[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tthe0:AAS81035.1

[Show Plain Result]


## Summary of Sequence Search
    1::433
   34::212     3e-23  37%  437 aa  YQEZ_BACSU RecName: Full=Uncharacterized protein yqeZ;
   58::181     1e-05  34%  196 aa  CLPP2_CHLFF RecName: Full=ATP-dependent Clp protease proteolytic
   53::176     1e-05  34%  191 aa  CLPP1_CHLCV RecName: Full=ATP-dependent Clp protease proteolytic
   53::176     7e-05  31%  191 aa  CLPP1_CHLPN RecName: Full=ATP-dependent Clp protease proteolytic
   24::117     1e-04  33%  200 aa  CLPP_LEUCK RecName: Full=ATP-dependent Clp protease proteolytic
   54::183     2e-04  34%  192 aa  CLPP1_CHLT2 RecName: Full=ATP-dependent Clp protease proteolytic
   97::160     2e-04  37%  286 aa  Y137_METJA RecName: Full=Uncharacterized protein MJ0137;
   54::183     2e-04  34%  192 aa  CLPP1_CHLTR RecName: Full=ATP-dependent Clp protease proteolytic
   54::183     2e-04  34%  192 aa  CLPP1_CHLTA RecName: Full=ATP-dependent Clp protease proteolytic
   54::166     2e-04  34%  192 aa  CLPP1_CHLAB RecName: Full=ATP-dependent Clp protease proteolytic
   54::183     3e-04  34%  192 aa  CLPP1_CHLMU RecName: Full=ATP-dependent Clp protease proteolytic
   33::174     7e-04  31%  208 aa  CLPP2_MESSB RecName: Full=ATP-dependent Clp protease proteolytic
    1::433

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKTYLVPIEGEIDPALAVFVEQALARAEREGASGVAFLIDT
YQEZ_BACSU      --------------------------------YVIPVEKNVEQGLASFLSRSLQDAKDAHADHIILDINT
CLPP2_CHLFF     ---------------------------------------------------------------IVFVINS
CLPP1_CHLCV     ---------------------------------------------------------------IVFVINS
CLPP1_CHLPN     ---------------------------------------------------------------IVFVINS
CLPP_LEUCK      ------------------------------KDRIVLVQGEVEDSMATIVAQLLFLEAQDPTKEISMYINS
CLPP1_CHLT2     ---------------------------------------------------------------IVFVINS
Y137_METJA      ---------------------------------------------------------------IDLIIHT
CLPP1_CHLTR     ---------------------------------------------------------------IVFVINS
CLPP1_CHLTA     ---------------------------------------------------------------IVFVINS
CLPP1_CHLAB     ---------------------------------------------------------------IVFVINS
CLPP1_CHLMU     ---------------------------------------------------------------IVFVINS
CLPP2_MESSB     ---------------------------------IIFLNGQVDDNSAALVCAQMLHLEAENPKKIAFYINS


                         .         .         *         .         .         .         .:140
query           PGGRVDAAIRISDRILQTPLPTLAVVQNAFSAGALIALSCRQIVMLPGSEIGAALPVVALPLQEPQAADQ
YQEZ_BACSU      PGGLVKSAIDMADLITESEIPVTAYVKRALSAGAYIALQADHIYMAPGGKMGAA----AIVDGQGNAADQ
CLPP2_CHLFF     PGGSVDAGFAVWDQIKMMTSPVTTVVTGAASMGSVLSLCAARRFATPHSRIMIHQPSIGGPI-TGQATDL
CLPP1_CHLCV     PGGSVDAGFAVWDQIKMMTSPVTTVVTGAASMGSVLSLCAARRFATPHSRIMIHQPSIGGPI-TGQATDL
CLPP1_CHLPN     PGGSVDAGFAVWDQIKMLTSPVTTVVTGAASMGSVLSLCAARRFATPHSRIMIHQPSIGGPI-TGQATDL
CLPP_LEUCK      PGGSVTAGLSITDNFIKAPVTTI-VMGLAASMGTIIASSGEKRFMLPNAE--------------------
CLPP1_CHLT2     PGGSVDAGFAVWDQIKMISSPLTTVVTGAASMGSVLSLCA-----VPGRRF--ATPHARIMIHQPQATDL
Y137_METJA      PGGLVLAATQIAKALKAHPAETRVIVPHAMSGGTLIALAADKIIMDENAVLGPVDP--------------
CLPP1_CHLTR     PGGSVDAGFAVWDQIKMISSPLTTVVTGAASMGSVLSLCA-----VPGRRF--ATPHARIMIHQPQATDL
CLPP1_CHLTA     PGGSVDAGFAVWDQIKMISSPLTTVVTGAASMGSVLSLCA-----VPGRRF--ATPHARIMIHQPQATDL
CLPP1_CHLAB     PGGSVDAGFAVWDQIKMMTSPVTTVVTGAASMGSVLSLCAARRFATPHSRIMIHQPSIGGPI-TGQATDL
CLPP1_CHLMU     PGGSVDAGFAVWDQIKMISSPVTTVVTGAASMGSVLSLCA-----APGRRF--ATPHARIMIHQPQATDL
CLPP2_MESSB     PGGVVSSGFAIYDQFIKCPVATLC-LGTAASMGSF-------LLMAGERGMRVALPNASIILHQPQASDQ


