[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tthe0:AAS81275.1

[Show Plain Result]


## Summary of Sequence Search
    1::618
    1::618       0.0  97%  618 aa  SYM_THET8 RecName: Full=Methionyl-tRNA synthetase;       
   17::681     e-160  52%  681 aa  SYM_DEIRA RecName: Full=Methionyl-tRNA synthetase;       
    3::628     e-150  46%  629 aa  SYM_THEMA RecName: Full=Methionyl-tRNA synthetase;       
    1::637     e-145  45%  638 aa  SYM_THETN RecName: Full=Methionyl-tRNA synthetase;       
    5::660     e-144  48%  660 aa  SYM_BACHD RecName: Full=Methionyl-tRNA synthetase;       
    3::649     e-142  48%  649 aa  SYM_BACST RecName: Full=Methionyl-tRNA synthetase;       
    3::641     e-136  47%  641 aa  SYM_CLOTE RecName: Full=Methionyl-tRNA synthetase;       
    6::660     e-133  46%  660 aa  SYM1_BACCR RecName: Full=Methionyl-tRNA synthetase 1;       
    6::660     e-132  46%  660 aa  SYM1_BACAN RecName: Full=Methionyl-tRNA synthetase 1;       
    8::664     e-131  46%  664 aa  SYM_BACSU RecName: Full=Methionyl-tRNA synthetase;       
    3::659     e-129  42%  659 aa  SYM_STAHJ RecName: Full=Methionyl-tRNA synthetase;       
   20::645     e-129  46%  645 aa  SYM_CLOPE RecName: Full=Methionyl-tRNA synthetase;       
    6::656     e-128  42%  656 aa  SYM_STAES RecName: Full=Methionyl-tRNA synthetase;       
    6::656     e-128  42%  656 aa  SYM_STAEQ RecName: Full=Methionyl-tRNA synthetase;       
    3::657     e-126  41%  657 aa  SYM_STAAR RecName: Full=Methionyl-tRNA synthetase;       
    3::657     e-126  41%  657 aa  SYM_STAAW RecName: Full=Methionyl-tRNA synthetase;       
    3::657     e-126  41%  657 aa  SYM_STAAS RecName: Full=Methionyl-tRNA synthetase;       
    3::657     e-126  41%  657 aa  SYM_STAAN RecName: Full=Methionyl-tRNA synthetase;       
    3::657     e-126  41%  657 aa  SYM_STAAM RecName: Full=Methionyl-tRNA synthetase;       
    3::657     e-126  41%  657 aa  SYM_STAAC RecName: Full=Methionyl-tRNA synthetase;       
    1::635     e-126  43%  636 aa  SYM_FUSNN RecName: Full=Methionyl-tRNA synthetase;       
    4::666     e-123  43%  669 aa  SYM_ENTFA RecName: Full=Methionyl-tRNA synthetase;       
    4::672     e-123  42%  673 aa  SYM_OCEIH RecName: Full=Methionyl-tRNA synthetase;       
    5::664     e-123  44%  664 aa  SYM_LISIN RecName: Full=Methionyl-tRNA synthetase;       
    6::665     e-122  43%  665 aa  SYM_LISMF RecName: Full=Methionyl-tRNA synthetase;       
    5::470     e-122  46%  497 aa  SYM_AQUAE RecName: Full=Methionyl-tRNA synthetase;       
    5::664     e-122  43%  664 aa  SYM_LISMO RecName: Full=Methionyl-tRNA synthetase;       
    3::658     e-122  40%  658 aa  SYM_STAS1 RecName: Full=Methionyl-tRNA synthetase;       
    5::661     e-121  42%  662 aa  SYM_LACLA RecName: Full=Methionyl-tRNA synthetase;       
    4::644     e-120  48%  644 aa  SYM_CLOAB RecName: Full=Methionyl-tRNA synthetase;       
    3::664     e-112  42%  665 aa  SYM_STRR6 RecName: Full=Methionyl-tRNA synthetase;       
    3::664     e-112  42%  665 aa  SYM_STRPN RecName: Full=Methionyl-tRNA synthetase;       
    3::627     e-112  40%  628 aa  SYM_CAMJE RecName: Full=Methionyl-tRNA synthetase;       
   12::529     e-107  43%  538 aa  SYM_STRCO RecName: Full=Methionyl-tRNA synthetase;       
    6::655     e-106  40%  656 aa  SYM_HELPJ RecName: Full=Methionyl-tRNA synthetase;       
    6::649     e-106  39%  650 aa  SYM_HELPY RecName: Full=Methionyl-tRNA synthetase;       
    1::481     e-105  42%  512 aa  SYM_RICFE RecName: Full=Methionyl-tRNA synthetase;       
    1::664     e-103  39%  665 aa  SYM_STRP8 RecName: Full=Methionyl-tRNA synthetase;       
    1::664     e-103  39%  665 aa  SYM_STRP1 RecName: Full=Methionyl-tRNA synthetase;       
    1::664     e-103  39%  665 aa  SYM_STRP3 RecName: Full=Methionyl-tRNA synthetase;       
    1::664     e-103  39%  665 aa  SYM_STRP6 RecName: Full=Methionyl-tRNA synthetase;       
    6::482     e-103  42%  515 aa  SYM_BRUSU RecName: Full=Methionyl-tRNA synthetase;       
    6::482     e-102  42%  515 aa  SYM_BRUME RecName: Full=Methionyl-tRNA synthetase;       
    9::522     e-102  43%  532 aa  SYM_SYNY3 RecName: Full=Methionyl-tRNA synthetase;       
    8::485     e-100  43%  530 aa  SYM_ANASP RecName: Full=Methionyl-tRNA synthetase;       
    7::507     e-100  43%  516 aa  SYM_RHIME RecName: Full=Methionyl-tRNA synthetase;       
    6::481     4e-98  41%  516 aa  SYM_RHILO RecName: Full=Methionyl-tRNA synthetase;       
   14::481     6e-97  41%  509 aa  SYM_RICBR RecName: Full=Methionyl-tRNA synthetase;       
    1::515     8e-97  40%  529 aa  SYM_THEEB RecName: Full=Methionyl-tRNA synthetase;       
    7::507     2e-96  42%  516 aa  SYM_AGRT5 RecName: Full=Methionyl-tRNA synthetase;       
    1::481     3e-96  40%  508 aa  SYM_RICPR RecName: Full=Methionyl-tRNA synthetase;       
    2::479     7e-96  43%  519 aa  SYM_MYCBO RecName: Full=Methionyl-tRNA synthetase;       
    4::503     3e-95  42%  537 aa  SYM_MYCLE RecName: Full=Methionyl-tRNA synthetase;       
