIQKKGLRPGLIAADVYRPA
SRP54_SULIM     KEWFISIVYDELSKLFGGD-KEPNVNPTKLPFLVGVQGSGKTTTSGKLAYFYKRRGYKVGLVAADVYRPA
SRP54_SULIK     KEWFISIVYDELSKLFGGD-KEPNVNPTKLPFLVGVQGSGKTTTSGKLAYFYKRRGYKVGLVAADVYRPA
SRP54_SULIA     KEWFISIVYDELSKLFGGD-KEPNVNPTKLPFLVGVQGSGKTTTSGKLAYFYKRRGYKVGLVAADVYRPA
SRP54_STAMF     REWFVNIVYEELSKFFGGXXXXXXXXXXXXWLLVGLQGSGKTTTAAKLAYYYKLEGYRVGLVAADTYRPA
SRP54_SULAC     REWFISIVYDELSRLFGGD-KEPEVMPKKLPYLVGVQGSGKTTTSGKLALFYKKKGYKVGLVAADIYRPA
SRP54_HYPBU     REWLVKLTYDELVKLFGGEYE-PEVKPPYVIMMVGVQGSGKTTTVGKLAKFYRGMGYRVGVVAADTYRPG
SRP54_METTH     KEHIISIVYDEMVKLLGEKSHELVIDDKPYRILLGLQGSGKTTTIGKLARYLRKKGFTVGVVCTDTWRPA
SRP54_PYRHO     KEHIIKIVYEELTKFLGTEAKPIEIKEKTVLLTVGVQGSGKTTTVAKLARYFQKRGYKVGVVCSDTWRPG
SRP54_THEVO     QDYMVKIIYEELLKILG-EPSNVELKPQTI-MLVGLYGHGKTTSAGKLSRFFMKKGLSAGLIAADVHRYA
SRP54_METJA     KEHIIKIVYXXXXXXXXXXXXXXXXKKQNVILLVGIQGSGKTTTAAKLARYIQKRGLKPALIAADTYRPA
SRP54_SULTO     REWFISIVYDELSKLFGGDPEVMPKKIPYVIMLVGVQGSGKTTTAGKLALFYKKKGYKVGLVAADVYRPA
SRP54_HALMA     RDWVLRIVYEELVDLVGESTELP-LEEQTI-MLAGLYGSGKTTTAAKMAWWFSTKGLRPAIIQTDTDRPG
SRP54_ARCFU     KEQILKIVYXXXXXXXXXXXXIPLKKAKIM--LVGLQGSGKTTTTAKMAKYFKDRGMKVAVVAADTWRPA
SRP54_UNCMA     KEHVLRIVYTELVNIVGKAT--PVALQSQTIMMVGLQGSGKTTTSAKIARYFARKGLKPAVICADTYRPG
SRP54_THEAC     QDYMVRIIYEELLKILG-EPSNVKLKPQTI-MLVGLYGNGKTTTAGKLARFFAKKGLNSGLIAADVHRYA
SRP54_MYCPN     QKWLLKVIKQELINILSQPNQEITSKRPLKVMVVGLQGSGKTTTCGKLAVWLKKQQQKAMLVALDIYRPA
SRP54_PYRAE     REYLIYVLYEELVKLLGGEQEFKPTKKPYIVLLLGVEGSGXXXXXXXXXXXXXXRGYKVGLVETDTIRPA
SRP54_METLZ     REHVLRIVYQELVNLVGKEAEF-SLKPQKI-LMAGLQGSGKTTTTGKLCRYFQRKGLKVGAIGADNFRPG
SRP54_HALLT     KDHVLKIVYEEMVELVGDSTELP-LENQTI-LLAGLQGSGKTTSAAKMAWWFSKKGLRPAVIQTDTFRPG
SRP54_HALWD     RDHVLRIVYEELVDLVGDSTDLP-LKSQTI-LLAGLQGSGKTTSAAKMAWWFSTKGLRPAVIQTDTFRPG
SRP54_HALSA     RDHVLRIVYEELVGLVGDSTPIP-LEEQTI-MLAGLQGSGKTTTAAKMAWWFSKKGLRPAIVQTDTFRPG
SRP54_HALS3     RDHVLRIVYEELVGLVGDSTPIP-LEEQTI-MLAGLQGSGKTTTAAKMAWWFSKKGLRPAIVQTDTFRPG
SRP54_THENV     RXXXXXXXXXXXXXXXGGEPEFKPTKKPYVVLLLGVEGSGXXXXXXXXXXXXVKRGYKVGLVETDTVRPA
SRP54_METKA     RDYLLRIVYXXXXXXXXXXXXXXXSRDVNVIMLVGLYGMGKTTTAAKLARYLQRKGYRVGLVGADPYRPA
SRP54_HALVO     RDHVLKIVYEELVDLIGESTEIP-LESQTI-MLAGLQGSGKTTTSAKMAWWFSKKGLRPAVIQTDTFRPG
SRP54_SULSO     KEWFISIVYDELSKLFGGD-KEPNVNPTKLPFLVGVQGSGKTTTAGKLAYFYKKRGYKVGLVAADVYRPA
SRP54_METS5     REWFIKIVYDELSALFGGD-KEPEVNPKSIWVIMXXXXXXXXXXXXXXXXFYKKRGYKVALVGADVYRPA
SRP54_ENTHI     RKLIKDSVFEELINLV--DPKTEAFKPKKVLMMVGLQGAGKTTTITKLALYYKNRGYKPAVVGADTFRAG
SRP54_AERPE     RDWMIKIVYEELVKLFGGEPQVDPPKTPWIVLLVGVQGSGKTTTAGKLAYYYVRRGYKVGLVSSDTHRPG
SRP54_META3     KDHIIKIVYDXXXXXXXXXXXXXXXKNKNIILLVGIQGSGKTTSAAKLARTLQKRGFKPALIAADVYRPA
SRP54_MOUSE     RKMIQHAVFKELVKLVGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTFRAG
SRP54_PONAB     RKMIQHAVFKELVKLVGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTFRAG
SRP54_MACFA     RKMIQHAVFKELVKLVGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTFRAG
SRP54_HUMAN     RKMIQHAVFKELVKLVGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTFRAG
SRP54_CANFA     RKMIQHAVFKELVKLVGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTFRAG
SRP54_BOVIN     RKMIQHAVFKELVKLVGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTFRAG
SRP54_RAT       RKMIQHAVFKELVKLVGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYFYQRKGWKTCLICADTFRAG
SRP54_MYCGE     QKSLLKTIKTELINILSQPNQELNEKRPLKIMMVGLQGSGKTTTCGKLAYWLEKKYKKTMLVGLDIYRPA
SRP54_PYRCJ     RXXXXXXXXXXXXKLLGGEQEFKPTKKPYVVLLLGVEGSGXXXXXXXXXXXXXXRGYKVGLVETDTIRPA
SRP54_ACIAM     REWFIKIVYDELSNLFGGDKEPKVIPDKIPYVIMXXXXXXXXXXXXXXXXFYKKKGFKVGLVGADVYRPA
SRP54_NATPD     RDHVLKIVYEEMVELVGESTALP-LEEQTI-VLAGLQGSGKTTTAAKMAWWFSKKGLRPAVIQTDTFRPG
SR542_ARATH     RRIIEQAIFSELCKMLGKSAFAPKKAKPRVVMFVGLQGSGKTTTCTKYAYYHQKKGYKPALVCADTFRAG
SRP54_GEOCY     RRIIQTSVFNELCKLLDGVPVHPTKGHSNVIMFVGLQGSGKTTTCTKLAYHYQKKGWKTCLVCADTFRAG
SRP54_YEAST     KKLIQKTVFDELCKLVGSEEKAPKKRKTNIIMFVGLQGSGKTTSCTKLAVYYSKRGFKVGLVCADTFRAG
SRP54_YARLI     KKVIQKALFDELVNLVGVDESKPQKGKSNVVMFVGLQGSGKTTSCTKLAVYYQRRGFKVGLVCADTFRAG
SR543_ARATH     RRIIEQAIFSELCKMLGXXXXXXXXXXXSVVMFVGLQGAGKTTTCTKYAYYHQKKGYKPALVCADTFRAG
SRP54_SCHPO     KRIVQKAVFDELCSLV--DPKTPKKGRPSVIMMVGLQGSGKTTTCSKLALHYQRRGLKSCLVAADTFRAG
SR542_SOLLC     RRIIQQAVFNELCKILDGKPSFTPKKGKSIVMFVGLQGSGKTTTCTKYAYYHQKKGWKPALVCADTFRAG
SR541_SOLLC     RRIIQQAVYNELCKILDGKPAFTLKKGKSVVMFVGLQGSGKTTTCTKYAYHHQKRGWKPALVCADTFRAG
SR543_HORVU     RRIIETSVGKELCKMLDGKPAFVPKKGKNVVMFVGLQGSGKTTTCTKYAHYHQRKGFKPSLVCADTFRAG
SRP54_CANAL     ---------------INGKKVRLSKESSHVIMFVGLQGAGKTTSCTKLAVYYKKRGFKVGLVCADTFRAG
SRP54_DICDI     RKIIKQVVFDELIRLLDGVPLWKPTKGKNIVMFVGLQGAGKTTSVTKLAYFYKKKGFSTAIVCADTFRAG
SR541_ARATH     RLIIEQAIFKELCRMLDXXXXXXXXXXXSVVMFVGLQGAGKTTTCTKYAYYHQKKGYKAALVCADTFRAG
SRP54_ASPNG     KRLIQKAVFDELVSLVDAEPFRPKKGRSNVIMFVGLQGAGKTTTCTKLARHYQMRGFKTALVCADTFRAG
FTSY_ECOLI      -------LYGLLKEEMGDEPLNVEGKAPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAA
SR542_HORVU     RRIIQQAVFTELCNMLDGKPAFTPKKGKSVVMFVGLQGSGKTTTCTKYAYYHQRKGFKPSLVCADTFRAG
SR541_HORVU     RRIIQQAVFTELCNMLDGKPAFTTKKGKSVVMFVGLQGSGKTTTCTKYAYYHQRKGFKPSLVCADTFRAG
DOCK_SULAC      XXXXXNTLKKSITEILTKNQKTDLIKKPFVIIFFGVNGVGKTTTIAKVVNMLKKNNLSTIIAASDTFRAA
FTSY_THEAQ      ----------------------------------------KTTTIAKLGRYYQNLGKKVMFCAGDTFRAA
FTSY_NEIMC      GNELRGALKEALYDLIKPLEKPPETKEPFVIMLAGINGAGKTTSIGKLAKYFQAQGKSVLLAAGDTFRAA
FTSY_NEIMB      GNELRGALKEALYDLIKPLEKPPETKEPFVIMLAGINGAGKTTSIGKLAKYFQAQGKSVLLAAGDTFRAA
FTSY_NEIMA      GNELRGALKEALYDLIKPLEKPPETKEPFVIMLAGINGAGKTTSIGKLAKYFQAQGKSVLLAAGDTFRAA
FTSY_SYNY3      PEQAIEFLKEILRSSLPSAEFAPEAEGLNVWLLTGVNGAGKTTTIGKLAFMAKQSGYDCVIAAADTFRAA
FTSY_NEIGO      GNELRGALKEALYDLIKPLEKPPETKEPFVIMLAGINGAGKTTSIGKLAKYFQAQGKSVLLAAGDTFRAA
Y291_METJA      EEITINAVKNAIKNILSQXXXXXXXXXXTVIVFVGINGTGKTTTIAKLAYKLKQKGYSVVLAAGDTFRAG
FTSY_HAEIN      -----------------------------VILMVGVNGVGKTTTIGKLARKFQAEGKSVMLAAGDTFRAA
FTSY_AQUAE      -----------------GELKIPE-KVGAVLLFVGVNGSGKTTTIGKLAHXXXXXXXXXXXXAGDTFRAA
FTSY_BACSU      ----------------------------------------KTTTIGKLAHKMKQEGKSVVLAAGDTFRAG
FTSY_MYCHO      ----------------------------NVILVVGVNGSGKTTSISKIAKKLIDEGKKVLIAAGDTFRAA
FTSY_RICCN      ----------------------------NVILVCGVNGAGKTTTIGKLASMYSAQGKKVAVAACDTFRAA
FTSY_BUCAP      -----------------------------VILVVGINGTGKTTTVSKLAKKYKLAGKSVMLAAADTFRAA
FTSY_RICFE      -EIDSDTVKEALAELIEQQLSKSEINKLNVILVCGVNGAGKTTTIGKLAAMYGMQGKKVAVAACDTFRAA
FTSY_RICTY      KEAIAKLIEQQLSKS--EIPFTLSENKLNIILICGVNGVGKTTTIGKLSALYSAQGKKVAVAACDTFRAA
FTSY_RICBR      ----------------------------NVVLVCGVNGAGKTTTIGKLAAMYGMQGKKVAVAACDTFRAA
FTSY_HELPY      -----------------------------VHLIVGVNGAGKTTTIAKLAKLSLKQHKKALLGAGDTFRAA
FTSY_HELPJ      -----------------------------VHLIVGVNGAGKTTTIAKLAKLSLKQHKKALLGAGDTFRAA
FTSY_MYCGE      ----------------------------NVYLFVGVNGVGKTTTLAKIADFFIKQNKRVLLVAGDTFRAG
FTSY_RICPR      ----------------------------NIILVCGVNGVGKTTTIGKLSALYSAEGKKVAVAACDTFRAA
FTSY_MYCPN      ----------------------------NVYLFVGVNGVGKTTSLAKLADQLTKQNKRVLMVAGDTFRAG
FTSY_MYCLE      -----------------------------------------------LARVLVADGRRVVLGXXXXXXXX
FTSY_BUCBP      -------------------PLNINYKNLFVILVVGVNGVGKTTLIGXXXXXXXXXXXSVILAAGDTFRAA
FTSY_BUCAI      ---------------------------------------------AKLAEKYKLEGKSIMLAAADTFRAA
FTSY_MYCTU      ----------------------------------------------------------------------
FTSY_MYCBO      ----------------------------------------------------------------------
SRPR_BOVIN      TSTVKQALQESLVQILQPQRRVDMLRDPYVVTFCGVNGVGKSTNLAKISFWLLENGFSVLIAACDTFRAG
SRPR_MOUSE      TSTVKQALQESLVQILQPQRRVDMLRDRQRPYVVGVNGVGKSTNLAKISFWLLENGFSVLIAACDTFRAG
SRPR_HUMAN      TSTVKQALQESLVQILQPQRRVDMLRDRQRPYVVGVNGVGKSTNLAKISFWLLENGFSVLIAACDTFRAG
SRPR_DICDI      ----------------------------------GVNGVGKSTNLAKVCYWLTANGYKCMLAACDTFRSG
SRPR_DROME      ----------------------------------GVNGVGKSTNLAKICFWLIENDFNVLIAACDTFRAG
SRPR_CANFA      TSTVKQALQESLVQILQPQRRVDMLRDPYVVTFCGVNGVGKSTNLAKISFWLLENGFSVLIAACDTFRAG
SRPR_YEAST      ALTQILTPVDLLREIQSKRSKKDEEGDPYVFSIVGVNGVGKSTNLSKLAFWLLQNNFKVLIVACDTFRSG
FLHF_PSEPU      --------------------------------MVGPAGMGKTTTLAKLAARYKYGAQNLALVSMDSFRIG
SRPR_SCHPO      --------------------------------LIGVNGVGKSTTLAKIAYWLLSNNFRILVAACDTFRSG