                         +         .         .         .         .         *         .:210
query           KVISALKGKFRAVAEARGRPVELAEAMVDPNLEVPGLSAKGEPLTLSADKAVELKVADLKAASLYEALQA
YQEZ_BACSU      KAQSLWLAEMEDAAVKNNRDPKYALAMADPDIDAKEVGAKGDLLTLNADKAIEVGYSEGTADNLSTLVKK
CLPP2_CHLFF     DIHAILKTKKRIVVEATGQPREVIEKAIDRDMWMTADEAK------------------------------
CLPP1_CHLCV     DIHAILKTKKRIVLEATGQPREVIEKAIDRDMWMTADEAK------------------------------
CLPP1_CHLPN     DIHAILKTKARIIVEATNQPRDIIEKAIDRDMWMTANEAK------------------------------
CLPP_LEUCK      ----------------------------------------------------------------------
CLPP1_CHLT2     DIHAILKTKARIIVEATGQSPEVIEKAID------------RDMWMSANEAMEFGLLD------------
Y137_METJA      ----------------------------------------------------------------------
CLPP1_CHLTR     DIHAILKTKARIIVEATGQSREVIEKAID------------RDMWMSANEAMEFGLLD------------
CLPP1_CHLTA     DIHAILKTKARIIVEATGQSREVIEKAID------------RDMWMSANEAMEFGLLD------------
CLPP1_CHLAB     DIHAILKTKKRIVLEATGQSREVIEKAID-----------------------------------------
CLPP1_CHLMU     DIHAILKTKARIIVEATGQSREVIEKAID------------RDMWMSANEAMEFGLLD------------
CLPP2_MESSB     NVMRHKRRMIRLYAEHCGRAEEDVERTLD-----------------------------------------


                         .         .         .         +         .         .         .:280
query           AGFxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YQEZ_BACSU      LGF-------------------------------------------------------------------
CLPP2_CHLFF     ----------------------------------------------------------------------
CLPP1_CHLCV     ----------------------------------------------------------------------
CLPP1_CHLPN     ----------------------------------------------------------------------
CLPP_LEUCK      ----------------------------------------------------------------------
CLPP1_CHLT2     ----------------------------------------------------------------------
Y137_METJA      ----------------------------------------------------------------------
CLPP1_CHLTR     ----------------------------------------------------------------------
CLPP1_CHLTA     ----------------------------------------------------------------------
CLPP1_CHLAB     ----------------------------------------------------------------------
CLPP1_CHLMU     ----------------------------------------------------------------------
CLPP2_MESSB     ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YQEZ_BACSU      ----------------------------------------------------------------------
CLPP2_CHLFF     ----------------------------------------------------------------------
CLPP1_CHLCV     ----------------------------------------------------------------------
CLPP1_CHLPN     ----------------------------------------------------------------------
CLPP_LEUCK      ----------------------------------------------------------------------
CLPP1_CHLT2     ----------------------------------------------------------------------
Y137_METJA      ----------------------------------------------------------------------
CLPP1_CHLTR     ----------------------------------------------------------------------
CLPP1_CHLTA     ----------------------------------------------------------------------
CLPP1_CHLAB     ----------------------------------------------------------------------
CLPP1_CHLMU     ----------------------------------------------------------------------
CLPP2_MESSB     ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YQEZ_BACSU      ----------------------------------------------------------------------
CLPP2_CHLFF     ----------------------------------------------------------------------
CLPP1_CHLCV     ----------------------------------------------------------------------
CLPP1_CHLPN     ----------------------------------------------------------------------
CLPP_LEUCK      ----------------------------------------------------------------------
CLPP1_CHLT2     ----------------------------------------------------------------------
Y137_METJA      ----------------------------------------------------------------------
CLPP1_CHLTR     ----------------------------------------------------------------------
CLPP1_CHLTA     ----------------------------------------------------------------------
CLPP1_CHLAB     ----------------------------------------------------------------------
CLPP1_CHLMU     ----------------------------------------------------------------------
CLPP2_MESSB     ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxx
YQEZ_BACSU      -------------
CLPP2_CHLFF     -------------
CLPP1_CHLCV     -------------
CLPP1_CHLPN     -------------
CLPP_LEUCK      -------------
CLPP1_CHLT2     -------------
Y137_METJA      -------------
CLPP1_CHLTR     -------------
CLPP1_CHLTA     -------------
CLPP1_CHLAB     -------------
CLPP1_CHLMU     -------------
CLPP2_MESSB     -------------