    2::479     6e-95  43%  519 aa  SYM_MYCTU RecName: Full=Methionyl-tRNA synthetase;       
    1::481     5e-94  40%  507 aa  SYM_RICTY RecName: Full=Methionyl-tRNA synthetase;       
   14::481     5e-93  40%  508 aa  SYM_RICCN RecName: Full=Methionyl-tRNA synthetase;       
   22::682     3e-92  43%  683 aa  SYM_LACPL RecName: Full=Methionyl-tRNA synthetase;       
   44::536     6e-87  40%  590 aa  SYMM_TAKRU RecName: Full=Methionyl-tRNA synthetase, mitochondrial; 
    4::472     3e-86  39%  521 aa  SYM_UREPA RecName: Full=Methionyl-tRNA synthetase;       
   60::561     4e-83  39%  622 aa  SYMM_NEUCR RecName: Full=Probable methionyl-tRNA synthetase,
   46::546     1e-82  40%  593 aa  SYMM_BOVIN RecName: Full=Methionyl-tRNA synthetase, mitochondrial; 
   46::546     1e-82  40%  593 aa  SYMM_HUMAN RecName: Full=Methionyl-tRNA synthetase, mitochondrial; 
   39::522     3e-82  40%  562 aa  SYMM_XENLA RecName: Full=Methionyl-tRNA synthetase, mitochondrial; 
   39::539     1e-80  40%  586 aa  SYMM_MOUSE RecName: Full=Methionyl-tRNA synthetase, mitochondrial; 
   42::492     1e-79  39%  575 aa  SYMM_DICDI RecName: Full=Probable methionyl-tRNA synthetase,
    1::639     3e-79  38%  651 aa  SYM_METTH RecName: Full=Methionyl-tRNA synthetase;       
   21::493     1e-78  39%  582 aa  SYMM_DROME RecName: Full=Methionyl-tRNA synthetase, mitochondrial; 
    6::668     2e-78  36%  668 aa  SYM_METKA RecName: Full=Methionyl-tRNA synthetase;       
    1::647     6e-78  37%  660 aa  SYM_METS3 RecName: Full=Methionyl-tRNA synthetase;       
    1::671     1e-76  37%  676 aa  SYM_METST RecName: Full=Methionyl-tRNA synthetase;       
    5::662     2e-75  36%  663 aa  SYM_METM7 RecName: Full=Methionyl-tRNA synthetase;       
    1::492     2e-75  34%  509 aa  SYM_MYCPU RecName: Full=Methionyl-tRNA synthetase;       
    5::662     2e-75  34%  663 aa  SYM_METM5 RecName: Full=Methionyl-tRNA synthetase;       
    5::504     2e-74  33%  512 aa  SYM_MYCPN RecName: Full=Methionyl-tRNA synthetase;       
    5::662     4e-74  33%  663 aa  SYM_METMP RecName: Full=Methionyl-tRNA synthetase;       
   18::509     6e-74  39%  539 aa  SYMM_SCHPO RecName: Full=Probable methionyl-tRNA synthetase,
    5::466     3e-73  34%  512 aa  SYM_MYCGE RecName: Full=Methionyl-tRNA synthetase;       
    8::664     3e-73  33%  664 aa  SYM_METHJ RecName: Full=Methionyl-tRNA synthetase;       
    4::657     1e-72  33%  658 aa  SYM_ARCFU RecName: Full=Methionyl-tRNA synthetase;       
    8::672     5e-72  33%  673 aa  SYM_METLZ RecName: Full=Methionyl-tRNA synthetase;       
    5::662     7e-72  35%  663 aa  SYM_METVS RecName: Full=Methionyl-tRNA synthetase;       
   10::669     7e-72  33%  669 aa  SYM_METTP RecName: Full=Methionyl-tRNA synthetase;       
   13::541     4e-71  38%  575 aa  SYMM_YEAST RecName: Full=Methionyl-tRNA synthetase, mitochondrial; 
    8::662     1e-70  32%  662 aa  SYM_METB6 RecName: Full=Methionyl-tRNA synthetase;       
   18::527     1e-70  38%  577 aa  SYMM_CANAL RecName: Full=Methionyl-tRNA synthetase, mitochondrial; 
    4::664     3e-69  33%  664 aa  SYM_METMJ RecName: Full=Methionyl-tRNA synthetase;       
    9::700     5e-69  33%  700 aa  SYM_CHLT3 RecName: Full=Methionyl-tRNA synthetase;       
    1::679     9e-69  34%  679 aa  SYM_PARD8 RecName: Full=Methionyl-tRNA synthetase;       
    1::679     2e-67  33%  679 aa  SYM_BACTN RecName: Full=Methionyl-tRNA synthetase;       
    1::679     7e-67  34%  679 aa  SYM_BACFR RecName: Full=Methionyl-tRNA synthetase;       
    1::679     7e-67  34%  679 aa  SYM_BACFN RecName: Full=Methionyl-tRNA synthetase;       
    3::651     1e-66  34%  651 aa  SYM_METJA RecName: Full=Methionyl-tRNA synthetase;       
   10::680     6e-66  33%  680 aa  SYM_PORG3 RecName: Full=Methionyl-tRNA synthetase;       
    8::663     9e-66  32%  663 aa  SYM_METPE RecName: Full=Methionyl-tRNA synthetase;       
    8::671     9e-66  31%  691 aa  SYM_GRAFK RecName: Full=Methionyl-tRNA synthetase;       
   13::683     1e-65  31%  683 aa  SYM_UNCMA RecName: Full=Methionyl-tRNA synthetase;       
   10::680     3e-65  33%  680 aa  SYM_PORGI RecName: Full=Methionyl-tRNA synthetase;       
   10::680     9e-64  32%  680 aa  SYM_BACV8 RecName: Full=Methionyl-tRNA synthetase;       
    1::675     3e-62  33%  675 aa  SYM_ALHEH RecName: Full=Methionyl-tRNA synthetase;       
    6::660     8e-62  30%  686 aa  SYM_FLAPJ RecName: Full=Methionyl-tRNA synthetase;       
    7::668     5e-60  33%  688 aa  SYM_DIAST RecName: Full=Methionyl-tRNA synthetase;       
    7::668     8e-60  33%  688 aa  SYM_ACISJ RecName: Full=Methionyl-tRNA synthetase;       
    9::692     5e-59  32%  700 aa  SYM_PELPB RecName: Full=Methionyl-tRNA synthetase;       
    1::674     5e-59  32%  674 aa  SYM_NITOC RecName: Full=Methionyl-tRNA synthetase;       
    8::688     7e-59  30%  689 aa  SYM_CYTH3 RecName: Full=Methionyl-tRNA synthetase;       
   12::697     1e-58  33%  705 aa  SYM_CHLCH RecName: Full=Methionyl-tRNA synthetase;       
    9::702     2e-58  34%  702 aa  SYM_PELLD RecName: Full=Methionyl-tRNA synthetase;       