FLHF_PSEAE      ----------------------------------------KTTTLAKMAARYVLKGAQSLLVSMDSYRIG
FLHF_HELPJ      ---------EVLRKIILCRPEDLNLRQKRILMLVGPTGVGKTTTLAKLAARYSAKKYKVGIITLDNYRIG
FLHF_CAMJE      ------------------------IKKQKIMMLVGPTGVGKTTTLAKLAFRYADKRYKTGIITLDTYRIG
FLHF_HELPY      ---------EVLRKMILCCPEDLNLRQKRILMLVGPTGVGKTTTLAKLAARYSAKKYKVGIITLDNYRIG
FLHF_TREPA      ---------------------------RNI-VLVGPTGVGKTTTLAKLAAFYKRTGIQPKIITTDNFRIG
FLHF_BORBU      ---------------------------KRVFILVGPTGVGKTTTIAKLAAIYESKSLNIKIITIDNYRIG
YWQD_BACSU      ---------------------------KSVMITSACPGEGKSTTAANLAVVFAQQGKKVLLIDADLRKP-
KTHY_DINSH      ----------------------------------GIDGSGKSTQARRLAEHLRDTGRDPLLTREPGGSPG


                         +         .         .         .         .         *         .:210
query           AREQLRVLGEKVGVPVLEVQDGESPESIXXXXXXXXXXXXXXXXXXXTAGRLQIDERLMEELVRLKAALR
SRP54_THEAQ     AREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVLG
SRP54_BACSU     AIKQLETLGKQLDMPVFSLGDQVSPVEIAKQAIEKAKEEHYDYVILDTAGRLHIDHELMDELTNVKEIAN
SRP54_MYCTU     AVNQLQVVGERAGVPVFAPHPGASPESXXXXXXXXXXXKHFDVVIVDTAGRLGIDEELMAQAAAIRDAIN
SRP54_MYCBO     AVNQLQVVGERAGVPVFAPHPGASPESXXXXXXXXXXXKHFDVVIVDTAGRLGIDEELMAQAAAIRDAIN
SRP54_ECOLI     AIKQLETLAEQVGVDFFPSDVGQKPVDIVNAALKEAKLKFYDVLLVDTAGRLHVDEAMMDEIKQVHASIN
SRP54_ECOL6     AIKQLETLAEQVGVDFFPSDVGQKPVDIVNAALKEAKLKFYDVLLVDTAGRLHVDEAMMDEIKQVHASIN
SRP54_ECO57     AIKQLETLAEQVGVDFFPSDVGQKPVDIVNAALKEAKLKFYDVLLVDTAGRLHVDEAMMDEIKQVHASIN
SRP54_STRMU     AIDQLKTLGQQINVPVFDMGTEHSAVEIVSQGLAQAKENRNDYVLIDTAGRLQIDEKLMTELRDIKALAN
SRP54_HAEIN     AIKQLETLAQSVGVDFFPSDVKQNPVDIAKSALADAKLKFYDVLIVDTAGRLHVDTEMMDEIKQVHAALN
SRP54_MYCLE     AVNQLQVVGERAGVPVFXXXXXXXXXAVASAGLVEARAKHFDVVIVDTAGRLGIDDELMAQAGAIREAIN
SRP54_AQUAE     AMLQLQRLAERVGVPYYEFEEGLGAVEIARRAVKRAKEESVDYLLLDTAGRLHVDEELMKELQEIKEVTN
SRP54_RICCN     AQEQLAILANSVQINSLPIVQGEKPLDIVKRAIAEAKISAYDVVIYDTAGRTQIDKAMMEEALAIKKIVE
SRP54_SYNE7     AIDQLITLGKQIDVPVFELGSDANPVEIARQGVEKARQEGIDTVIVDTAGRLQIDTEMMEELAQVKEAIA
SRP54_RICFE     AQEQLAILANSVQINSLPIVQGEKPLDIVKRAIAEAKISAYGVVIYDTAGRTQIDKEMMEEALAIKKIVE
SRP54_RICBR     AQEQLEILANSVKINSLPIVKGEKPLDIVKRAMAEAKLSAYDIVIYDTAGRTQIDQEMMNEAIAIKKIVE
SRP54_RICPR     AQEQLAIIANSVNIDSLPIVKGEKPLDIVKRAIGEAQISAYDVVIYDTAGRIQIDNVMMEEALAIKKILN
SRP54_SYNY3     AIDQLKTLGQQIDVPVFDLGSDANPVEIARQGVEKAKELGVDTVLIDTAGRLQIDPQMMAELAEIKQVVK
SR54C_ARATH     AIDQLVILGEQVGVPVYTAGTDVKPADIAKQGLKEAKKNNVDVVIMDTAGRLQIDKGMMDELKDVKKFLN
SRP54_RICTY     AQEQLAIIANSVNIDSLPIVQGEQPLDIVKRAISEAKIFAYDVVIYDTAGRIQIDNVMMEEALAIKKILN
SRP54_BUCAI     AIEQLKILSDQIEIDFFESDKHHTPIEITKNAIKYAKLKLYDVLLIDTAGRLHIDKKMMNEIQQIQVISK
SRP54_METAC     AYHQLKTLAEKLNVGFYGEEG--NPDAVEITKNGLKALEKYDIRIVDTAGRHALEADLIEEMERIHAVAK
SRP54_HELPJ     AVEQLKVLGEQVGVEVFH-EENKSVKEIANNALKRAKEAQFDVLIVDSAGRLAIDKELMQELKEVKEVLN
SRP54_THEON     AYQQLKQLVEPFGIEVFGDPEEKDAIKLAKEGVEHFREKGVDIIIVDSAGRHKEEKSLIEEMKQISAAIK
SRP54_HELPY     AVEQLKVLGEQVGVEVF-YEENKSVKEIASNALKRAKEAQFDVLLVDSAGRLAIDKELMQELKEVKEILN
SRP54_METBF     AYHQLKTLCEKLNVAFYGEEN--NPDAVEITRNGLKALEKYDVKIVDTAGRHALEADLIEEMEQINAVAK
SRP54_METST     AYEQLRQLTEPLDVPVFG--DPENKDAIDLAKKGLEKCGSKYDVILVTAGRHKEEKDLLDEMAELSQIVQ
SRP54_BUCAP     AIKQLQILSDQVKIDFYLSDTTQTPINITKEAIEHAKLKLYDLLLIDTAGRLHINTEMMNEINTIQNISK
SRP54_PYRKO     AYYQLRQLLDPFGIEVFGDPEEKDAVKLAREGVEHFREKGVDVIIVDSAGRHKEEKGLIEEMRQISEAIK
SRP54_METMA     AYHQLKTLSEKLNVGFYGEEG--NPDAVEITIHGLKALEKYDIKIVDTAGRHALEADLIEEMERIHAVAK
SRP54_PYRFU     AYHQLRQLLDRYHIEVFGNPQEKDAIKLAKEGVDYFKSKGVDIIIVDTAGRHKEDKALIEEMKQISNVIH
SRP54_THEGJ     AYYQLKQLVEPYNIEVFGDPGEKDAIKLAREGVEYFKDKGVDVIIVDTAGRHKEESGLIEEMKQISEAIK
SRP54_METTP     AYDQLKALCDRQGIFFYGEKGNENAPEVAKNGLEATKKYDVRIVD--TAGRHALESDLIQEMKDIHAVVN
SRP54_METS3     AYEQLRQLTEEMQVPLYG--DPDNKDALDLAQKGLKEFKNRKVIIFDTAGRHKQEEDLIAEMDTLDDIIQ
SRP54_PYRAR     AFDQLRQLAEKIGAPFYGERDGK--DAVEIARRGVANLKGVDVLIIDTAGRHRNEEALLQEVKAIYDAVN
SRP54_METM7     AYQQLKQLSEKINVPLFG-DETRTKTPVEITKEGMEKLKKVDVIIIDTAGRHKEEEGLLAEMREMKDLTN
SRP54_BUCBP     AIKQLKMLSKQAKISFFPSNNTQSPKDIVQHAIQHAKLKFYDVLLIDTAGRLQIDKKMMNELLDVYNISH
SRP54_METVS     AYQQLKQLSEKINVPLFG-DETKTKTPVEIVKEGIEKLKKSDVLIIDTAGRHKEEESLLEEMKQMKEITN
SRP54_PYRIL     AFDQLKQLAEKIGVPFYGERD--SKDAVEIARRGVQNFKNMDVVIIDTAGRHKNEEALLQEVKMIYEAVN
SRP54_METMP     AYQQLKQLSEKINVPLFG-DETRTKTPVEITKEGMEKLKKVDVIIIDTAGRHKEEEGLLAEMKEMKDLTN
SRP54_SULIN     AYDQLLQLGNQIGVPVYGEPNNQNAIEIAKKGVDTFVKNKMDIIIVDTAGRHGYGEKLLEEMKEIYEALK
SRP54_PYRAB     AYHQLKQLLDPYHIEVFGDPNEKDAIKLAKEGVEHFKAKGVDLIIVDTAGRHKEEKDLIEEMRMISNEIK
SRP54_METM5     AYQQLKQLSEKINVPLFG-DETRTKTPVDITKEGMEKLKKVDVIIIDTAGRHKEEESLLAEMKEMKDLTN
SRP54_MYCMY     AIEQLVQLGQKTNTQVFE-KGKQDPVKTAEQALEYAKENNFDVVILDTAGRLQVDQVLMKELDNLKKKTS
SRP54_METBU     AYQQLKTLCDKLNVPFY----GENPDAVGIVERGLAELGKNDVLIVDTAGRHSLEADLIDEMEQIHEIAQ
SRP54_SULIY     AYDQLLQLGNQIGVPVYGEPNNQNAIEIAKKGVDTFVKNKMDIIIVDTAGRHGYGEKLLEEMKEIYEALK
SRP54_SULIL     AYDQLLQLGNQIGVPVYGEPNNQNAIEIAKKGVDTFVKNKMDIIIVDTAGRHGYGEKLLEEMKEIYEALK
SRP54_METM6     AYQQLKQLSEKINVPLFG-DETRTKTPVDITKEGMEKLKKVDVIIIDTAGRHKEEEGLLAEMKEMKDLTN
SRP54_SULIM     AYDQLLQLGNQIGVPVYGEPNNQNAIEIAKKGVDTFVKNKMDIIIVDTAGRHGYGEKLLEEMKEIYEALK
SRP54_SULIK     AYDQLLQLGNQIGVPVYGEPNNQNAIEIAKKGVDTFVKNKMDIIIVDTAGRHGYGEKLLEEMKEIYEALK
SRP54_SULIA     AYDQLLQLGNQIGVPVYGEPNNQNAIEIAKKGVDTFVKNKMDIIIVDTAGRHGYGEKLLEEMKEIYEALK
SRP54_STAMF     AYDQLKQLGEQIGVPVYGEPDNKDAVEIARRGVEYFVSRGFDIVIVDTAGRHHREEDLLREMREIAENIK
SRP54_SULAC     AYEQLIQIGQQINIPVYGEPGNKNPIEIATNGLEKFLKEKMNIVIIDTAGRHGYGEELLEEMKSMYDKIH
SRP54_HYPBU     AYEQLKQLADRAGAMFYGEPGSKDPVGIARRGVEELKQRGADIVIVDTAGRHGYEEALLDEMKRIAEAIK
SRP54_METTH     ALEQLKQYTE--GQDVSIYGDPQNRDALDLAEKGLARFQKKDVIIFDTAGRHKEEKDLLREMEELSAIVE
SRP54_PYRHO     AYHQLKQLLDPYHIEVFGDPNEKDAVKLAKEGVEYFKTRDVDLIIVDTAGRHKEEKDLXXXXXXXXXXXX
SRP54_THEVO     AYEQLQQIAESVNAKFYG--DPKEKDPVKIIKNGLEVLKDAQVKIIDTSGRDSLDSDLIEEIRRIKEAVK
SRP54_METJA     AYEQLKQLAEKIHVPIYG-DETRTKSPVDIVKEGMEKFKKADVLIIDTAGRHKEEKGLLEEMKQIKEITN
SRP54_SULTO     AYDQLVQIGKQINVPVYGEPNNTDAVGIAKRGVEKFLSEKYDIIIVDTAGRHGYGEKLLEEMKNMYSEIK
SRP54_HALMA     AYDQSKEMAERAEVDFYGDPDEDDPVKIARDGLEATENADVRIVD--TAGRDGLNXXXXXXXXXXXXXXX
SRP54_ARCFU     AYEQLRQLAEEYGITFYG-EKGEK-DAVKIVKNALEKLKDHDMIIIDTAGRHALEDELIDEMIKIAEVAR
SRP54_UNCMA     AYDQLKQLCDKLGVGFYG--EAGNKDAVAIVRNGLKEMAKYDVKIVDTAGRHALETDLIQEMKDIYGLTK
SRP54_THEAC     AYDQLKQIASEVNAKFYGDQSEKDP--VRLIKHGLEQLKDVAVKIIDTSGRDSMDAELFDEIRRIKEAVA
SRP54_MYCPN     AIDQLATLAEQTE-SVFFAKGTQAPDQTTKEAVKTFKESGCQAIICDTAGRLQTNQELMDELVAIKNELH
SRP54_PYRAE     AFDQLRQLAEKIGVPFYGERDGK--DAVEIAKRGVQNFKNMDVIIVDTAGRHRNEEALLKEVRAIYDAVS
SRP54_METLZ     AYAQLETLCKKINVP--SYGDPKEKDAVKIVKDGLAALKDVDVIIVDTAGRHALEDDLIDEITQVNAYLN
SRP54_HALLT     AYDQAKQMCERAEVDFYGDPDNDDPVAIAREGLEATADADVHIVD--TAGRHXXXXXXXXXXXXXXRAVD
SRP54_HALWD     AYDQAEQMCERAEVSFYGDPDCDDPVKIAREGIEATADADIHIVD--TAGRHALEADLIDEIEAIDSTVA
SRP54_HALSA     AYEQAAEMADRAEVDFYGEPDSDDPVQIARDGLAATADADVHIVD--TAGRHXXXXXXXXXXXXXXXXXX
SRP54_HALS3     AYEQAAEMADRAEVDFYGEPDSDDPVQIARDGLAATADADVHIVD--TAGRHXXXXXXXXXXXXXXXXXX
SRP54_THENV     AFDQLRQLAEKIGVPFYGERDGK--DAVEIARRGVQNLKNLDVVIVDTAGRHRNEEALLQEVKAIYEAVS
SRP54_METKA     AGEQLRQLXXXXXXXXXXXXXXXXXXXXXKGVEALKDECDVVIVD--TAGRDRLSEDLIDELREMAERIE
SRP54_HALVO     AYDQAKQMCERAEVDFYGDPDCDDPVQIAREGLEATEDADVHIVD--TAGRHAXXXXXXXXXXXXXGVVQ
SRP54_SULSO     AYDQLLQLGNQIGVQVYGEPNNQNPIEIAKKGVDIFVKNKMDIIIVDTAGRHGYGXXXXXXXXXXXXVLK
SRP54_METS5     ALEQLQQIGKQINVPVYGEPGSQDAVGIAKRGVEKFLSERYELVIVDTAGRHGYGEKLLEEMKDIYEKIK
SRP54_ENTHI     AYEQLQMNAKRAGVPFFGIKEESDPVKVASEGVRTFRKEKNDIILVDTSGRHKQDKELFKEMQSVRDAIK
SRP54_AERPE     AYEQLKRLAEEAGAMFYGEREGD-PAEIARRGLEDLLSRGAEIVIVDTAGRHGHGERLLDEMKAIASKVR
SRP54_META3     AYQQLKQLSEKIHIP-LHGDPTKTKTPMEITEEGLKQFKKNDVIIIDTAGRHXXXXXXXXXXXXXXXXXX
SRP54_MOUSE     AFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVSNAIQ
SRP54_PONAB     AFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQ
SRP54_MACFA     AFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQ
SRP54_HUMAN     AFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQ
SRP54_CANFA     AFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQ
SRP54_BOVIN     AFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQ
SRP54_RAT       AFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVSNAIQ
SRP54_MYCGE     AIEQLETLSQQTN-SVFFAQGTQPVAKTTKAALSAFKTAKCQTIICDTAGRLQTNETLMDELVSVKNELN
SRP54_PYRCJ     AFDQLKQLAEKIGVPFYGERDGKN--AVEIAVRGVQNFKNMDVVIIDTAGRHRNEEELLKEVKAIYDAVK
SRP54_ACIAM     AXXXXXXXXXXIGVPVYGEPGEKDAVGIAKRGVEKFLSEKMEIIIVDTAGRHGYGEELLEEMKNIYEAIK
SRP54_NATPD     AYDQAKEMCERAEVDFYGNPDSDDPVEIAERGLEETADADVHIVD--TAGRHXXXXXXXXXXXXXXSAVD
SR542_ARATH     AFDQLKQNATKSKIPYYGSYTGSDPVKIAVEGVDRFKKENCDLIIVDTSGRHKQQASLFEEMRQISEATK
SRP54_GEOCY     AFDQLKQNATKARVPFYGSYTEMDPVVIAQEGVEKFKEDSFEVIIVDTSGRHKQEESLFEEMLQVSQAID
SRP54_YEAST     AFDQLKQNAIRARIPFYGSYTETDPAKVAEEGINKFKKEKFDIIIVDTSGRHHQEEELFQEMIEISNVIK
SRP54_YARLI     AFDQLKQNATKAKIPFFGSYTETDPVAVAAEGVAXXXXXXXXXXXVDTSGRHRQESELFTEMVDIGAAVK
SR543_ARATH     AFDQLKQNATKAKIPFYGSYTESDPVKIAVEGVDTFKKENCDLIIVDTSGRHKQEASLFEEMRQVAEATK
SRP54_SCHPO     AFDQLKQNAIKARVPYFGSYTETDPVVIAKEGVDKFKNDRFDVIIVDTSGRHQQEQELFAEMVEISDAIR
SR542_SOLLC     AFDQLKQNATKAKIPFYGSYTESDPVKIAVDGVETFKKENCDLIIVDTSGRHKQEAALFEEMRQVAEATK
SR541_SOLLC     AFDQLKQNATKAKIPFYGSSYTESPVKIAVDGVETFKKENCDLIIVDTSGRHKQEAALFEEMRQVSEAQK
SR543_HORVU     AFDQLKQNATKAKIPFYGSYMESDPVKIAVEGLEKFRQEKSDLIIIDTSGRHMQEAALFEEMRQVAEATK
SRP54_CANAL     AFDQLKQNAIKANIPYYGSYLEPDPVKIAFEGVQKFKQEKFDIIIVDTSGRHRQEEQLFTEMVQIGEAVQ
SRP54_DICDI     AFDQVRHNAAKAKIHYYGSETEKDPVVVARTGVDIFKKDGTEIIIVDTSGRHKQDSELFEEMKQIETAVK
SR541_ARATH     AFDQLKQNATKAKIPFYGSYTESDPVKIAVEGVDRFKKEKCDLIIVDTSGRHKQAASLFEEMRQVAEATE
SRP54_ASPNG     AFDQLKQNATKAKIPYYGSLTQTDPAIVAAEGVAKFKKERFEIIIVDTSGRHKQEEELFTEMTQIQTAVT
FTSY_ECOLI      AVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKARNIDVLIADTAGRLQNKSHLMEELKKIVRVMK
SR542_HORVU     AFDQLKQNATKAKIPFYGSYMESDPVKIAVEGLERFRKENSDLIIIDTSGRHKQEAALFEEMRQVAEATK
SR541_HORVU     AFDQLKQNATKAKIPFYGSYMESDPVKIAVEGLERFRKENSDLIIIDTSGRHKQEAALFEEMRQVAEATK
DOCK_SULAC      AQEQLAYHASKLEVQLIRGKYGADPASVAFDAISFAKSRNIDVVLIDTAGRMHIDSDLVEELKRVLRIAK
FTSY_THEAQ      GGTQLSEWGKRLSIPVIQGPEGTDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAIE
FTSY_NEIMC      AREQLQAWGERNNVTVISQTTGDSA-AVCFDAVQAAKARGIDIVLADTAGRLPTQLHLMEEIKKVKRVLQ
FTSY_NEIMB      AREQLQAWGERNNVTVISQTTGDSA-AVCFDAVQAAKARGIDIVLADTAGRLPTQLHLMEEIKKVKRVLQ
FTSY_NEIMA      AREQLQAWGERNNVTVISQTTGDSA-AVCFDAVQAAKARGIDIVLADTAGRLPTQLHLMEEIKKVKRVLQ
FTSY_SYNY3      AVEQVKVWGERSGVPVINPGQNTDPAAVVYDGISAAQSRNVNLLLVDTAGRLQNKKNLMDELAKIKAPNA
FTSY_NEIGO      AREQLQAWGGRNNVTVISQTTGDS--AAVCFDAVQAAKARIDIVLADTAGRLPTQLHLMEEIKKVKRVLQ
Y291_METJA      AIEQLEQHAKNVGVKVIKHKPGADSAAVIYDAIQHAKARGIDVVLADTAGRQATNVNLMEEIKKVVRVTK
FTSY_HAEIN      AVEQLQVWGERNHIPVVAQSTGSDSASVIFDAMQSAAARNIDILIADTAGRLQNKNNLMDELKKIVRVMK
FTSY_AQUAE      AIEQLEVWAKRAGVDIVKKEEGSDPGAVVYEGMKKAKEEGYEVVLVDTAGRLHTKEPLINELRKIKKVIQ
FTSY_BACSU      AIEQLEVWGERTGVPVIKQTAGSDPAAVIYDAVHAAKARNADVLICDTAGRLQNKVNLMKELEKVKRVIE
FTSY_MYCHO      AVEQLEIWAKRVGADIVTPNENEDPAAVVYRAIDIAKSKKYDILIVDTAGRLQNKVNLMNELAKINRVLA
FTSY_RICCN      AVNQLSTWADRANALLITGEESADPASVAYRGMEESIKQNIDILFIDTAGRLHNKKNLMDELSKIVKVIK
FTSY_BUCAP      GIEQLQILGKRNNIPVISQSSGSDPASVAFDAVKSAISKKIDVLIIDTAGRXXXXXXXMVRVIKKLNLSA
FTSY_RICFE      AVNQLSTWVDRANALLITGEESADPASVAYRAMEESIKQNIDILFIDTAGRLHNKKNLMDELSKIVKVIK
FTSY_RICTY      AINQLSSWVDRANALLITGEVSADPASVAYRAIQESIKQNIDILFIDTAGRLHNNKNLMDELSKIVKVIK
FTSY_RICBR      AVNQLDSWVTRAKALLITGEEAADPASVAYRAVEESIKQDIDILFIDTAGRLHNKKNLMDELTKIVKVIK
FTSY_HELPY      AVKQLQLWGEKLNIQVISAKEGSDPSSLAYNTIESAIAKNIDEVFIDTAGRLHNQTNLKNELSKIARTCA
FTSY_HELPJ      AVKQLQLWGEKLNVQVISAKEGSDPSSLAYNTIESAIAKNIDEVFIDTAGRLHNQTNLKNELSKIAHTCA
FTSY_MYCGE      AIEQLNQWAKLLNCDIVLPNPKEQTPAVIFRGVKKGIDDKYDFVLCDTSGRLQNKLNLMNELQKIYQIIQ
FTSY_RICPR      AINQLSSWVHRANALLITGKASADPASVAYRAIEESIKQNIDILFIDTAGRLHNNKNLMDELSKIVKVIK
FTSY_MYCPN      AVAQLAEWAQRIGCDIVLPNPKEETPAVIFRGVQQGIQNEYDFVLCDTSGRLQNKTNLMNELVQKVSSAK
FTSY_MYCLE      XXDQLQTWASRVGAELVRGVEGADPASVAFDAVDKGIGAGADVVVIDTAGRLHTKVGLMDELDKIKRVVT
FTSY_BUCBP      AIDQLKLWGEINSVSVITREIGSDPASVVYDAIKIAKLKCIDILIIDTAGRLHNKNNLMEELKKIKRVIH
FTSY_BUCAI      GIEQLQTLGKLNNIPVIAQRSGSDPAAVIFDAVKSAKSKKIDVLIIDTAGRLHNKLHLIEELXXXXXXXX
FTSY_MYCTU      --------------------EGADPASVAFDAVDKGIAAGADVVLIDTAGRLHTKVGLMDELDKVKRVVT
FTSY_MYCBO      --------------------EGADPASVAFDAVDKGIAAGADVVLIDTAGRLHTKVGLMDELDKVKRVVT
SRPR_BOVIN      AVEQLRTHGGRTMVQLFEKGYGKDXXXXXXXXXXXXRNQGFDVVLVDTAGRMQDNAPLMTALAKLITVNT
SRPR_MOUSE      AVEQLRTHGGRTMVQLFEKGYGKDXXXXXXXXXXXXRNQGFDVVLVDTAGRMQDNAPLMTALAKLITVNT
SRPR_HUMAN      AVEQLRTHGGRTMVQLFEKGYGKDXXXXXXXXXXXXRNQGFDVVLVDTAGRMQDNAPLMTALAKLITVNT
SRPR_DICDI      AIEQLKTHADRLNVHLFERGYSKDAASVAQDAIAFAKDTGYDVVLIDTTGRMQNNEPLMKALSKLVNQNN
SRPR_DROME      AVEQLRTHTRHLNVQLYEKGYGKDAAGIAMEAIKFAHDTRVDVVLVDTAGRMQDNEPLMRSLSKLIKVNN
SRPR_CANFA      AVEHVRTHTRRLSVQLFEKGYGKDXXXXXXXXXXXXRNQGFDVVLVDTAGRMQDNAPLMTALAKLITVNT
SRPR_YEAST      AVEQLRVHVENLAVELFEAGYGGSDTKIAKQAIKYSRDQNFDIVLMDTAGRRHNDPTLMSPLKSFADQAK
FLHF_PSEPU      AQEQLKTLGRILNVPVTYVDPGQS------LAAALEPLLRKRVVLIDTAGLQASDPALRMQLETLAGRGI
SRPR_SCHPO      AIEQLGVHVKNLSIELFAQGYGKDSSFVVKNAVEYAKQNSFDVILIDTAGRRHNDQRLMGSLEKFTKATK
FLHF_PSEAE      AQEQIKTLGRILNVPVTLVDPGQS------LIQALAPLARKRMVLIDTAGLPASDPALRMQLEALASPSL
FLHF_HELPJ      ALEQLSWYANKMKMSIEAVIDAKD------FAKEIEALEYCDFILVDTTGHSQYDKEKIAGLKEFIDGGY
FLHF_CAMJE      AVEQLFQYAKMMKLPIIDIEPKDLDEAI-------KSLNNCEVILVDTIGNSQYDQKTKEFLMHSNAEI-
FLHF_HELPY      ALEQLSWYANKMKMSIEAVIDAKD------FAKEIEALEYCDFILVDTTGHSQYDKEKIAGLKEFIDGGY
FLHF_TREPA      AAFQMERYCELMGLDLCVVQ-----APVEFLTYMTLYQQETDVVFVDTEGRSPVDGQNIERMVEYFRAVK
FLHF_BORBU      AKKQIQTYGDIMGIPVRAIE--------------------------------------------------
YWQD_BACSU      ----------------------------------------------------------------------
KTHY_DINSH      AEDIRRLLVE------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           PDEVLLVLDAMTGQEALSVAQAFDERVGVTGLVLTKLDGDARGGAALSARRVTGKPIYFAGVSERPEGLE
SRP54_THEAQ     PDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGLE
SRP54_BACSU     PEEIFLVVDSMTGQDAVNVAKSFNEQLGLTGVVLTKLDGDTRGGAALSIRAVTNTPIKFAGLGEKLDALE
SRP54_MYCTU     PDEVLFVLDAMIGQDAVTTAAAFGEGVGFTGVALTKLDGDARGGAALSVREVTGVPILFASTGEKLEDFD
SRP54_MYCBO     PDEVLFVLDAMIGQDAVTTAAAFGEGVGFTGVALTKLDGDARGGAALSVREVTGVPILFASTGEKLEDFD
SRP54_ECOLI     PVETLFVVDAMTGQDAANTAKAFNEALPLTGVVLTKVDGDARGGAALSIRHITGKPIKFLGVGEKTEALE
SRP54_ECOL6     PVETLFVVDAMTGQDAANTAKAFNEALPLTGVVLTKVDGDARGGAALSIRHITGKPIKFLGVGEKTEALE
SRP54_ECO57     PVETLFVVDAMTGQDAANTAKAFNEALPLTGVVLTKVDGDARGGAALSIRHITGKPIKFLGVGEKTEALE
SRP54_STRMU     PNEILLVVDSMIGQEAANVAREFNQQLEVTGVILTKIDGDTRGGAALSVRQITGKPIKFTGTGEKITDIE
SRP54_HAEIN     PIETLFTVDAMTGQDAANTAKAFNEALPLTGVILTKVDGDARGGAALSIRQITGKPIKFLGVGEKTEALE
SRP54_MYCLE     PDEVLFVLDAMIGQDXXXXXXXXXXXXXXXXXXLTKLDGDARGGAALSVREVTGVPILFATTGEKLDDFD
SRP54_AQUAE     PSEILYVADAMQGQTALETAKTFHERLGLTGVVITKMDGDARGGLALSVKEVLGVPIKFIGVGEKIEDIE
SRP54_RICCN     PTETLLVIDSMTGQDAVVTASSFNEKLAISGLILSRIDGDSKGGAALSVKYITKKPIKFLSSGENLIDLE
SRP54_SYNE7     PHEVLLVVDSMIGQEAASLTRSFHERIGITGAILTKLDGDSRGGAALSIRRVSGQPIKFVGLGEKVEALQ
SRP54_RICFE     PTETLLVIDSMTGQDAVVTANSFNEKLEISGLILSRIDGDSKGGAALSVKYITKKPIKFLSSGEKLTDLE
SRP54_RICBR     PTETLLVIDSMTGQDAVVTASSFNEQLEISGLILSRIDGDSKGGAALSVKYITQRPIKFLSSGEKLTDLE
SRP54_RICPR     PTETLLVIDSMTGQDAVITAKTFSEKLEISGLILSRIDGDTKGGAALSVKYFTQKPIKFLSSGEKLTDLE
SRP54_SYNY3     PDDTLLVVDAMTGQEAANLTHTFHEQIGITGAILTKLDGDTRGGAALSVRQISGQPIKFVGVGEKVEALQ
SR54C_ARATH     PTEVLLVVDAMTGQEAAALVTTFNVEIGITGAILTKLDGDSRGGAALSVKEVSGKPIKLVGRGERMEDLE
SRP54_RICTY     PTETLLVIDSMTGQDAVVTARSFSDKLEISGLILSRIDGDTKGGAALSVKYLTQKPIKFLSCGEKLTDLE
SRP54_BUCAI     AIETLLIVDSMMGQDAINMAKIFNNDLLISGIILTKTDGDSRSGIALSMRYITGKPIKFIGTGEKIISLE
SRP54_METAC     PDHKFMVLDAGIGQQASQQAHAFNDSVGITGVIITKLDGTAKGGGALSAVSETKAPIAFIGVGETPEDFE
SRP54_HELPJ     PHEVLYVADALSGQDGVKSANTFNEEIGVSGVVLSKFDSDSKGGIALGITYQLGLPLRFIGSGEKIPDLD
SRP54_THEON     PHEVILVIDGTIGQQAYNQALAFKEATPIGSIIVTKLDGSAKGGGALSAVAATGAPIKFIGVGERIDDLE
SRP54_HELPY     PHEVLYVADALSGQDGVKSANTFNEEIGVSGVVLSKFDSDSKGGIALGITYQLGLPLRFIGSGEKIPDLD
SRP54_METBF     PDHKFMVLDAGIGQQASQQAHAFNDSVGITGVIITKLDGTAKGGGALSAVSETKAPIAFIGVGETPEDFE
SRP54_METST     PDEVILVIDGTIGQQARSQAETFKKTTDIGSIIVSKLDGSAKGGGALSAVAEIRAPIKFIGTGERVDDFE
SRP54_BUCAP     PIETLLIVDSMMGQDAINIAKKFSASLSISGIVITKTDSDARSGVALSIRHITGKPIKFIGTGEKLHQLE
SRP54_PYRKO     PHEVILVIDGTIGQQAYNQAMAFKEATPIGSIIVTKLDGSAKGGGALSAVAATGAPIKFIGTGERIDDLE
SRP54_METMA     PDHKFMVLDAGIGQQASQQAHAFNDSVGITGVIITKLDGTAKGGGALSAVSETKAPIAFIGVGETPEDFE
SRP54_PYRFU     PHEVILVIDGTIGQQAYNQALAFKEATPIGSIIVTKLDGSAKGGGALSAVAATGAPIKFIGTGEKIDDIE
SRP54_THEGJ     PHEVILVIDGTIGQQAYHQALAFKEATPIGSIIVTKLDGSAKGGGALSAVAATGAPIKFIGVGEKIDDLE