    1::681     4e-58  31%  681 aa  SYM_LEPBP RecName: Full=Methionyl-tRNA synthetase;       
    1::681     4e-58  31%  681 aa  SYM_LEPBA RecName: Full=Methionyl-tRNA synthetase;       
   13::677     2e-56  30%  681 aa  SYM_CHRSD RecName: Full=Methionyl-tRNA synthetase;       
    3::669     5e-56  32%  689 aa  SYM_POLSJ RecName: Full=Methionyl-tRNA synthetase;       
    1::679     7e-56  32%  679 aa  SYM_HALHL RecName: Full=Methionyl-tRNA synthetase;       
   10::660     9e-56  30%  680 aa  SYM_PHOPR RecName: Full=Methionyl-tRNA synthetase;       
    1::669     9e-56  32%  689 aa  SYM_LEPCP RecName: Full=Methionyl-tRNA synthetase;       
    6::677     9e-56  29%  677 aa  SYM_AERHH RecName: Full=Methionyl-tRNA synthetase;       
    3::668     2e-55  29%  688 aa  SYM_RALSO RecName: Full=Methionyl-tRNA synthetase;       
   13::674     2e-55  28%  678 aa  SYM_MARAV RecName: Full=Methionyl-tRNA synthetase;       
   10::681     3e-55  31%  681 aa  SYM_HAHCH RecName: Full=Methionyl-tRNA synthetase;       
    7::683     6e-55  30%  684 aa  SYM_METBU RecName: Full=Methionyl-tRNA synthetase;       
    1::678     1e-54  31%  678 aa  SYM_ACIF5 RecName: Full=Methionyl-tRNA synthetase;       
    1::678     1e-54  31%  678 aa  SYM_ACIF2 RecName: Full=Methionyl-tRNA synthetase;       
    7::672     1e-54  29%  673 aa  SYM_DICNV RecName: Full=Methionyl-tRNA synthetase;       
   10::697     2e-54  30%  698 aa  SYM_PARUW RecName: Full=Methionyl-tRNA synthetase;       
    1::681     3e-54  32%  685 aa  SYM_ACIAD RecName: Full=Methionyl-tRNA synthetase;       
   10::670     6e-54  31%  690 aa  SYM_VIBVY RecName: Full=Methionyl-tRNA synthetase;       
   10::670     6e-54  31%  690 aa  SYM_VIBVU RecName: Full=Methionyl-tRNA synthetase;       
    9::680     6e-54  30%  680 aa  SYM_THICR RecName: Full=Methionyl-tRNA synthetase;       
    1::696     6e-54  31%  696 aa  SYM_DECAR RecName: Full=Methionyl-tRNA synthetase;       
   10::663     1e-53  33%  683 aa  SYM_VIBC3 RecName: Full=Methionyl-tRNA synthetase;       
   10::666     2e-53  33%  686 aa  SYM_VIBHB RecName: Full=Methionyl-tRNA synthetase;       
   10::663     2e-53  33%  683 aa  SYM_VIBCH RecName: Full=Methionyl-tRNA synthetase;       
    8::681     2e-53  32%  686 aa  SYM_RALEH RecName: Full=Methionyl-tRNA synthetase;       
   15::668     2e-53  33%  688 aa  SYM_VIBPA RecName: Full=Methionyl-tRNA synthetase;       
   10::682     2e-53  30%  682 aa  SYM_PASMU RecName: Full=Methionyl-tRNA synthetase;       
    1::674     2e-53  33%  697 aa  SYM_METPP RecName: Full=Methionyl-tRNA synthetase;       
    9::667     2e-53  32%  687 aa  SYM_BDEBA RecName: Full=Methionyl-tRNA synthetase;       
   10::666     9e-53  32%  686 aa  SYM_VIBSL RecName: Full=Methionyl-tRNA synthetase;       
   10::675     9e-53  30%  675 aa  SYM_TOLAT RecName: Full=Methionyl-tRNA synthetase;       
    1::679     1e-52  29%  679 aa  SYM_ACTP2 RecName: Full=Methionyl-tRNA synthetase;       
    1::682     6e-52  29%  682 aa  SYM_ACTPJ RecName: Full=Methionyl-tRNA synthetase;       
    1::682     6e-52  29%  682 aa  SYM_ACTP7 RecName: Full=Methionyl-tRNA synthetase;       
   21::692     2e-51  29%  692 aa  SYM_METFK RecName: Full=Methionyl-tRNA synthetase;       
    4::670     2e-51  30%  670 aa  SYM_LEGPC RecName: Full=Methionyl-tRNA synthetase;       
    1::668     2e-51  33%  691 aa  SYM_BORA1 RecName: Full=Methionyl-tRNA synthetase;       
    9::679     2e-51  29%  679 aa  SYM_PSEE4 RecName: Full=Methionyl-tRNA synthetase;       
    1::674     3e-51  31%  679 aa  SYM_RHOBA RecName: Full=Methionyl-tRNA synthetase;       
    9::679     3e-51  29%  679 aa  SYM_PSEPG RecName: Full=Methionyl-tRNA synthetase;       
   13::698     3e-51  30%  698 aa  SYM_NATPD RecName: Full=Methionyl-tRNA synthetase;       
    4::670     3e-51  29%  670 aa  SYM_LEGPH RecName: Full=Methionyl-tRNA synthetase;       
    9::681     4e-51  29%  681 aa  SYM_PSEPW RecName: Full=Methionyl-tRNA synthetase;       
   10::682     4e-51  31%  682 aa  SYM_HAEI8 RecName: Full=Methionyl-tRNA synthetase;       
   10::666     5e-51  31%  686 aa  SYM_VIBFM RecName: Full=Methionyl-tRNA synthetase;       
   10::675     5e-51  30%  675 aa  SYM_PSEA6 RecName: Full=Methionyl-tRNA synthetase;       
   11::712     5e-51  35%  712 aa  SYM_METAC RecName: Full=Methionyl-tRNA synthetase;       
    9::684     5e-51  28%  684 aa  SYM_HAEDU RecName: Full=Methionyl-tRNA synthetase;       
   21::710     5e-51  31%  710 aa  SYM_BURXL RecName: Full=Methionyl-tRNA synthetase;       
    6::677     7e-51  29%  677 aa  SYM_SHIFL RecName: Full=Methionyl-tRNA synthetase;       
    6::677     7e-51  29%  677 aa  SYM_SHIF8 RecName: Full=Methionyl-tRNA synthetase;       
   12::713     7e-51  31%  713 aa  SYM_SALRD RecName: Full=Methionyl-tRNA synthetase;       
   10::684     7e-51  29%  684 aa  SYM_HAEPS RecName: Full=Methionyl-tRNA synthetase;       
   10::695     7e-51  30%  703 aa  SYM_CHLTE RecName: Full=Methionyl-tRNA synthetase;       
    1::672     7e-51  34%  692 aa  SYM_BORBR RecName: Full=Methionyl-tRNA synthetase;       