SRP54_METTP     ADHKLLVMDAAIGQQASEQARAFNEAVGITGVIITKLDGTAKGGGALSAVAETKTSVAFIGVGETASDLE
SRP54_METS3     PTESILVIDGTIGQQAGEQAKAFSQATDVGSIIITKLDGSAKGGGAMSAVAETGAPIKFIGTGERIDDFE
SRP54_PYRAR     PDEVVLVVDATVGKLAAAQAEAFMKYLPIHTVIITKMDSTARGGGALAAVAKTGARVKFIGVGEDVEELE
SRP54_METM7     PTEIILVIDGTLGQQAKNQAKAFKESVSEIGSILTKLDGSAKGGGALSAVAEINAPIKFIGTGEGVDNLE
SRP54_BUCBP     PIETFFVADAMFGQDSINVINEFNKYLPVSSFIITKTDSDTRAGIILSIKYLTKKPIKFIGTGEKLEELE
SRP54_METVS     PNEIILVIDGTLGQQAKNQAKAFKDAVSEIGSILTKLDGSAKGGGALSAVAEINAPIKFIGTGEGVDNLE
SRP54_PYRIL     PDEVILVIDATVGKLAAAQAEAFMKYLPIHSVIITKMDSTARGGGALAAVIKTGARVKFIGVGEDVDEFD
SRP54_METMP     PNEIILVIDGTLGQQAKNQAKAFKESVSEIGSILTKLDGSAKGGGALSAVAEINAPIKFIGTGEGVDNLE
SRP54_SULIN     PDDVILVIDASIGQKAYDLASRFHQASPIGSIIITKMDGTAKGGGALSAVAATGATIKFIGTGEKIDELE
SRP54_PYRAB     PHEVILVIDGTIGQQAYNQALAFKEATPIGSIIVTKLDSSAKGGGALSAVAATGAPIKFIGTGEKIDDLE
SRP54_METM5     PNEIILVIDGTLGQQAKNQAKAFKESVSEIGSILTKLDGSAKGGGALSAVAEINAPIKFIGTGEGVDNLE
SRP54_MYCMY     PNEILLVVDGMSGQEIINVTNEFNDKLKLSGVVVTKLDGDARGGATLSISYLTKLPIKFIGEGEGYNALA
SRP54_METBU     PDYKLLVLDGAIGQQASEQARAFNDSVGISGVVISKLDGTAKGGGALSAVSETNSAIAFIGVGETPDDLE
SRP54_SULIY     PDDVILVIDASIGQKAYDLASRFHQASPIGSIIITKMDGTAKGGGALSAVAATGATIKFIGTGEKIDELE
SRP54_SULIL     PDDVILVIDASIGQKAYDLASRFHQASPIGSIIITKMDGTAKGGGALSAVAATGATIKFIGTGEKIDELE
SRP54_METM6     PNEIILVIDGTLGQQAKNQAKAFKDSVSEIGSILTKLDGSAKGGGALSAVAEINAPIKFIGTGEGVDNLE
SRP54_SULIM     PDDVILVIDASIGQKAYDLASRFHQASPIGSIIITKMDGTAKGGGALSAVAATGATIKFIGTGEKIDELE
SRP54_SULIK     PDDVILVIDASIGQKAYDLASRFHQASPIGSIIITKMDGTAKGGGALSAVAATGATIKFIGTGEKIDELE
SRP54_SULIA     PDDVILVIDASIGQKAYDLASRFHQASPIGSIIITKMDGTAKGGGALSAVAATGATIKFIGTGEKIDELE
SRP54_STAMF     PDEVVLVIDAAIGQQAHDLAKKFHEATPIGSIIVTKLDGTAKGGGALSAVAVTGATIKFIGTGEKIDELE
SRP54_SULAC     PDEVILVIDASIGQKAYDLASRFHQASPIGSLIVSKMDGTAKGGGALSAVIATGAQIKFIGTGEKLDELE
SRP54_HYPBU     PDEVVLVIDAAMGQKSYDLAKRFHEATPVGSIIVTKMDGTAKGGGALSAVAATGARIKFIGTGEDIDEIE
SRP54_METTH     PHEAILVIDGTIGQQAREQALAFRKATDIGSIIVTKLDGSAKGGGALSAVAEIGAPIKFIGTGERIDDLE
SRP54_PYRHO     PHEVILVIDGTIGQQAYNQALAFKEATPIGSIIVTKLDSSAKGGGALSAVAATGAPIKFIGVGEKIDDLE
SRP54_THEVO     PDQVLMVIDATMGQQAGPESKAINDAVGVTGIIITKMDGTAKGGGALSAVAKMRVPIYFIGTGEHMDDME
SRP54_METJA     PDEIILVIDGTIGQQAGIQAKAFKEAVGEIGIIVTKLDGSAKGGGALSAVAETKAPIKFIGIGEGIDDLE
SRP54_SULTO     PDEVILVIDASIGQKAYDLASRFHQASPIGSIIVTKMDGTAKXXXXXXXXXXXXXXIKFIGTGEKLDELE
SRP54_HALMA     PDRDLLVLDAAMGQSAKSQAADFEAAIGIDGVVITKLDGTAKGGGALAAVNETDSTIAFLGSGETVKDIE
SRP54_ARCFU     PDYKLLVLDAAIGQLASKQAQAFHEAIGINGIIITKFDGTAKGGGALSAARQIGIPIAFIGTGEKVEDFE
SRP54_UNCMA     FDHKLLVLDAAIGQQASEQARAFNDAIGITGVVITKLDGTAKGGGALSAVSDTNTSIAFIGVGETPDDME
SRP54_THEAC     PDEVLMIIDATMGQQAGPEAKAFNDAIGVTGIIITKMDGTAKGGGALSAVAEIHVPIYFIGTGEHMDDLE
SRP54_MYCPN     PDEILMVVDGLSGQEIINVAKEFHNRLKLTGFIITKLDSDARAGAALSLTSLLEVPIKLMGTSEKLTGLE
SRP54_PYRAE     PDEVVLVIDATVGKMAAAQAEAFMKYLPIHSVIITKMDSTARGGGALAAVAKTGAKVKFIGVGEDVDEFE
SRP54_METLZ     PDHRWLVIDAALGQAARDQAKRFHEAIGIDGVIVTKMDGTAKGGGAMSAVAETQSGIVFIGNGETIDDLE
SRP54_HALLT     PDRSLLVLDAAIGQGAKEQARQFEKSIGIEGVMITKLDGTAKGGGALTAVNETDSSIAFLGTGETVQDIE
SRP54_HALWD     PDRSLLVLDAAIGQGAKQQAREFNNAIGIDGVVVTKLDGTAKGGGALTAVNETDSSIAFLGTGETVQDVE
SRP54_HALSA     PDRSLLVLDAAIGQGAKQQARQFDASIGIDGVAITKLDGTAKGGGSLTAVNETDSTIAFLGSGETVQDIE
SRP54_HALS3     PDRSLLVLDAAIGQGAKQQARQFDASIGIDGVAITKLDGTAKGGGSLTAVNETDSTIAFLGSGETVQDIE
SRP54_THENV     PDEVVLVIDATVGKLAAAQAEAFMRYLPIHSVIITKMDSTARGGGALAAVAKTGAKVKFIGVGEDVDELE
SRP54_METKA     PHEVLLVLDATVGQKAGDHAEAFHEAVQLTGVVITKLDTAAKGGGALSAVARTGAPIKFVGTGERVDDLE
SRP54_HALVO     PDLNLLVLDAAIGQGAKEQAQQFDESIGIGGVVITKLDGTAKGGGALTAVNETDSSIAFLGMGETVQDIE
SRP54_SULSO     PDDVILVIDASIGQKAYDLASRFHQASPIGSVIITKMDGTAKGGGALSAVVATGATIKFIGTGEKIDELE
SRP54_METS5     PNEVILVIDASLGQKAYDLAKRFHEASNVGSIIITKMDGTAKGGGALSAVAATGAPIKFIGVGEKIDELE
SRP54_ENTHI     PDSIIFVMDGAIGQAAFGQAKAFKDAVEVGSVIITKLDGHSNGGGALSAVAATKSPIIFIGTGEKVNEIE
SRP54_AERPE     PDEVALVIDASIGQKAMGLAERFHKSTPIGSIIVTKMDXXXXXXXXXXXXXXXXXRIKFIGTGETLGELE
SRP54_META3     XXXIILVIDGTLGQQAKNQAKAFKDAVNIGSILITKMDGSAKGGGALSAVAEIGAPIKFIGTGEKVDDLE
SRP54_MOUSE     PDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFE
SRP54_PONAB     PDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFE
SRP54_MACFA     PDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFE
SRP54_HUMAN     PDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFE
SRP54_CANFA     PDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFE
SRP54_BOVIN     PDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFE
SRP54_RAT       PDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFE
SRP54_MYCGE     PDEIIMVVDGLSGQEIINVAQTFHKRLKLTGFIISKXXXXXXXXXXXXXXXXXQVPIKLIGVSEKLDGLE
SRP54_PYRCJ     PDEVFLVIDATVGKLAAAQAEAFMKYLPIHSVIITKMDSTARGGGALAAVAKTGARVKFIGVGEDVDEFE
SRP54_ACIAM     PDEVTLVIDASIGQKAYDLASKFNQASKIGTIIITKMDGTAKGGGALSAVAATGATIKFIGTGEKIDELE
SRP54_NATPD     PDRNLLVLDAAIGQGAKDQAERFHDAVGIDGVAITKLDGTAKGGGALAAVDQTDSSIAFLGTGEEVKDIE
SR542_ARATH     PDLVIFVMDSSIGQTAFEQARAFKQTVAVGAVIITKMDGHAKGGGTLSAVAATKSPVIFIGTGEHMDEFE
SRP54_GEOCY     PDNIIFVMDGTIGQACESQARAFKEKVDVASVIVTKLDGHAKGGGALSAVAATRSPIIFIGTGEHIDEME
SRP54_YEAST     PNQTIMVLDASIGQAAEQQSKAFKESSDFGAIILTKMDGHARGGGAISAVAATNTPIIFIGTGEHIHDLE
SRP54_YARLI     PDSTIMVLDASIGQAAEPQSRAFKDASDFGSIILTKMDGHAKGGGAISAVAATNTPIIFIGTGEHIHDLE
SR543_ARATH     PDLVIFVMDSSIGXXXXXXXXXXXXSVAVGAVIITKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFE
SRP54_SCHPO     PDQTIMILDASIGQAAESQSKAFKETADFGAVIITKLDGHAKGGGALSAVAATKTPIVFIGTGEHINDLE
SR542_SOLLC     PDLVIFVMDSSIGXXXXXXXXXXXXSVAVGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFE
SR541_SOLLC     PDLVIFVMDSSIGXXXXXXXXXXXXSVAVGAVIVTKMDGHAKGGGALSRVAATKSPVIFIGTGEHMDEFE
SR543_HORVU     PDLVIFVMDGSIGXXXXXXXXXXXXXXXVGAVIVTKLDGHAKGGGALSAVAATKSPVIFIGTGEHIDDFD
SRP54_CANAL     PTQTIMVMDGSIGQAAESQARAFKESSNFGSIILTKMDGHAKGGGAISAVAATKTPIVFIGTGEHVGDLE
SRP54_DICDI     PDNCIFVMDSSIGQAAYEQATAFRSSVKVGSIIITKMDGNSMGGGAISAVAATNTPIIFIGTGEHLTDLE
SR541_ARATH     PDLVIFVMDSSIGXXXXXXXXXXKETVSVGAVIITKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFE
SRP54_ASPNG     PDQTILVLDSTIGQAAEAQSSAFKATADFGAIIITKTDXXXXXXXXXXXXXXTHTPIIYLGTGEHLMDLE
FTSY_ECOLI      PHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLR
SR542_HORVU     PDLVIFVMDGSIGXXXXXXXXXXXXXXXVGAVIITKLDGHAKGGGALSAVAATKSPVIFIGTGEHIDEFE
SR541_HORVU     PDLVIFVMDGSIGXXXXXXXXXXXXXXXVGAVIITKLDGHAKGGGALSAVAATKSPVIFIGTGEHIDEFE
DOCK_SULAC      PDFRILILDSLAGSDALEQARHFENNVGYDAVILTKVDADAKGGIALSLAYELKKPVVYMGVGQNYDDLI
FTSY_THEAQ      PKEVWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDLQ
FTSY_NEIMC      PHEIIVVLDANIGQNAVNQVKAFDDALGLTGLIVTKLDGTAKGGAALASDRPV--PVRYIGVGEGIDDLR
FTSY_NEIMB      PHEIIVVLDANIGQNAVNQVKAFDDALGLTGLIVTKLDGTAKGGAALASDRPV--PVRYIGVGEGIDDLR
FTSY_NEIMA      PHEIIVVLDANIGQNAVNQVKAFDDALGLTGLIVTKLDGTAKGGAALASDRPV--PVRYIGVGEGIDDLR
FTSY_SYNY3      TVESLLVLDATLGQNGLRQAEVFAEAAKLSGVVLTKLDGSAKGGVALAVAQQLNLPIRFIGAGEGIEDLR
FTSY_NEIGO      PHEIIVVLDANIGQNAVNQVKAFDDALGLTGLIVTKLDGTAKGGAALASDRPV--PVRYIGVGEGIDDLR
Y291_METJA      PDLVIFVGDALTGNDAVYQAEEFNRAVNIDGIILTKVDADAKGGAALSIGYAIGKPILYLGVGQRYQDLI
FTSY_HAEIN      PHEIMLTLDAGTGQNAISQAKLFNEAVGLTGISLTKLDGTAKGGVIFAIADQFKLPIRYIGVGEKIEDLR
FTSY_AQUAE      PSETLLVIDATTGQNAIQQAKVFKEAVDITGIVVTKLDGSAKGGAVVAICRELKIPIKLVGVGEGIDDLQ
FTSY_BACSU      PHEVLLALDATTGQNAMAQAKEFSKATNVTGIALTKLDGTAKGGIVLAIRNELHIPVKLVGLGEKVDDLQ
FTSY_MYCHO      PHESLLVLDATTGQNGVIQARVFKESTPLTGIILTKMDGTSKGGIVLTIKDEIGLFVKYIGLGEKVDDLA
FTSY_RICCN      PTHSVLVIDAITGQNTYNQVEHFNDATNLTGLIVTKLDGSAKAGVIVGVVQKFNLPLYFIGIGEKIEDLK
FTSY_BUCAP      PHEIMLIIDACNGQNTIKQTEMFHKAINLTGLVITKLDGTAKGGVIFSLANQFLIPIRYIGIGEKTTDLV
FTSY_RICFE      PTHSVLVIDAITGQNTYNQVEHFNDATNLTGLIVTKLDGSAKAGVLVGVVQKFNLPVYFIGIGEKIEDLK
FTSY_RICTY      PTHSILIIDAVTGQNTYNQIEYFNDVTNLTGLIITKLDGSAKAGVLVGAVQKFNLPIYFIGIGEQIEDLK
FTSY_RICBR      PTHSVLVIDAITGQNTYNQVEHFNDATNLTGLIVTKLDGSAKAGVIVGVVQRFNLPIYFIGIGEQIEDLK
FTSY_HELPY      PFYKFLILDGTQGSSGLTQAKIFHETLALDGVIMTKLDGTSKGGAILSVLYELKLPILYLGMGEKEDDLI
FTSY_HELPJ      PFYKFLILDGTQGSSGLTQAKIFHETLALDGVIMTKLDGTSKGGAILSVLYELKLPILYLGMGEKEDDLI
FTSY_MYCGE      PSETLLVLDGTVGQTGLSQAKVFNEFSKLTGIVLTKMDGSAKGGIILAIKDMFNLPVKLIGFGEKTSDLA
FTSY_RICPR      PTHSILIIDAITGQNTYNQIEYFNDVTNLTGLIVTKLDGSAKAGVLVGAVQKFNLPVYFIGIGEKIEDLK
FTSY_MYCPN      PQETLLVLDGTTGQSGLAQAKVFNEFTELTGIILTKMDSSSKGGIILAIKDLFNLPVKLIGFGETTADLA
FTSY_MYCLE      RDEVLLVLDATIGQNGLTQVRVFAEVVDITGAVLTKLDGTAKGGIVFRIQRELGVPVKLVGLGEGPDDLA
FTSY_BUCBP      KQETMLVLDACIGQNSIKQVKIFHESLNVTGLVITKLDSTAKGGVIFSIAQEFLIPVRYISFGEDFEDIQ
FTSY_BUCAI      PHEKLLIIDSCNGQNTIQQTEIFHKALNLTGIIITKLDGTAKGGVVFSLADQFQIPIRYIGIGEKMQDLG
FTSY_MYCTU      RDEVLLVLDATIGQNGLAQARVFAEVVDISGAVLTKLDGTAKGGIVFRVQQELGVPVKLVGLGEGPDDLA
FTSY_MYCBO      RDEVLLVLDATIGQNGLAQARVFAEVVDISGAVLTKLDGTAKGGIVFRVQQELGVPVKLVGLGEGPDDLA
SRPR_BOVIN      PDLVLFVGEALVGNEAVDQLVKFNRALAIDGIVLTKFDTDDKVGAAISMTYITSKPIVFVGTGQ------
SRPR_MOUSE      PDLVLFVGEALVGNEAVDQLVKFNRALAIDGIVLTKFDTDDKVGAAISMTYITSKPIVFVGTGQ------
SRPR_HUMAN      PDLVLFVGEALVGNEAVDQLVKFNRALAIDGIVLTKFDTDDKVGAAISMTYITSKPIVFVGTGQ------
SRPR_DICDI      VDLVLFVGEALVGNDGVDQLTKFDKSLSIDGIILTKFDTDDKVGAAISMVYSTGHPILFLGTGQ------
SRPR_DROME      PDLVLFVGEALVGNEAVDQLVKFNQSLAIDGIVLTKFDTDDKVGAAISMTYITGQPIVFVGTGQ------
SRPR_CANFA      PDLVLFVGEALVGNEAVDQLVKFNRALAIDGIVLTKFDTDDKVGAAISMTYITSKPIVFVGTGQ------
SRPR_YEAST      PDKIIMVGEALVGTDSVQQAKNFNDAFGLDFFIISKCDGEML-GTMVNMVYATGIPILFVGVGQ------
FLHF_PSEPU      AAKNYLVLATTSQKQVLTAAYHSYKRCGLAGCILTKLDETASLGDVLS----------------------
SRPR_SCHPO      LDKIFQVAEALVGTDSLAQAKHFQASLPLDGFIISKVD--------------------------------
FLHF_PSEAE      NVKNYLVMATTSQSQVLKSAYQTYRHCGLAGCILTKLDEAGSLGESMALAIAQRLPVYLADGPRIPDDLQ
FLHF_HELPJ      NIDVSLVLSVTTKYEDMKDIYDSFGVLGIDTLIFTKLDESRGLGNLFSLVHESQKPISYLSVGQ------
FLHF_CAMJE      --DVNLVVSANTKHEDLMEIYKNFSFLNIDTLIITKFDETKVFGNIFSLVYETNIPLSFFSIQEVPDDLE
FLHF_HELPY      NIDVSLVLSVTTKYEDMKDIYDSFGVLGIDTLIFTKLDESRGLGNLFSLVHESQKPISYLSVGQ------
FLHF_TREPA      NFELEVYLTIDAGSKANDLREVFKQYAEYRALIVTKLDETTSIGNLISALSEARTPITYITTGQTPSNLE
FLHF_BORBU      ----------------------------------------------------------------------
YWQD_BACSU      ----------------------------------------------------------------------
KTHY_DINSH      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           PFYPDRLAGRILGMGDVATLAEKVRQAGLEAEAPKSAKELTLEDFLKQMQNLKRLGSFSELLKLLPGVGR
SRP54_THEAQ     PFYPERLAGRILGMGDVASLAEKVRAAGLEAEAPKSAKELSLEDFLKQMQNLKRLGPFSEILGLLPGV--
SRP54_BACSU     PFHPERMASRILGMGDVLTLIEKA-QASVDEDKAKELEQFTLDDFLEQLGQVRNMGPLDELLQMMPGAGK
SRP54_MYCTU     VFHPDRMASRILGMGDVLSLIXXXXXXXXXXXXXXGAGELTLEDFLEQMLAVRKMGPIGNLLGMLPGAAQ
SRP54_MYCBO     VFHPDRMASRILGMGDVLSLIXXXXXXXXXXXXXXGAGELTLEDFLEQMLAVRKMGPIGNLLGMLPGAAQ
SRP54_ECOLI     PFHPDRIASRILGMGDVLSLIEDIESKVDRAQAEKLASKLDLNDFLEQLRQMKNMGGMASLMGKLPGMGQ
SRP54_ECOL6     PFHPDRIASRILGMGDVLSLIEDIESKVDRAQAEKLASKLDLNDFLEQLRQMKNMGGMASLMGKLPGMGQ
SRP54_ECO57     PFHPDRIASRILGMGDVLSLIEDIESKVDRAQAEKLASKLDLNDFLEQLRQMKNMGGMASLMGKLPGMGQ
SRP54_STRMU     TFHPDRMSSRILGMGDLLTLIEKASQDYDEQKSAELAEKMDFNDFIEQLDQVQNMGSMEDILKMIPGMNN
SRP54_HAEIN     PFHPDRVASRILGMGDVLSLIEDLERSVDREKAEKMAQDFTLDDFREQLIEMKKMGGMMSMLEKLPGAKN
SRP54_MYCLE     VFHPDRMASRILGMGDVLSLIXXXXXXXXXXXXXXXAGELTLEDFLEQMLAVRKMGLIGNLLGMLPGAGQ
SRP54_AQUAE     PFYPDRIAQRILGLGDIQSLVEKAQEVITEDKAQVMATEFDLEDLREMLRMIQQMGPLDKLLSMIPGVAP
SRP54_RICCN     EFDAERLASRILDMGDIISFVEKARXXXXXXXXXXXXXXFDLNDYLQQMRSIKKMGGFGSILSMLPGSGK
SRP54_SYNE7     PFHPERMASRILGMGDVLTLVEKAQEEIDLADVEKMAAKFDFTDFLKQMRLLKNMGSLAGFIKLIPGLGG
SRP54_RICFE     EFDAERLASRILDMGDIISFVEKARXXXXXXXXXXXXXXFDLNDYLQQMRSIKKMGGFGSILSMLPGSGK
SRP54_RICBR     EFDAKRIASRILDMGDIISFVEKAASIVDREQAEKTAAKLDLNDYLQQMKSIKKIGGFGSILSMLPGSGK
SRP54_RICPR     EFNAERLASRILDMGDIISFVKKAASIVDREEAEKTAIKLDLNDYLQQMRSIKKMGGFGSILSMLPGSGK
SRP54_SYNY3     PFYPDRLASRILNMGDVLTLVEKAQEAIDVGDVEKLQNKIDFDDFIKQMRFMKNMGSLGGLLKMIPGMNK
SR54C_ARATH     PFYPDRMAGRILGMGDVLSFVEKATEVMRQEDAEDLQKKIDFNDFLKQTRAVAKMGSMTRVLGMIPGMGK
SRP54_RICTY     EFDAERLASRILDMGDIISFVKKAASIVDREEAERTAIKLDLNDYLKHMRSIKKMGGFGSILSMLPGSGK
SRP54_BUCAI     PFHPERIADRILGMNDIMSLIEDIEEKVDQSQIQKLTKKLNLNDFLTQIKQMKKIGGLNYFANKF-SINH
SRP54_METAC     KFEADRFISRLLGMGDLKSLMEKAEESLSEEDVNVEAGRFTLKDMYKQLEAMNKMGPLKQIMSMLPGMGK
SRP54_HELPJ     VFMPERIVGRLMGAGDIISLAEKTASVLNPNEAKDLSKKLTFNDFLNQIEKVKKLGSMSSLISMIPGLGN
SRP54_THEON     PFDPKRFVSRLLGLGDIXXXXXXXXXXXXXXDLEKFLKKFNLKDMYAQLEAMQKMGPLKQILQMIPGMGY
SRP54_HELPY     VFVPERIVGRLMGAGDIVSLAEKTASVLNPNEAKDLSKKLTFNDFLNQIEKVKKLGSMSSLISMIPGLGN
SRP54_METBF     KFEADRFISRLLGMGDLKSLMEKAEETLSEEDVNVEAGRFTLKDMYKQLEAMNKMGPLKQIMSMLPXXVK
SRP54_METST     AFDPERFISRLLGMGDLDTLIEK----AAEVTSEKSDKEMTLKDMENQLEMMNKMGPIQQIMKLIPGLGN
SRP54_BUCAP     PFHPERIADRILGMNQVISLEEKVNQSQVKNLTKKFRKDFNLNDFLIQLKEMKNMGNLNYFIEKF-SKNK
SRP54_PYRKO     PFDPKRFVSRLLGLGDXXXXXXXXXXXXXXXXXXXXDMEFNLKDMYAQLEAMQKMGPLKQILQMIPGLGY
SRP54_METMA     KFEADRFISRLLGMGDLKSLMEKAEESLSEEDVNVEAGRFTLKDMYKQLEAMNKMGPLKQIXXXXXXXXK
SRP54_PYRFU     PFDPPRFVSRLLGLGDIQGXXXXXXXXXXXXXXXXXXXKFTLKDMYAQLEAMRKMGPLKQILRMIPGLGY
SRP54_THEGJ     PFDPKRFVSRLLGLGDIXXXXXXXXXXXXXXXXXXXDVEFNLKDMYAQLEAMQKMGPLKQILQMIPGLGY
SRP54_METTP     KFEADRFISRLLGMGDIKGLIEKAQEVQIESDVDVDAMKFTLKDMYKQLEAMNKMGPLKQIMQMLPGIGI
SRP54_METS3     LFDPARFISRLLGMGDIQTLIEKAEDSIDEDMAEKTMKNMTLVDMKNQFEMMNSMGPMQQVLSMIPGLGK
SRP54_PYRAR     PFNPRKFVARLLGMGDLDALLEKIKAVXXXXXXXXXSGRLDLLTFKKQIDSLMKLGPLSKVFQLLPGAAK
SRP54_METM7     QFDPKKFISRILGMGDLDSLLEKIMDESTEESIDSILKKFTLIELYAQLETISKMGPMKQILSMIPGMGG
SRP54_BUCBP     LFYPDRIASRILGMGDMLSLIENIKHIKKFSNTIKKYNTFNFNDMLLHINQIKKIGGVNSILGKLPKT-Q
SRP54_METVS     TFDPKKFISRLLGMGDLDSLLEKVMDESTEESIDSILKKFTLVELYAQLETISKMGPMKQIMGMIPGFGG
SRP54_PYRIL     LFNPRKFVARVLGMGDLDALVEKIKAVFEEEKVLQEIERLDLLTFKKQIEGLLKLGPLSKVLQLLPGAAK
SRP54_METMP     QFDPKKFISRILGLGDLDSLLEKIMDESTEESIDSILKKFTLIELYAQLETISKMGPMKQILSMIPGMGG
SRP54_SULIN     IFNAKRYVSRILGMGDIESILEKVK--GLEEDVMEGKGKLTLRDVYAQIMALRKMGPLSKVLQHIPGLGV
SRP54_PYRAB     PFDPARFVSRLLGLGDIQGXXXXXXXXXXXXXXXXXXXKFTLKDMYAQLEAMRKMGPLKQILRMIPGLGY
SRP54_METM5     QFDPKKFISRILGLGDLDSLLEKIMDESTEESIDSILKKFTLIELYAQLETISKMGPMKQILSMIPGMGG
SRP54_MYCMY     AFYPKRMADRLMGMGDIETLFERAVENIDERSIQKTMNQFDLEDLRNQLAQIAKMGSLNKLMKMLP-INK
SRP54_METBU     KFEPDRFISRLLGMGDIKSLIEKAEETLSEEDIDMEAMRFTLKDMYSQLEAMNKMGPMKQIMQMLPGMGA
SRP54_SULIY     IFNAKRYVSRILGMGDIESILEKVK--GLEEDVMEGKGKLTLRDVYAQIMALRKMGPLSKVLQHIPGLGV
SRP54_SULIL     IFNAKRYVSRILGMGDIESILEKVK--GLEEDVMEGKGKLTLRDVYAQIMALRKMGPLSKVLQHIPGLGV
SRP54_METM6     QFDPKKFISRILGFGDLDSLLEKTEDI-MDESAEESIDSITLIELYAQLETISKMGPMKQILSMIPGMGG
SRP54_SULIM     IFNAKRYVSRILGMGDIESILEKVK--GLEEDVMEGKGKLTLRDVYAQIMALRKMGPLSKVLQHIPGLGV
SRP54_SULIK     IFNAKRYVSRILGMGDIESILEKVK--GLEEDVMEGKGKLTLRDVYAQIMALRKMGPLSKVLQHIPGLGV
SRP54_SULIA     IFNAKRYVSRILGMGDIESILEKVK--GLEEDVMEGKGKLTLRDVYAQIMALRKMGPLSKVLQHIPGLGV
SRP54_STAMF     VFRPPRFVARILGIGDLEGLIEKVRRIKVEF-TEKDVEELNMRLVYKQLVSLRKMGPLRKILQMIPGLSL
SRP54_SULAC     VFNPRRFVSRLLGLGDXXXXVEDYENLEKRMEDVISGKKLTLRDIYKQLIALRKMGPLGKIFQMLPGAGQ
SRP54_HYPBU     VFRPKRFVARLLGMGDLESLLEKIERLRGVEEFEKTVAEITFRTIYKQLQQVTKLGPFRKILQMIPGISE
SRP54_METTH     VFDPERFISRLLGMGDLRSXXXXXXXXXXXXXXXXXSGKFTLRDMRVQFEMMGKMGPLQQVMSMLPGAGK
SRP54_PYRHO     PFDPARFVSRLLGLGDIQGXXXXXXXXXXXXXXXXXRGKFTLKDMYAQLEAMRKMGPLKQILRMIPGLGY
SRP54_THEVO     IFDPKKFLSRLLGLGDLETLFETVKEANIEEEAQKSFEKLNLKDMYDVWEKFSRPGLMKKLLAKLPGSQK
SRP54_METJA     PFDPKKFISRLLGMGDLESLLEKVDEKTEESIDAIMRGKFTLNELMTQLEAIENMGSMKKILSMIPGFGG
SRP54_SULTO     VFNPRRFVSRILGMGDIESIIEKIKQIQKKMEEVMSGKKLTLRDIYKQLTALRKMGPLNKILQMLPGFGQ
SRP54_HALMA     RFEPSGFISRLLGMGDLKQLTERVERAMEETQEPEDMLEFTLKDMRKQMQTMNNMGPLDQVMDMIPGLGG
SRP54_ARCFU     RFDPAGFVSRLLGMGDIKALMEKIERIASEEELDPEAGTFTLKDIYKQIEAMNKMGPVRKIFEMLPGLGL
SRP54_UNCMA     RFDPDGFISRLLGMGDLRALVERANEV-LQKDDVNVEKKFTLNDMYDQLEAINKMGPLKQIMSMLPGLGG
SRP54_THEAC     VFDPKKFLSRLLGLGDLESLFETVQEADIEEEAQESFEKLNLKDMYDVWEKFSKPGLMKKLLARIPGSQK
SRP54_MYCPN     QFHPERIASRILGLGDVMTLVEKAEEVFDKQSLTKTVSKMDLEDLLLYMEQMNQMGSVSSIVKMLPGNLT
SRP54_PYRAE     QFSPRKFVARVLGMGDLDTLLEKIKAVXXXXXXXXXSGRLDLLTFKKQIDSLLKLGPLSKVFQLLPGAAK
SRP54_METLZ     RFDPNGFISRLLGMGDLKALVEKAEESMNAEDVDVNAMKFTLNDMYKQLEAVQKMGPLKQVLSMLPMGNM
SRP54_HALLT     RFEPSGFISRLLGMGDLKQLSERVERAMAEAQEEDEQGEFTLKDMKRQMDAMNRMGPLDQVMDMIPXXXX
SRP54_HALWD     RFEPNGFISRLLGMGDLKQLSERVERAMAETQEPEDIMEFTLKDMRKQMEAMDRMGPLDQVMDMIPGLGG
SRP54_HALSA     RFEPDSFISRLLGMGDLKQLTERVERAXXXXXXXLMKGEFTLHDMRKQMQAMDNMGPLDQVMDMIPGMGG
SRP54_HALS3     RFEPDSFISRLLGMGDLKQLTERVERAXXXXXXXLMKGEFTLHDMRKQMQAMDNMGPLDQVMDMIPGMGG
SRP54_THENV     MFIPRKFVARVLGMGDLDALVERIKXXXXXXXXXXXSGKLDLLTFKKQIDGLLKLGPLSKVFQMLPGAAK
SRP54_METKA     EFNPRSFVARLLGIGDIXXXXXXXXXXXXXXXXXXXXXXFTLKDLYEQLEALSKMGPVDKLLQYVPGMGR
SRP54_HALVO     RFEPNGFISRLLGMGDLKQLSERVERAMSETQAPEEMMKFTLKDMQKQMEAMDKMGPLDQVLDMIPGFGG