    4::670     9e-51  30%  670 aa  SYM_LEGPA RecName: Full=Methionyl-tRNA synthetase;       
    1::672     9e-51  33%  692 aa  SYM_BORPE RecName: Full=Methionyl-tRNA synthetase;       
    1::672     9e-51  33%  692 aa  SYM_BORPA RecName: Full=Methionyl-tRNA synthetase;       
   10::666     9e-51  30%  686 aa  SYM_ALISL RecName: Full=Methionyl-tRNA synthetase;       
   10::681     1e-50  31%  686 aa  SYM_VIBF1 RecName: Full=Methionyl-tRNA synthetase;       
    8::670     1e-50  32%  690 aa  SYM_RALME RecName: Full=Methionyl-tRNA synthetase;       
    3::684     1e-50  30%  707 aa  SYM_POLNA RecName: Full=Methionyl-tRNA synthetase;       
    6::677     1e-50  29%  677 aa  SYM_ECOUT RecName: Full=Methionyl-tRNA synthetase;       
    6::677     1e-50  29%  677 aa  SYM_ECOL6 RecName: Full=Methionyl-tRNA synthetase;       
    6::677     1e-50  29%  677 aa  SYM_ECOK1 RecName: Full=Methionyl-tRNA synthetase;       
    6::677     1e-50  29%  677 aa  SYM_ECO45 RecName: Full=Methionyl-tRNA synthetase;       
    5::679     1e-50  28%  679 aa  SYM_SHEPA RecName: Full=Methionyl-tRNA synthetase;       
    6::677     1e-50  29%  677 aa  SYM_ESCF3 RecName: Full=Methionyl-tRNA synthetase;       
    9::690     1e-50  31%  702 aa  SYM_CHLL2 RecName: Full=Methionyl-tRNA synthetase;       
    7::710     2e-50  34%  710 aa  SYM_METBF RecName: Full=Methionyl-tRNA synthetase;       
    4::670     2e-50  29%  670 aa  SYM_LEGPL RecName: Full=Methionyl-tRNA synthetase;       
   10::685     2e-50  29%  686 aa  SYM_MANSM RecName: Full=Methionyl-tRNA synthetase;       
    9::680     2e-50  30%  702 aa  SYM_CHLPD RecName: Full=Methionyl-tRNA synthetase;       
    8::668     3e-50  31%  688 aa  SYM_RALEJ RecName: Full=Methionyl-tRNA synthetase;       
    9::679     3e-50  29%  679 aa  SYM_PSEPK RecName: Full=Methionyl-tRNA synthetase;       
    9::679     3e-50  29%  679 aa  SYM_PSEP1 RecName: Full=Methionyl-tRNA synthetase;       
    6::676     4e-50  29%  676 aa  SYM_PECCP RecName: Full=Methionyl-tRNA synthetase;       
    6::676     6e-50  29%  676 aa  SYM_ERWCT RecName: Full=Methionyl-tRNA synthetase;       
    5::666     7e-50  29%  686 aa  SYM_PSYIN RecName: Full=Methionyl-tRNA synthetase;       
   10::685     7e-50  32%  685 aa  SYM_ACTSZ RecName: Full=Methionyl-tRNA synthetase;       
    6::677     9e-50  29%  677 aa  SYM_SHIB3 RecName: Full=Methionyl-tRNA synthetase;       
    6::677     1e-49  30%  677 aa  SYM_SHISS RecName: Full=Methionyl-tRNA synthetase;       
    6::677     1e-49  30%  677 aa  SYM_SHIBS RecName: Full=Methionyl-tRNA synthetase;       
    9::702     1e-49  32%  702 aa  SYM_PROVI RecName: Full=Methionyl-tRNA synthetase;       
    6::677     1e-49  28%  677 aa  SYM_KLEP7 RecName: Full=Methionyl-tRNA synthetase;       
    6::677     1e-49  28%  677 aa  SYM_KLEP3 RecName: Full=Methionyl-tRNA synthetase;       
    6::676     1e-49  29%  676 aa  SYM_ERWT9 RecName: Full=Methionyl-tRNA synthetase;       
    6::677     1e-49  30%  677 aa  SYM_ECO81 RecName: Full=Methionyl-tRNA synthetase;       
    6::677     1e-49  30%  677 aa  SYM_ECO27 RecName: Full=Methionyl-tRNA synthetase;       
    5::679     2e-49  28%  679 aa  SYM_SHEHH RecName: Full=Methionyl-tRNA synthetase;       
    9::694     2e-49  30%  694 aa  SYM_METCA RecName: Full=Methionyl-tRNA synthetase;       
    6::677     2e-49  30%  677 aa  SYM_ECOSM RecName: Full=Methionyl-tRNA synthetase;       
    6::677     2e-49  30%  677 aa  SYM_ECOSE RecName: Full=Methionyl-tRNA synthetase;       
    6::677     2e-49  29%  677 aa  SYM_ECOLU RecName: Full=Methionyl-tRNA synthetase;       
    6::677     2e-49  30%  677 aa  SYM_ECOLI RecName: Full=Methionyl-tRNA synthetase;       
    6::677     2e-49  30%  677 aa  SYM_ECOLC RecName: Full=Methionyl-tRNA synthetase;       
    6::677     2e-49  30%  677 aa  SYM_ECOL5 RecName: Full=Methionyl-tRNA synthetase;       
    6::677     2e-49  30%  677 aa  SYM_ECOHS RecName: Full=Methionyl-tRNA synthetase;       
    6::677     2e-49  30%  677 aa  SYM_ECODH RecName: Full=Methionyl-tRNA synthetase;       
    6::677     2e-49  30%  677 aa  SYM_ECOBW RecName: Full=Methionyl-tRNA synthetase;       
    6::677     2e-49  30%  677 aa  SYM_ECO8A RecName: Full=Methionyl-tRNA synthetase;       
    6::677     2e-49  30%  677 aa  SYM_ECO7I RecName: Full=Methionyl-tRNA synthetase;       
    6::677     2e-49  30%  677 aa  SYM_ECO5E RecName: Full=Methionyl-tRNA synthetase;       
    6::677     2e-49  30%  677 aa  SYM_ECO57 RecName: Full=Methionyl-tRNA synthetase;       
    6::677     2e-49  30%  677 aa  SYM_ECO55 RecName: Full=Methionyl-tRNA synthetase;       
    6::677     2e-49  30%  677 aa  SYM_ECO24 RecName: Full=Methionyl-tRNA synthetase;       
    9::682     2e-49  30%  682 aa  SYM_PSE14 RecName: Full=Methionyl-tRNA synthetase;       
   10::683     2e-49  29%  683 aa  SYM_HAES2 RecName: Full=Methionyl-tRNA synthetase;       
    6::677     3e-49  29%  677 aa  SYM_SALTI RecName: Full=Methionyl-tRNA synthetase;       
    6::677     3e-49  29%  677 aa  SYM_SALSV RecName: Full=Methionyl-tRNA synthetase;       