SRP54_SULSO     TFNAKRFVSRILGMGDIESILEKVK--GLEEDVMEGKGKLTLRDVYAQIIALRKMGPLSKVLQHIPGLGI
SRP54_METS5     VFNPRRFVARILGMGDLEAIIEKMKYEGIQGEVMTGKSKLTLRDMYKQIVAVRKMGPLSKILQLIPGMGD
SRP54_ENTHI     EFDAESFVRQLLGMGDLKGIAKLAKDFAENAEYKTMVKHLTVRDWKEQLSNLQKMGQLGNIMQMI-GLNH
SRP54_AERPE     PFAPRRFVARILGMGDLESLLERIKSLEEAGELDRAAEDITMRTIYRQLRAMRKLGPLGKVLQMLPGASA
SRP54_META3     PFDPKKFISRLLGMGDLDSLXXXXXXXXXSLDAMMRGK-FTLNELYSQLEAISKMGSMKQLMAMIPGMGT
SRP54_MOUSE     PFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEALIEKQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGT
SRP54_PONAB     PFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEALIEKQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGT
SRP54_MACFA     PFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEALIEKQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGT
SRP54_HUMAN     PFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEALIEKQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGT
SRP54_CANFA     PFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEALIEKQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGT
SRP54_BOVIN     PFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEALIEKQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGT
SRP54_RAT       PFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEALIEKQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGT
SRP54_MYCGE     QFHPERIANRILGLGDVMSLVEKAEQVFDKKDLTKTISKMDLEDLLIYMQQMHKMGSVSSLIKMLPANFS
SRP54_PYRCJ     LFNPRKFVARVLGMGDLDALVEKIKAVFEEDKVLEELERLDLLTFKKQIDSLLKLGPLSKVFQLLPSAIK
SRP54_ACIAM     VFNPRRFVARILGMGDIETILEKIKEVENYDKMQKKMEELTLRDVYNQLIALRKMGPLSKLFQLLPGIGM
SRP54_NATPD     RFEPSGFISRLLGMGDLKQLSERVERAMEETQAEEDKGEFTLKDMRNQMNAMNKMGPLDQVMDMIPGLGG
SR542_ARATH     VFDAKPFVSRLLGNGDMSGFVNKLQEVVPKDQQPESHGKFTLRIMYDQFQNMLNMGPLKEVFSMLPGMAE
SRP54_GEOCY     PFKTKPFVSKXXXXXXXXXXXXKVSDLKLDENEELMDKQFTLRDMYEQFQNIMKMGPFNQIIGMIPGFSD
SRP54_YEAST     KFSPKSFISKLLGIGDIESLFEQLQTVSNKEDAKATMENITLLDFKKQMQTIMKMGPLSNIAQMIPGMSN
SRP54_YARLI     AFSPKQFISKLLGIGDLQGLMETMQSLNLDQKKTMEHIQFTLADLRDQMGNMLKMGSLSSIAGMIPGLGM
SR543_ARATH     VFDVKPFVSRLLGMGDWSGFVDKLQEVVPKDQQPELLEKLTLRIMYDQFQNILNMGPLKEVFSMLPGIAE
SRP54_SCHPO     RFSPRSFISKXXXXXXXXXXMEHVQ--SLDFDKKNMVKNLTVRDFRDQLGNIMKLGPLSKMASMIPGMSN
SR542_SOLLC     VFDVKPFVSRLLGMGDWSGFMDKIHEVVPMDQQPELLQKLTLRIMYEQFQNILKMGPIGQVFSMLPGFSA
SR541_SOLLC     VFDVKPFVSRLLGMGDLSGLVNKIQDVVPMDQQPELLQKLTLRIMYEQFQSMLKMGPLG-VFSMLPGFAE
SR543_HORVU     VFNVEPFVARLLGRGDLPGLIDKMQQSELVAKLSEGA--FTLRLLYEQFQNLLKMGPMSQIFSMLPGFSS
SRP54_CANAL     IFKPTTFISKLLGIGDIQGLIEHVQSLNLQDEGHKQTIEFTLRDFQNQMNNFLKMGPLTNIASMIPGLSN
SRP54_DICDI     LFDPSTFVSKLLGYGDMKGMLEKIKE--VIPEDSTSLKEITLRSXXXXXXXXXXLGPIDKLVQMIPGMNQ
SR541_ARATH     VFDVKPFVSRLLGKGDWSGLVDKLQEVDLQNELVENLSQFTLRSMYDQFQCSLRI-PLNQLFSMLPGIAE
SRP54_ASPNG     RFEPKAFIQKLLGMGDMAGLVEHVQAVTKDSASAKETYKYTLRDFRENITSIMKMGPLSKLSGMIPGLSN
FTSY_ECOLI      PFKAD-----------------------------------------------------------------
SR542_HORVU     IFDVKPFVSRXXXXXXXXXXXXKIQDVMPADQQPELLAKLTLRLLYEQFQNLLKMGPIGQVFSMLPGFSS
SR541_HORVU     IFDVKPFVSRXXXXXXXXXXXXKIQDVMPADQQPELLAKLTLRLLYEQFQNLLKMGPIGQVFSMLPGFSS
DOCK_SULAC      PFSPDWFVERI-----------------------------------------------------------
FTSY_THEAQ      PFDPEAFVEALL----------------------------------------------------------
FTSY_NEIMC      PF--------------------------------------------------------------------
FTSY_NEIMB      PF--------------------------------------------------------------------
FTSY_NEIMA      PF--------------------------------------------------------------------
FTSY_SYNY3      PF--------------------------------------------------------------------
FTSY_NEIGO      PFDARAFVDRLL----------------------------------------------------------
Y291_METJA      EFDADWMVRKL-----------------------------------------------------------
FTSY_HAEIN      EF--------------------------------------------------------------------
FTSY_AQUAE      PFDADAYVEALL----------------------------------------------------------
FTSY_BACSU      EFDPE-----------------------------------------------------------------
FTSY_MYCHO      EF--------------------------------------------------------------------
FTSY_RICCN      IFNQHDFARNLVGL--------------------------------------------------------
FTSY_BUCAP      VF--------------------------------------------------------------------
FTSY_RICFE      IFNRHDFAKSLVGL--------------------------------------------------------
FTSY_RICTY      IFNRHDFSRSLVGL--------------------------------------------------------
FTSY_RICBR      IFNRHDFAKSLVGL--------------------------------------------------------
FTSY_HELPY      AFDEER----------------------------------------------------------------
FTSY_HELPJ      AFDEER----------------------------------------------------------------
FTSY_MYCGE      IF--------------------------------------------------------------------
FTSY_RICPR      IFNRHDFSRSLVGL--------------------------------------------------------
FTSY_MYCPN      AF--------------------------------------------------------------------
FTSY_MYCLE      PFEP------------------------------------------------------------------
FTSY_BUCBP      VFNSNIFVNAIL----------------------------------------------------------
FTSY_BUCAI      HF--------------------------------------------------------------------
FTSY_MYCTU      PFEPAAFVDALLG---------------------------------------------------------
FTSY_MYCBO      PFEPAAFVDALLG---------------------------------------------------------
SRPR_BOVIN      ----------------------------------------------------------------------
SRPR_MOUSE      ----------------------------------------------------------------------
SRPR_HUMAN      ----------------------------------------------------------------------
SRPR_DICDI      ----------------------------------------------------------------------
SRPR_DROME      ----------------------------------------------------------------------
SRPR_CANFA      ----------------------------------------------------------------------
SRPR_YEAST      ----------------------------------------------------------------------
FLHF_PSEPU      ----------------------------------------------------------------------
SRPR_SCHPO      ----------------------------------------------------------------------
FLHF_PSEAE      VARSHQLVSRAVSL--------------------------------------------------------
FLHF_HELPJ      ----------------------------------------------------------------------
FLHF_CAMJE      VANSDFLVHCIL----------------------------------------------------------
FLHF_HELPY      ----------------------------------------------------------------------
FLHF_TREPA      ----------------------------------------------------------------------
FLHF_BORBU      ----------------------------------------------------------------------
YWQD_BACSU      ----------------------------------------------------------------------
KTHY_DINSH      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           ALPQGFQVDERAFKRLEAIVLSMTPEERKDPRILNASRRRRIAKGSGTTVQEVNRLVKAFEETKALMKSL
SRP54_THEAQ     --PQGLKVDEKAIKRLEAIVLSMTPEERKDPRILNGSRRKRIAKGSGTSVQEVNRFIKAFEEMKALMKSL
SRP54_BACSU     MKGKNIQVDEKQLNHVEAIIKSMTVLEKEQPDIINASRRKRIAKGSGTSVQEVNRLLKQFDEMKKMMKQM
SRP54_MYCTU     MKDALAEVDDKQLDRVQAIIRGMTPQERADPKIINASRRLRIANGSGVTVSEVNQLVERFFEARKMMSSM
SRP54_MYCBO     MKDALAEVDDKQLDRVQAIIRGMTPQERADPKIINASRRLRIANGSGVTVSEVNQLVERFFEARKMMSSM
SRP54_ECOLI     -IPDNVQMDDKVLVRMEAIINSMTMKERAKPEIIKGSRKRRIAAGCGMQVQDVNRLLKQFDD--------
SRP54_ECOL6     -IPDNVQMDDKVLVRMEAIINSMTMKERAKPEIIKGSRKRRIAAGCGMQVQDVNRLLKQFDD--------
SRP54_ECO57     -IPDNVQMDDKVLVRMEAIINSMTMKERAKPEIIKGSRKRRIAAGCGMQVQDVNRLLKQFDD--------
SRP54_STRMU     PALANVKVDEGEIARKRAIVSSMTPEERENPDLLTPSRRRRIASGSGNTFVNVNKFIKDFNQAKKMMQGV
SRP54_HAEIN     LSEHKNQVDDKMFVKMEAIINSMTLKERANPDIIKGSRRRRIALGSGTQVQDVNKLLKQFDE--------
SRP54_MYCLE     VKEVLEQVDDKQLDRLQAIIRGMTPQERADPKIINASRRLRIANGSGVTVSEVNQLVDRFFEARKMMSSV
SRP54_AQUAE     QL-KHLKVDEKQFKKIEAIINSMTPEERRNPKIINMSRKKRIARGSGTTVSDVN----------------
SRP54_RICCN     IMDQIDQLNSKIIEHQEAIILSMTPKERKNPDIINASRRKRIAVGAGTTVQKVNILLKQYKQISEIMKKV
SRP54_SYNE7     KIDEQLRQGERQLKRVEAMINSMTPQERRDPDLLSPSRRHRIAKGCGQTEAE------------------
SRP54_RICFE     IMDQIDQLNSKIIEHQEAIILSMTLKERENPDIINASRRKRIAAGAGTTVQKVNILLKQYKQISEMMKKA