    6::677     3e-49  29%  677 aa  SYM_SALPC RecName: Full=Methionyl-tRNA synthetase;       
    6::677     3e-49  29%  677 aa  SYM_SALG2 RecName: Full=Methionyl-tRNA synthetase;       
    6::677     3e-49  29%  677 aa  SYM_SALEP RecName: Full=Methionyl-tRNA synthetase;       
    6::677     3e-49  29%  677 aa  SYM_SALCH RecName: Full=Methionyl-tRNA synthetase;       
   10::683     3e-49  29%  683 aa  SYM_HAES1 RecName: Full=Methionyl-tRNA synthetase;       
    6::677     4e-49  30%  677 aa  SYM_SHIDS RecName: Full=Methionyl-tRNA synthetase;       
    6::677     5e-49  29%  677 aa  SYM_SALPK RecName: Full=Methionyl-tRNA synthetase;       
    6::677     5e-49  29%  677 aa  SYM_SALPB RecName: Full=Methionyl-tRNA synthetase;       
    6::677     5e-49  29%  677 aa  SYM_SALPA RecName: Full=Methionyl-tRNA synthetase;       
    6::677     5e-49  29%  677 aa  SYM_SALAR RecName: Full=Methionyl-tRNA synthetase;       
    5::688     6e-49  29%  688 aa  SYM_SHEWM RecName: Full=Methionyl-tRNA synthetase;       
    6::677     6e-49  28%  677 aa  SYM_SALTY RecName: Full=Methionyl-tRNA synthetase;       
    6::677     6e-49  29%  677 aa  SYM_SALNS RecName: Full=Methionyl-tRNA synthetase;       
    6::677     6e-49  29%  677 aa  SYM_SALHS RecName: Full=Methionyl-tRNA synthetase;       
    6::677     6e-49  28%  677 aa  SYM_SALDC RecName: Full=Methionyl-tRNA synthetase;       
    6::677     6e-49  29%  677 aa  SYM_SALA4 RecName: Full=Methionyl-tRNA synthetase;       
    9::672     6e-49  30%  677 aa  SYM_SACD2 RecName: Full=Methionyl-tRNA synthetase;       
   11::499     1e-48  29%  540 aa  SYM_HALOH RecName: Full=Methionyl-tRNA synthetase;       
   13::515     1e-48  33%  584 aa  SYM_THERP RecName: Full=Methionyl-tRNA synthetase;       
    5::675     1e-48  28%  675 aa  SYM_SHEAM RecName: Full=Methionyl-tRNA synthetase;       
   12::519     2e-48  33%  572 aa  SYM_HYPBU RecName: Full=Methionyl-tRNA synthetase;       
    4::723     3e-48  35%  723 aa  SYM_PYRHO RecName: Full=Methionyl-tRNA synthetase;       
    4::733     4e-48  34%  733 aa  SYM_THEON RecName: Full=Methionyl-tRNA synthetase;       
    4::523     4e-48  35%  571 aa  SYM_SULTO RecName: Full=Methionyl-tRNA synthetase;       
    9::678     4e-48  28%  678 aa  SYM_PSEMY RecName: Full=Methionyl-tRNA synthetase;       
   10::682     4e-48  31%  682 aa  SYM_HAEIE RecName: Full=Methionyl-tRNA synthetase;       
   10::675     5e-48  28%  675 aa  SYM_PROMH RecName: Full=Methionyl-tRNA synthetase;       
   10::682     5e-48  31%  682 aa  SYM_HAEIN RecName: Full=Methionyl-tRNA synthetase;       
   10::682     5e-48  31%  682 aa  SYM_HAEIG RecName: Full=Methionyl-tRNA synthetase;       
    1::690     7e-48  31%  690 aa  SYM_THIDA RecName: Full=Methionyl-tRNA synthetase;       
    4::741     7e-48  35%  741 aa  SYM_PYRKO RecName: Full=Methionyl-tRNA synthetase;       
    8::671     9e-48  32%  691 aa  SYM_VEREI RecName: Full=Methionyl-tRNA synthetase;       
    6::678     9e-48  29%  704 aa  SYM_LEPBL RecName: Full=Methionyl-tRNA synthetase;       
    6::678     9e-48  29%  704 aa  SYM_LEPBJ RecName: Full=Methionyl-tRNA synthetase;       
   11::510     9e-48  31%  559 aa  SYM_KORCO RecName: Full=Methionyl-tRNA synthetase;       
    1::680     1e-47  31%  700 aa  SYM_RHOFD RecName: Full=Methionyl-tRNA synthetase;       
    8::696     2e-47  28%  700 aa  SYM_PSYCK RecName: Full=Methionyl-tRNA synthetase;       
   10::658     2e-47  29%  677 aa  SYM_IDILO RecName: Full=Methionyl-tRNA synthetase;       
    5::676     2e-47  28%  676 aa  SYM_SHESA RecName: Full=Methionyl-tRNA synthetase;       
    9::682     2e-47  30%  682 aa  SYM_PSESM RecName: Full=Methionyl-tRNA synthetase;       
    5::676     3e-47  27%  676 aa  SYM_SHESM RecName: Full=Methionyl-tRNA synthetase;       
    5::673     3e-47  28%  673 aa  SYM_SHELP RecName: Full=Methionyl-tRNA synthetase;       
    1::681     3e-47  28%  685 aa  SYM_NEIMA RecName: Full=Methionyl-tRNA synthetase;       
    1::681     3e-47  29%  685 aa  SYM_NEIMB RecName: Full=Methionyl-tRNA synthetase;       
   13::523     3e-47  31%  553 aa  SYM_DEHSC RecName: Full=Methionyl-tRNA synthetase;       
    5::676     4e-47  28%  676 aa  SYM_SHESR RecName: Full=Methionyl-tRNA synthetase;       
   13::523     4e-47  31%  553 aa  SYM_DEHSB RecName: Full=Methionyl-tRNA synthetase;       
    1::680     6e-47  29%  684 aa  SYM_NEIG1 RecName: Full=Methionyl-tRNA synthetase;       
   11::715     6e-47  32%  715 aa  SYM_METMA RecName: Full=Methionyl-tRNA synthetase;       
    8::689     8e-47  28%  700 aa  SYM_PSYA2 RecName: Full=Methionyl-tRNA synthetase;       
    5::689     1e-46  28%  689 aa  SYM_SHESW RecName: Full=Methionyl-tRNA synthetase;       
    5::689     1e-46  28%  689 aa  SYM_SHEPC RecName: Full=Methionyl-tRNA synthetase;       
    5::676     1e-46  27%  676 aa  SYM_SHEON RecName: Full=Methionyl-tRNA synthetase;       
    1::674     1e-46  28%  674 aa  SYM_FRATO RecName: Full=Methionyl-tRNA synthetase;       
    1::626     2e-46  27%  690 aa  SYM_PICTO RecName: Full=Methionyl-tRNA synthetase;       
   12::689     2e-46  28%  715 aa  SYM_LEPIC RecName: Full=Methionyl-tRNA synthetase;       
    1::674     2e-46  28%  674 aa  SYM_FRATH RecName: Full=Methionyl-tRNA synthetase;       
    1::674     2e-46  28%  674 aa  SYM_FRATF RecName: Full=Methionyl-tRNA synthetase;       
   13::526     2e-46  33%  600 aa  SYM_CHLSY RecName: Full=Methionyl-tRNA synthetase;       
   13::526     2e-46  33%  600 aa  SYM_CHLAA RecName: Full=Methionyl-tRNA synthetase;       
    4::722     2e-46  35%  722 aa  SYM_PYRAB RecName: Full=Methionyl-tRNA synthetase;       
    4::724     3e-46  35%  724 aa  SYM_PYRFU RecName: Full=Methionyl-tRNA synthetase;       
   12::689     3e-46  28%  715 aa  SYM_LEPIN RecName: Full=Methionyl-tRNA synthetase;       
   11::500     3e-46  30%  544 aa  SYM_BACWK RecName: Full=Methionyl-tRNA synthetase;       
    9::682     4e-46  30%  682 aa  SYM_PSEU2 RecName: Full=Methionyl-tRNA synthetase;       
    1::673     5e-46  29%  673 aa  SYM_FRATN RecName: Full=Methionyl-tRNA synthetase;       
    1::674     8e-46  29%  674 aa  SYM_FRATW RecName: Full=Methionyl-tRNA synthetase;       
    1::674     8e-46  29%  674 aa  SYM_FRATT RecName: Full=Methionyl-tRNA synthetase;       
    1::674     8e-46  29%  674 aa  SYM_FRAT1 RecName: Full=Methionyl-tRNA synthetase;       
   17::686     8e-46  30%  686 aa  SYM_ALCBS RecName: Full=Methionyl-tRNA synthetase;       
   11::502     8e-46  28%  540 aa  SYM1_ALKOO RecName: Full=Methionyl-tRNA synthetase 1;       
    1::681     1e-45  28%  685 aa  SYM_NEIMF RecName: Full=Methionyl-tRNA synthetase;       
   11::502     1e-45  30%  544 aa  SYM_BACC7 RecName: Full=Methionyl-tRNA synthetase;       
   11::502     1e-45  30%  544 aa  SYM2_BACCR RecName: Full=Methionyl-tRNA synthetase 2;       
    1::681     2e-45  28%  685 aa  SYM_NEIM0 RecName: Full=Methionyl-tRNA synthetase;       
    9::683     2e-45  27%  683 aa  SYM_PSEFS RecName: Full=Methionyl-tRNA synthetase;       
   11::502     2e-45  30%  544 aa  SYM_BACCQ RecName: Full=Methionyl-tRNA synthetase;       
   11::685     4e-45  33%  689 aa  SYM_CHRVO RecName: Full=Methionyl-tRNA synthetase;       
    5::523     5e-45  33%  571 aa  SYM_SULAC RecName: Full=Methionyl-tRNA synthetase;       
    1::671     9e-45  35%  672 aa  SYM_META3 RecName: Full=Methionyl-tRNA synthetase;       
   13::517     1e-44  31%  592 aa  SYM_ROSCS RecName: Full=Methionyl-tRNA synthetase;       
   13::523     1e-44  31%  553 aa  SYM_DEHE1 RecName: Full=Methionyl-tRNA synthetase;       
   11::502     1e-44  29%  544 aa  SYM1_BACHK RecName: Full=Methionyl-tRNA synthetase 1;       
   14::688     2e-44  31%  689 aa  SYM_HALSA RecName: Full=Methionyl-tRNA synthetase;       
   11::502     2e-44  29%  544 aa  SYM_BACC0 RecName: Full=Methionyl-tRNA synthetase;       
    8::517     3e-44  31%  593 aa  SYM_SACEN RecName: Full=Methionyl-tRNA synthetase;       
   11::502     3e-44  29%  544 aa  SYM_BACC3 RecName: Full=Methionyl-tRNA synthetase;       
   11::502     3e-44  29%  544 aa  SYM1_BACAH RecName: Full=Methionyl-tRNA synthetase 1;       
    3::653     3e-44  26%  673 aa  SYM_PSEHT RecName: Full=Methionyl-tRNA synthetase;       
   13::526     3e-44  32%  600 aa  SYM_CHLAD RecName: Full=Methionyl-tRNA synthetase;       
   11::502     5e-44  29%  544 aa  SYM_BACAC RecName: Full=Methionyl-tRNA synthetase;       
   11::502     5e-44  29%  544 aa  SYM_BACAA RecName: Full=Methionyl-tRNA synthetase;       
   11::502     5e-44  29%  544 aa  SYM2_BACAN RecName: Full=Methionyl-tRNA synthetase 2;       
   11::502     6e-44  29%  544 aa  SYM1_BACC1 RecName: Full=Methionyl-tRNA synthetase 1;       
    9::675     1e-43  27%  679 aa  SYM_PSEU5 RecName: Full=Methionyl-tRNA synthetase;       
   11::502     1e-43  29%  544 aa  SYM_BACC2 RecName: Full=Methionyl-tRNA synthetase;       
   12::525     1e-43  30%  570 aa  SYM_PYRCJ RecName: Full=Methionyl-tRNA synthetase;       
   11::510     1e-43  33%  568 aa  SYM_METS5 RecName: Full=Methionyl-tRNA synthetase;       
   13::530     2e-43  31%  592 aa  SYM_ROSS1 RecName: Full=Methionyl-tRNA synthetase;       
    6::675     4e-43  27%  675 aa  SYM_YERE8 RecName: Full=Methionyl-tRNA synthetase;       
    6::675     4e-43  26%  675 aa  SYM_PHOLL RecName: Full=Methionyl-tRNA synthetase;       
   12::535     7e-43  31%  570 aa  SYM_PYRAE RecName: Full=Methionyl-tRNA synthetase;       
   12::537     9e-43  33%  561 aa  SYM_IGNH4 RecName: Full=Methionyl-tRNA synthetase;       
    9::677     9e-43  27%  681 aa  SYM_AZOVD RecName: Full=Methionyl-tRNA synthetase;       
    6::679     2e-42  29%  679 aa  SYM_SODGM RecName: Full=Methionyl-tRNA synthetase;       
    6::675     2e-42  26%  675 aa  SYM_SERP5 RecName: Full=Methionyl-tRNA synthetase;       
    6::710     2e-42  32%  711 aa  SYM_FLAJ1 RecName: Full=Methionyl-tRNA synthetase;       
    6::675     4e-42  27%  675 aa  SYM_YERPP RecName: Full=Methionyl-tRNA synthetase;       
    6::675     4e-42  27%  675 aa  SYM_YERPN RecName: Full=Methionyl-tRNA synthetase;       
    6::675     4e-42  27%  675 aa  SYM_YERPE RecName: Full=Methionyl-tRNA synthetase;       