SRP54_RICBR     IMDQIDQLNSKIIEHQEAIILSMTPKERRNPDIINASRRKRIALGAGTTVQKVNILLKQFKQISDMMKKA
SRP54_RICPR     IFDQIDQLNSKIIEHQEAIILSMTLKERKNPDIINASRRKRIAAGAGMTVQKVNILLKQYKQISAVMKKT
SRP54_SYNY3     LSSGDIEKGEKELKRTEAMISSMTTEERKNPDLLSPSRRRRIAQGSGHSETDVSKLITNF----------
SR54C_ARATH     VSPAQIREAEKNLLVMEAMIEVMTXXXXXXXXXXXXXXXKRIAKDSGKTEQQVSALVAQIFQMRVKMKNL
SRP54_RICTY     IIDQIDQLDSRIIEHQEAIILSMTLKERKNPDIINASRRKRIAAGAGMTVQKVNILLKQYKQISAVMKKA
SRP54_BUCAI     QLSNNISLDKNTLKKIEAMICSMTPKERIKPIIIKGSRKRRIALGSGTQIQDVNKLLKNFDDIRRIMKKI
SRP54_METAC     FSDEMFQATSDKMKNYKVIMDSMTEEEMTDPRVIGGSRIKRISKGSGCSSEDVRELLKYHKTMQTALKGF
SRP54_HELPJ     ALKDTDLESSLEVKKIKAMVNSMTKKERENPEILNGSRRKRIALGSGLEVSEINRIIKRFDQASKMAKRL
SRP54_THEON     SLPDAVRVGEERLKKFKVIMDSMTEEELEHPEIINYSRIKRIARGSGTSIQEVRELLHQYNQMKKMFKSM
SRP54_HELPY     ALKDTDLESSLEVKKIKAMVNSMTKKEQENPEILNGSRRKRIALGSGLEVSEINRIIKRFDQASKMAKRL
SRP54_METBF     LSDEMFQATSDKMKNYKTIMDSMTEEEMTDPKLIGGSRIKRISRGSGCSPEEVRELLKYHKTMQTALKGF
SRP54_METST     QLPNASKVTEEKLGMYKILMNSMTTYELENPEVIKKSRINRISRGAGLTNDDVKDLLKYYNVTKKALKGM
SRP54_BUCAP     ILSNNPLLGENTLNRIEAIIYSMTHKERMHPIIIKGSRKRRIALGSGTKIQDVNKLLKNFD---------
SRP54_PYRKO     SLPEAVRVGEEKLKRYKVIMDSMTEEELENPEIINYSRIKRIARGSGATTAEVRELLNQYNQMKKMFKSL
SRP54_METMA     LSDEMFQATSDKMKNYKVIMDSMTEDEMADPKLIGGSRIKRISRGSGCSPEDVRELLKYHKTMQTALKGF
SRP54_PYRFU     SLPDDISIGEERLKKFKVIMDSMTEEELLNPEIINYSRIKRIARGSGTSTKDVKELLDQYRQMKKLFKSM
SRP54_THEGJ     SLPEAVRVGEEKLRRYRIIMDSMTEEELENPDIINYSRIKRIARGSGTSTREVRELLAQYNQMRKMFKNL
SRP54_METTP     ELDKEYQVTKERLEAYRFIMDSMTDEELEDPKIINASRIKRIARGSGTRPELVKELLKS-----------
SRP54_METS3     VSKEASKMTEDKIDGYKVIMSSMTKKEMENPKLIKQSRIRRIAMGAGVEESEVRDLLKYYNNTKKTMKGI
SRP54_PYRAR     ISEEQIELSQKNLKKWRAILSSMTMEELKNPDILNASRIRRIALGAGVTPKDVKEMLTVYENLKKMSKTL
SRP54_METM7     NLPEAAQLTEDKLKRYKIMMDSMTMEEKENPELIKASRLQRIAKGAGVKQEEIKDLLKYYSTTKNAFGNL
SRP54_BUCBP     TIFNSFQIDENILLKMKTIINSMTISERHQPELIKGSRKRRISLGSGIPIPEINQLLKQF----------
SRP54_METVS     NMPEAAQLTEQKLKRYKIMMDSMTMEEKENPELIKTSRLQRIAKGAGVKQDEIKDLLKYYATTK------
SRP54_PYRIL     ISEEQVELSQKNLKKWYAILSSMTIEELKNPDILNASRIRRIALGAGVTPKDVKEMLTVYENLKKMSKTL
SRP54_METMP     NMPEAAQLTEAKLKRYKIMMDSMTMEEKENPELIKTSRLQRIAKGAGVKQEEIKDLLKYYSTTKNAFGNL
SRP54_SULIN     MLPDQLKLGEEKIRRWLAALNSMTYKELENPSIIDKSRMRRIAEGSGLEVEDVRELLEWYNNMNKLLKMV
SRP54_PYRAB     SLPEVISVGEERLRKFKVIMDSMTEEELMNPDIINYSRIKRIARGSGTSVKDVKELLNQYNQMKKFFKSM
SRP54_METM5     NLPEAAQLTEDKLKRYKIMMDSMTLEEKENPELIKTSRLQRIAKGAGVKQDEIKDLLKYYSTTKNAFGNL
SRP54_MYCMY     VSESQIQEAQRKLAVFSILMDSMTLKERRDPRVLKASRKNRIIKGSGRSEKEFNELINSFEKGKKQVLEI
SRP54_METBU     KLDDAYKVTEDKMKGYRVLMDSMTEEELLNPRLLGSSRIKRISLGSGSSPDAVRELLKYYKMMQNAMKGL
SRP54_SULIY     MLPDQLKLGEEKIRRWLAALNSMTYKELENPSIIDKSRMRRIAEGSGLEVEDVRELLEWYNNMNKLLKMV
SRP54_SULIL     MLPDQLKLGEEKIRRWLAALNSMTYKELENPSIIDKSRMRRIAEGSGLEVEDVRELLEWYNNMNKLLKMV
SRP54_METM6     NMPEAAQLTEDKLKRYKIMMDSMTMEEKENPELIKTSRLQRIARGAGVKPEEIKDLLKYYSTTKNAFGNL
SRP54_SULIM     MLPDQLKLGEEKIRRWLAALNSMTYKELENPSIIDKSRMRRIAEGSGLEVEDVRELLEWYNNMNKLLKMV
SRP54_SULIK     MLPDQLKLGEEKIRRWLAALNSMTYKELENPSIIDKSRMRRIAEGSGLEVEDVRELLEWYNNMNKLLKMV
SRP54_SULIA     MLPDQLKLGEEKIRRWLAALNSMTYKELENPSIIDKSRMRRIAEGSGLEVEDVRELLEWYNNMNKLLKMV
SRP54_STAMF     KIPLXXXXXXXXXXXXXAIINSMTYEELDKPEXXXXXXXXXXAYGAGVKPEDVRELLKQYEMMKKLSKQL
SRP54_SULAC     VPEEQLKLGEEKIRTFMAIMNSMTYKELDNPSIIDKARMRRIAKGAGVTVEEVKELLKQYQMTNNLLKMV
SRP54_HYPBU     SLDEAARLSEEKVKKWLTIMNSMTYEELDNPNLLERSRVKRIAVGAGVEPSEVRELYNYYKSVKKMMRQL
SRP54_METTH     LPKDASRMTEETIRKYLIIMDSMTEEELEKPDIIKHSRIRRIARGSGTRNEDVKELLKYYRVTKKAMKGL
SRP54_PYRHO     SLPELISVGEERLRKFKVIMDSMTEEELMNPEIINYSRIKRIARGSGTSIKDVKELLTQYNQMKKFFKSM
SRP54_THEVO     INDDQILTAEQKLQRYRIIMDSMTFQELENPEIINAKRITRIARGAGVREEDVRMLLKEFKAMKNNMKLM
SRP54_METJA     AMPKELHLTEAKIKKYKVIISSMTKEERENPXXXXXXXXXXXXXXXXTTENDVREVLRYYETTKNAIDKL
SRP54_SULTO     IPEEQLKLGEEKIKKFLVIMNSMTYKELDNPSIIDKSRIRRIAKGSGTSPEEVKELLKQYQVTNNLLKMV
SRP54_HALMA     GLDDAMDVTQERMQDFDVIMDSMTEEELENPRVVGQSRTKRICRGSGKPEERVRELLQQHKQMEQMLKQF
SRP54_ARCFU     KVDNDMEMTQEKMKKFRVIMDSMTEEELLNPKXXXXXXXXXXXXXXGTSPQEVKELL-------------
SRP54_UNCMA     NITDDYKMTQDKLKGYKVIMDSMTAAERDDPKLIGSSRIARVAHGSGKSPEEVRELLK------------
SRP54_THEAC     IDDSKIQSAEDKLRMYRIIMDSMTFEELENPEIINAKRITRIARGAGVREEDVRMLLKEFK---------
SRP54_MYCPN     VSDDHVESIEAKVKLWKVLINSMTREERRHPKLINPSRKQRIIKGSGRKMDELNKLMK--EWSKLQTKTA
SRP54_PYRAE     ISEEQIELSQRNLKKWRAILSSMTLEELKNPEILNASRIRRIALGAGVAPKDVKEMLTVYENLRKMSKTL
SRP54_METLZ     NVPDALEGTADKMKKFRIIMDSMTPQELDEPALINTSRMIRVAKGSGSSVEEVRDLIKYY---KMMQKTL
SRP54_HALLT     QLPDAMDVTQDRMRRFERIMDSMTDEELEQPRVVGQSRTERIARGSGTDEETVRQLL---EQHSMMEQTI
SRP54_HALWD     GLDDAMDVTQNRMRDFDVIMDSMTEAELEDPRSVGASRVRRIARGSGTDEETVRELL---QQHKMMERTI
SRP54_HALSA     GLDDAMDVTQERMRGFEVIMDSMTEAEMADPRSVGASQIRRIARGSGQPEDRVRELL-------------
SRP54_HALS3     GLDDAMDVTQERMRGFEVIMDSMTEAEMADPRSVGASQIRRIARGSGQPEDRVRELL-------------
SRP54_THENV     ISEEQIELSQKNLKKWRAILSSMTVEELKNPELLNASRIRRIALGAGVTPRDVKEMLTVYENLKRMSKTL
SRP54_METKA     NVRKISQITEERLKKYKVIMDSMTEKELENPEILNKSRIRRIAIGSGTSERDVIELLNHYRMMKDVIEDI
SRP54_HALVO     GIDDAMDVTKDRMRSFEVIMDSMTEEELENPRKVGASRVRRIAQGSGQDEETIQELLEQHRMMEQTIKQF
SRP54_SULSO     MLPDQLKIGEEKIRRWLAALNSMTYKELENPNIIDKSRMRRIAEGSGXXXXXXXXXXXWYNNMNRLLKMV
SRP54_METS5     IPEDQVKVGEQKMQRWLSIMNSMTYQELDNPSIIDKQRMRRIAMGSGTEVEEVRELIEHFNTVQRTLKML
SRP54_ENTHI     PMFQGGNI-EKKFKVFMVILDSMTDRESAKTMLNDESRIRRLARGSGRDIREVNEL---FEQIKLFQQCI
SRP54_AERPE     SIDEGLKLGEEKMKRWMAIIESMTYEELDRPEIIDKRRMRRIAIGSGTSVDDVRELLVYYKNLKTMM---
SRP54_META3     NLPKGADITEHKLKKYKIIMDSMTSTEKENPDIIKTSRMKRIAKGAGVKQEEIKELLKYYSTTK------
SRP54_MOUSE     FMSKGNEQESMALKKLMTIMDSMNDQETDGAKVFSPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVK--
SRP54_PONAB     FMSKGNEQESMALKKLMTIMDSMNDQETDGAKVFSPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVK--
SRP54_MACFA     FMSKGNEQESMALKKLMTIMDSMNDQETDGAKVFSPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVK--
SRP54_HUMAN     FMSKGNEQESMALKKLMTIMDSMNDQETDGAKVFSPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVK--
SRP54_CANFA     FMSKGNEQESMALKKLMTIMDSMNDQETDGAKVFSPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVK--
SRP54_BOVIN     FMSKGNEQESMALKKLMTIMDSMNDQETDGAKVFSPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVK--
SRP54_RAT       FMSKGNEQESMALKKLMTIMDSMNDQETDGAKVFSPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVK--
SRP54_MYCGE     VSEENAELIENKIELWKVLINSMTREERRHPKLINPNRKQRIIKGSGRKMDELNKLMK--EWNKMQLKAT
SRP54_PYRCJ     VSEEQIELSQKNLRKWKAILSSMTMEELKHPEVLNASRIRRIAMGAGVTPKDVKEMLTVFE---------
SRP54_ACIAM     QIPEDLKVGEEKMRKWLAIMNSMTYEELDNPSIIDKSRMRRIALGSGTEIEDVKELIEHYNLMQRTIKML
SRP54_NATPD     GIDDAMDMTQERLRDFEVIMDSMSEAELENPRAIGQSQIERIARGSGTDEDTVRELLE------------
SR542_ARATH     MMPEGHEKESQAIKRYMTMMDSMTNEESSNPKVFNESRIMRIARGSGRIVREVMEMLEEYKRLTTMLKNL
SRP54_GEOCY     FMSKGNERESMALKRLMTMMDSMNDGELDHPNSKQPGRAARVARGSGTSVREVNELLKQYSNFSATVK--
SRP54_YEAST     MMNQGEEETSQKMKKMVYVLDSMTKEEESDGRIEEPTRMVRVAKGSGTSVFEVEMIL-------------
SRP54_YARLI     ASSISDEEGTRRIKRMIYILDSMNQKEDSDGSIFKPSRITRVARGSGTSIREVEEVL----QQQKMMASM
SR543_ARATH     MMPKGHEKESQAIKRYMTMMDSMTNDESSNPKVFNESRMMRIARGSGRQVREV---MEMLEEYKRLAKIW
SRP54_SCHPO     MM-NGMNDEEGSMKRMLYIVDSMTEQELDSDGLLQPSRVLRVARGSGTSVLEVEETI-------------
SR542_SOLLC     ELPKGRENESQAIKRYMTMMDSMTNEESSNPKLMTDSRIMRIARGSGRQVHEV---MDMMEEYKRLAKIW
SR541_SOLLC     MMPQGREKESQAFKRYMTMMDSMTDEESTNPKILTESRIMRIARGSGRLVHEV---MEMLEEYKRLAKIF
SR543_HORVU     ELPKGQEKQSKKFKRYMTIMDSMTPAESTNPKLMTESRIIRVARGSGRKVKDV---MEMLEEYKRLAKMW
SRP54_CANAL     IMSQGDEETSKKIKNMIYIMDSMTTKELEDGRIFEPSRIVRVARGSGCAVVEVEMILQ------------
SRP54_DICDI     -LPQ-LQGNEGGLK-LKAILDSLSEKELDGKKPITQKRIITIAQGSGRHPNEVVELLKTFE---------
SR541_ARATH     MMPKGHGEESRVMKRYMTMMDSMTNKESPNPKIFNESRIMRIARGSGRLVREVMEMLEEYKRIAKTMKGI
SRP54_ASPNG     -LTAGLDDEDGSMKRMIYIFDSMTAAELDGDGVEQPSRMVRIACGSGTTVREVEDLLSQHRMMAGMAKRV
FTSY_ECOLI      ----------------------------------------------------------------------
SR542_HORVU     ELPKGHEKEGQAIKRYMTIMDSMTAAESTNPKLMTEXXXXXXXXXXXXXXXDVTDML---EEYKRLAKMW
SR541_HORVU     ELPKGHEKEGQAIKRYMTIMDSMTAAESTNPKLMTEXXXXXXXXXXXXXXXDVTDML---EEYKRLAKMW
DOCK_SULAC      ----------------------------------------------------------------------
FTSY_THEAQ      ----------------------------------------------------------------------