    6::675     4e-42  27%  675 aa  SYM_YERPA RecName: Full=Methionyl-tRNA synthetase;       
    6::675     4e-42  27%  675 aa  SYM_YERP3 RecName: Full=Methionyl-tRNA synthetase;       
   17::540     4e-42  32%  565 aa  SYM_THEPD RecName: Full=Methionyl-tRNA synthetase;       
    6::675     6e-42  27%  675 aa  SYM_YERPB RecName: Full=Methionyl-tRNA synthetase;       
   12::508     6e-42  32%  565 aa  SYM_THENV RecName: Full=Methionyl-tRNA synthetase;       
    6::675     7e-42  27%  675 aa  SYM_YERPG RecName: Full=Methionyl-tRNA synthetase;       
   12::521     7e-42  31%  570 aa  SYM_PYRAR RecName: Full=Methionyl-tRNA synthetase;       
    5::689     9e-42  27%  689 aa  SYM_SHEB5 RecName: Full=Methionyl-tRNA synthetase;       
    6::675     2e-41  27%  675 aa  SYM_YERPY RecName: Full=Methionyl-tRNA synthetase;       
    6::675     2e-41  27%  675 aa  SYM_YERPS RecName: Full=Methionyl-tRNA synthetase;       
    5::689     2e-41  27%  689 aa  SYM_SHEB9 RecName: Full=Methionyl-tRNA synthetase;       
   12::533     2e-41  32%  614 aa  SYM_BEUC1 RecName: Full=Methionyl-tRNA synthetase;       
   13::525     3e-41  33%  610 aa  SYM_CORDI RecName: Full=Methionyl-tRNA synthetase;       
    5::524     8e-41  31%  573 aa  SYM_SULIM RecName: Full=Methionyl-tRNA synthetase;       
    1::654     8e-41  26%  726 aa  SYM_BORRA RecName: Full=Methionyl-tRNA synthetase;       
   15::526     1e-40  31%  606 aa  SYM_THEFY RecName: Full=Methionyl-tRNA synthetase;       
    1::654     1e-40  25%  726 aa  SYM_BORDL RecName: Full=Methionyl-tRNA synthetase;       
    5::689     2e-40  26%  689 aa  SYM_SHEB8 RecName: Full=Methionyl-tRNA synthetase;       
   11::502     2e-40  29%  544 aa  SYM_BACC4 RecName: Full=Methionyl-tRNA synthetase;       
    6::693     3e-40  27%  697 aa  SYM_PSYWF RecName: Full=Methionyl-tRNA synthetase;       
   12::510     4e-40  32%  567 aa  SYM_PYRIL RecName: Full=Methionyl-tRNA synthetase;       
   12::525     5e-40  31%  600 aa  SYM_KINRD RecName: Full=Methionyl-tRNA synthetase;       
    1::654     5e-40  26%  726 aa  SYM_BORT9 RecName: Full=Methionyl-tRNA synthetase;       
   15::657     7e-40  26%  736 aa  SYMC_DICDI RecName: Full=Probable methionyl-tRNA synthetase,
    5::687     9e-40  31%  710 aa  SYM_HERAR RecName: Full=Methionyl-tRNA synthetase;       
   14::527     3e-39  29%  577 aa  SYM_RUBXD RecName: Full=Methionyl-tRNA synthetase;       
    1::651     3e-39  28%  734 aa  SYM_BORBU RecName: Full=Methionyl-tRNA synthetase;       
    8::497     3e-39  30%  550 aa  SYM_CHLMU RecName: Full=Methionyl-tRNA synthetase;       
    1::655     4e-39  25%  724 aa  SYM_BORGA RecName: Full=Methionyl-tRNA synthetase;       
    1::651     4e-39  28%  734 aa  SYM_BORBZ RecName: Full=Methionyl-tRNA synthetase;       
   10::510     6e-39  28%  546 aa  SYM_COXB1 RecName: Full=Methionyl-tRNA synthetase;       
   10::510     8e-39  28%  546 aa  SYM_COXBU RecName: Full=Methionyl-tRNA synthetase;       
   10::510     8e-39  28%  546 aa  SYM_COXBR RecName: Full=Methionyl-tRNA synthetase;       
   10::510     8e-39  28%  546 aa  SYM_COXBN RecName: Full=Methionyl-tRNA synthetase;       
   22::705     1e-38  32%  725 aa  SYM_BURPS RecName: Full=Methionyl-tRNA synthetase;       
   22::705     1e-38  32%  725 aa  SYM_BURP6 RecName: Full=Methionyl-tRNA synthetase;       
   22::705     1e-38  32%  725 aa  SYM_BURP1 RecName: Full=Methionyl-tRNA synthetase;       
   22::705     1e-38  32%  725 aa  SYM_BURP0 RecName: Full=Methionyl-tRNA synthetase;       
   22::705     1e-38  32%  725 aa  SYM_BURMS RecName: Full=Methionyl-tRNA synthetase;       
   22::705     1e-38  32%  725 aa  SYM_BURMA RecName: Full=Methionyl-tRNA synthetase;       
   22::705     1e-38  32%  725 aa  SYM_BURM9 RecName: Full=Methionyl-tRNA synthetase;       
   22::705     1e-38  32%  725 aa  SYM_BURM7 RecName: Full=Methionyl-tRNA synthetase;       
   10::510     1e-38  28%  546 aa  SYM_COXB2 RecName: Full=Methionyl-tRNA synthetase;       
   14::717     2e-38  32%  717 aa  SYM_HALMA RecName: Full=Methionyl-tRNA synthetase;       
    8::497     2e-38  31%  550 aa  SYM_CHLTB RecName: Full=Methionyl-tRNA synthetase;       
    8::497     2e-38  31%  550 aa  SYM_CHLTA RecName: Full=Methionyl-tRNA synthetase;       
    8::497     2e-38  31%  550 aa  SYM_CHLT2 RecName: Full=Methionyl-tRNA synthetase;       
    5::524     2e-38  30%  573 aa  SYM_SULSO RecName: Full=Methionyl-tRNA synthetase;       
   11::490     2e-38  27%  545 aa  SYM_STRPS RecName: Full=Methionyl-tRNA synthetase;       
   11::490     2e-38  27%  545 aa  SYM_STRP7 RecName: Full=Methionyl-tRNA synthetase;       
    1::525     2e-38  31%  610 aa  SYM_CORGL RecName: Full=Methionyl-tRNA synthetase;       
    1::525     2e-38  31%  610 aa  SYM_CORGB RecName: Full=Methionyl-tRNA synthetase;       
    8::497     5e-38  31%  550 aa  SYM_CHLTR RecName: Full=Methionyl-tRNA synthetase;       
   22::698     5e-38  33%  718 aa  SYM_BURTA RecName: Full=Methionyl-tRNA synthetase;       
    1::655     5e-38  25%  724 aa  SYM_BORAP RecName: Full=Methionyl-tRNA synthetase;       