FTSY_NEIMC      ----------------------------------------------------------------------
FTSY_NEIMB      ----------------------------------------------------------------------
FTSY_NEIMA      ----------------------------------------------------------------------
FTSY_SYNY3      ----------------------------------------------------------------------
FTSY_NEIGO      ----------------------------------------------------------------------
Y291_METJA      ----------------------------------------------------------------------
FTSY_HAEIN      ----------------------------------------------------------------------
FTSY_AQUAE      ----------------------------------------------------------------------
FTSY_BACSU      ----------------------------------------------------------------------
FTSY_MYCHO      ----------------------------------------------------------------------
FTSY_RICCN      ----------------------------------------------------------------------
FTSY_BUCAP      ----------------------------------------------------------------------
FTSY_RICFE      ----------------------------------------------------------------------
FTSY_RICTY      ----------------------------------------------------------------------
FTSY_RICBR      ----------------------------------------------------------------------
FTSY_HELPY      ----------------------------------------------------------------------
FTSY_HELPJ      ----------------------------------------------------------------------
FTSY_MYCGE      ----------------------------------------------------------------------
FTSY_RICPR      ----------------------------------------------------------------------
FTSY_MYCPN      ----------------------------------------------------------------------
FTSY_MYCLE      ----------------------------------------------------------------------
FTSY_BUCBP      ----------------------------------------------------------------------
FTSY_BUCAI      ----------------------------------------------------------------------
FTSY_MYCTU      ----------------------------------------------------------------------
FTSY_MYCBO      ----------------------------------------------------------------------
SRPR_BOVIN      ----------------------------------------------------------------------
SRPR_MOUSE      ----------------------------------------------------------------------
SRPR_HUMAN      ----------------------------------------------------------------------
SRPR_DICDI      ----------------------------------------------------------------------
SRPR_DROME      ----------------------------------------------------------------------
SRPR_CANFA      ----------------------------------------------------------------------
SRPR_YEAST      ----------------------------------------------------------------------
FLHF_PSEPU      ----------------------------------------------------------------------
SRPR_SCHPO      ----------------------------------------------------------------------
FLHF_PSEAE      ----------------------------------------------------------------------
FLHF_HELPJ      ----------------------------------------------------------------------
FLHF_CAMJE      ----------------------------------------------------------------------
FLHF_HELPY      ----------------------------------------------------------------------
FLHF_TREPA      ----------------------------------------------------------------------
FLHF_BORBU      ----------------------------------------------------------------------
YWQD_BACSU      ----------------------------------------------------------------------
KTHY_DINSH      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           ERRKGRGLMGMFRR
SRP54_THEAQ     EKKKGRGLMGMFRR
SRP54_BACSU     --------------
SRP54_MYCTU     --LGGMGIPGI---
SRP54_MYCBO     --LGGMGIPGI---
SRP54_ECOLI     --------------
SRP54_ECOL6     --------------
SRP54_ECO57     --------------
SRP54_STRMU     --------------
SRP54_HAEIN     --------------
SRP54_MYCLE     --LGGMGIPGM---
SRP54_AQUAE     --------------
SRP54_RICCN     SKMNPKNLL-----
SRP54_SYNE7     --------------
SRP54_RICFE     SKMNPKNLL-----
SRP54_RICBR     SNMNPKNLL-----
SRP54_RICPR     SKMNPKNLL-----
SRP54_SYNY3     --------------
SR54C_ARATH     --------------
SRP54_RICTY     SKMNPQNL------
SRP54_BUCAI     K-------------
SRP54_METAC     RGGK----------
SRP54_HELPJ     TNKKG---------
SRP54_THEON     DKRK----------
SRP54_HELPY     TNKKG---------
SRP54_METBF     RGGK----------
SRP54_METST     GKRNMSGPMGKLMR
SRP54_BUCAP     --------------
SRP54_PYRKO     NKRK----------
SRP54_METMA     RGGK----------
SRP54_PYRFU     NKRQ----------
SRP54_THEGJ     DKRK----------
SRP54_METTP     --------------
SRP54_METS3     GKRGRFGMMGQFMK
SRP54_PYRAR     KRQ-----------
SRP54_METM7     KR------------
SRP54_BUCBP     --------------
SRP54_METVS     --------------
SRP54_PYRIL     KRQ-----------
SRP54_METMP     KR------------
SRP54_SULIN     KRRRG---------
SRP54_PYRAB     NKRQ----------
SRP54_METM5     KR------------
SRP54_MYCMY     TKMIKSGRM-----
SRP54_METBU     RGGK----------
SRP54_SULIY     KRRRG---------
SRP54_SULIL     KRRRG---------
SRP54_METM6     KR------------
SRP54_SULIM     KRRRG---------
SRP54_SULIK     KRRRG---------
SRP54_SULIA     KRRRG---------
SRP54_STAMF     RKRR----------
SRP54_SULAC     KRRKG---------
SRP54_HYPBU     KKRK----------
SRP54_METTH     GRRKMGGPMGQLMR
SRP54_PYRHO     NKRQ----------
SRP54_THEVO     KGNRG---------
SRP54_METJA     --RKGKML------
SRP54_SULTO     KRRKG---------
SRP54_HALMA     Q-------------
SRP54_ARCFU     --------------
SRP54_UNCMA     --------------
SRP54_THEAC     --------------
SRP54_MYCPN     E--MGRMLKG----
SRP54_PYRAE     RRQ-----------
SRP54_METLZ     KGFRG---------
SRP54_HALLT     SQFQGMG-------
SRP54_HALWD     KQFQGMG-------
SRP54_HALSA     --------------
SRP54_HALS3     --------------
SRP54_THENV     KRQ-----------
SRP54_METKA     Q-------------
SRP54_HALVO     QNMGDGDMQRMMKK
SRP54_SULSO     KRRRG---------
SRP54_METS5     KRRK----------
SRP54_ENTHI     DR------------
SRP54_AERPE     --------------
SRP54_META3     --------------
SRP54_MOUSE     ---KMGGIKGLFK-
SRP54_PONAB     ---KMGGIKGLFK-
SRP54_MACFA     ---KMGGIKGLFK-
SRP54_HUMAN     ---KMGGIKGLFK-
SRP54_CANFA     ---KMGGIKGLFK-
SRP54_BOVIN     ---KMGGIKGLFK-
SRP54_RAT       ---KMGGIKGLFK-
SRP54_MYCGE     EMGK----------
SRP54_PYRCJ     --------------
SRP54_ACIAM     KRRKKEKLLGQF--
SRP54_NATPD     --------------
SR542_ARATH     EK------------
SRP54_GEOCY     ---KMGGIKGLFK-
SRP54_YEAST     --------------
SRP54_YARLI     ASRMG-GKNGM---
SR543_ARATH     SKMKG---------
SRP54_SCHPO     --------------
SR542_SOLLC     SKMKG---------
SR541_SOLLC     SKMKG---------
SR543_HORVU     SKR-----------
SRP54_CANAL     --------------
SRP54_DICDI     --------------
SR541_ARATH     K-------------
SRP54_ASPNG     GGQK----------
FTSY_ECOLI      --------------
SR542_HORVU     SKMKG---------
SR541_HORVU     SKMKG---------
DOCK_SULAC      --------------
FTSY_THEAQ      --------------
FTSY_NEIMC      --------------
FTSY_NEIMB      --------------
FTSY_NEIMA      --------------
FTSY_SYNY3      --------------
FTSY_NEIGO      --------------
Y291_METJA      --------------
FTSY_HAEIN      --------------
FTSY_AQUAE      --------------
FTSY_BACSU      --------------
FTSY_MYCHO      --------------
FTSY_RICCN      --------------
FTSY_BUCAP      --------------
FTSY_RICFE      --------------
FTSY_RICTY      --------------
FTSY_RICBR      --------------
FTSY_HELPY      --------------
FTSY_HELPJ      --------------
FTSY_MYCGE      --------------
FTSY_RICPR      --------------
FTSY_MYCPN      --------------
FTSY_MYCLE      --------------
FTSY_BUCBP      --------------
FTSY_BUCAI      --------------
FTSY_MYCTU      --------------
FTSY_MYCBO      --------------
SRPR_BOVIN      --------------
SRPR_MOUSE      --------------
SRPR_HUMAN      --------------
SRPR_DICDI      --------------
SRPR_DROME      --------------
SRPR_CANFA      --------------
SRPR_YEAST      --------------
FLHF_PSEPU      --------------
SRPR_SCHPO      --------------
FLHF_PSEAE      --------------
FLHF_HELPJ      --------------
FLHF_CAMJE      --------------
FLHF_HELPY      --------------
FLHF_TREPA      --------------
FLHF_BORBU      --------------
YWQD_BACSU      --------------
KTHY_DINSH      --------------