    4::534     5e-38  29%  572 aa  SYM_AERPE RecName: Full=Methionyl-tRNA synthetase;       
   12::542     6e-38  32%  600 aa  SYM_SALAI RecName: Full=Methionyl-tRNA synthetase;       
    7::703     6e-38  34%  703 aa  SYM_MYXXD RecName: Full=Methionyl-tRNA synthetase;       
    8::665     6e-38  32%  688 aa  SYM_CUPTR RecName: Full=Methionyl-tRNA synthetase;       
   25::544     8e-38  29%  582 aa  SYM_CALMQ RecName: Full=Methionyl-tRNA synthetase;       
    5::680     1e-37  31%  700 aa  SYM_JANMA RecName: Full=Methionyl-tRNA synthetase;       
   15::545     2e-37  32%  603 aa  SYM_SALTO RecName: Full=Methionyl-tRNA synthetase;       
   22::691     2e-37  33%  718 aa  SYM_BURCJ RecName: Full=Methionyl-tRNA synthetase;       
   22::691     2e-37  33%  718 aa  SYM_BURCH RecName: Full=Methionyl-tRNA synthetase;       
   22::689     2e-37  33%  716 aa  SYM_BURCC RecName: Full=Methionyl-tRNA synthetase;       
   22::691     2e-37  33%  718 aa  SYM_BURCA RecName: Full=Methionyl-tRNA synthetase;       
    6::496     3e-37  27%  545 aa  SYM_HAMD5 RecName: Full=Methionyl-tRNA synthetase;       
   17::693     7e-37  33%  720 aa  SYM_BURS3 RecName: Full=Methionyl-tRNA synthetase;       
   22::695     9e-37  32%  722 aa  SYM_BURM1 RecName: Full=Methionyl-tRNA synthetase;       
   22::700     9e-37  34%  720 aa  SYM_BURA4 RecName: Full=Methionyl-tRNA synthetase;       
    6::686     2e-36  30%  686 aa  SYM_MAGSM RecName: Full=Methionyl-tRNA synthetase;       
   22::700     2e-36  34%  720 aa  SYM_BURCM RecName: Full=Methionyl-tRNA synthetase;       
    6::677     5e-36  30%  677 aa  SYM_ENTS8 RecName: Full=Methionyl-tRNA synthetase;       
   12::538     5e-36  32%  620 aa  SYM_BIFAA RecName: Full=Methionyl-tRNA synthetase;       
    7::686     5e-36  32%  706 aa  SYM_ACIAC RecName: Full=Methionyl-tRNA synthetase;       
   22::701     6e-36  31%  721 aa  SYM_BURVG RecName: Full=Methionyl-tRNA synthetase;       
   12::523     1e-35  31%  623 aa  SYM_BIFA0 RecName: Full=Methionyl-tRNA synthetase;       
    6::677     2e-35  31%  677 aa  SYM_CITK8 RecName: Full=Methionyl-tRNA synthetase;       
    1::673     3e-35  31%  696 aa  SYM_XANCP RecName: Full=Methionyl-tRNA synthetase;       
    1::670     3e-35  31%  694 aa  SYM_XANCB RecName: Full=Methionyl-tRNA synthetase;       
    1::673     3e-35  31%  696 aa  SYM_XANC8 RecName: Full=Methionyl-tRNA synthetase;       
    1::699     3e-35  31%  723 aa  SYM_AZOSB RecName: Full=Methionyl-tRNA synthetase;       
   22::532     9e-35  29%  601 aa  SYM_PROAC RecName: Full=Methionyl-tRNA synthetase;       
    1::668     1e-34  31%  694 aa  SYM_XANOR RecName: Full=Methionyl-tRNA synthetase;       
    1::668     1e-34  31%  694 aa  SYM_XANOP RecName: Full=Methionyl-tRNA synthetase;       
    1::668     1e-34  31%  694 aa  SYM_XANOM RecName: Full=Methionyl-tRNA synthetase;       
    3::514     1e-34  29%  558 aa  SYM1_ACAM1 RecName: Full=Methionyl-tRNA synthetase 1;       
    1::668     1e-34  31%  694 aa  SYM_XANAC RecName: Full=Methionyl-tRNA synthetase;       
    1::666     2e-34  31%  692 aa  SYM_STRMK RecName: Full=Methionyl-tRNA synthetase;       
    9::683     2e-34  29%  683 aa  SYM_PSEPF RecName: Full=Methionyl-tRNA synthetase;       
    6::677     2e-34  30%  677 aa  SYM_ENT38 RecName: Full=Methionyl-tRNA synthetase;       
   13::527     2e-34  29%  612 aa  SYM_CORJK RecName: Full=Methionyl-tRNA synthetase;       
    1::668     3e-34  30%  694 aa  SYM_XANC5 RecName: Full=Methionyl-tRNA synthetase;       
    6::727     3e-34  31%  793 aa  SYM_TREDE RecName: Full=Methionyl-tRNA synthetase;       
    8::507     3e-34  28%  547 aa  SYM_THEAC RecName: Full=Methionyl-tRNA synthetase;       
    9::528     4e-34  31%  579 aa  SYM_HYPNA RecName: Full=Methionyl-tRNA synthetase;       
  261::777     4e-34  28%  905 aa  SYMC_XENLA RecName: Full=Methionyl-tRNA synthetase, cytoplasmic;   
    4::528     6e-34  28%  613 aa  SYM_COREF RecName: Full=Methionyl-tRNA synthetase;       
   18::702     7e-34  32%  702 aa  SYM_XYLFA RecName: Full=Methionyl-tRNA synthetase;       
   21::726     7e-34  32%  797 aa  SYM_ARATH RecName: Full=Probable methionyl-tRNA synthetase;        
   18::702     1e-33  32%  702 aa  SYM_XYLFT RecName: Full=Methionyl-tRNA synthetase;       
   18::702     1e-33  32%  702 aa  SYM_XYLF2 RecName: Full=Methionyl-tRNA synthetase;       
   13::525     1e-33  30%  611 aa  SYM_CORU7 RecName: Full=Methionyl-tRNA synthetase;       
   18::702     2e-33  32%  702 aa  SYM_XYLFM RecName: Full=Methionyl-tRNA synthetase;       
    9::681     2e-33  29%  681 aa  SYM_PSEF5 RecName: Full=Methionyl-tRNA synthetase;       
    7::510     2e-33  29%  551 aa  SYM_CHLFF RecName: Full=Methionyl-tRNA synthetase;       
    7::509     2e-33  29%  550 aa  SYM_CHLCV RecName: Full=Methionyl-tRNA synthetase;       
  265::775     2e-33  28%  902 aa  SYMC_MOUSE RecName: Full=Methionyl-tRNA synthetase, cytoplasmic;   
   12::549     3e-33  31%  595 aa  SYM_NOCSJ RecName: Full=Methionyl-tRNA synthetase;       
   20::730     4e-33  32%  801 aa  SYM_ORYSJ RecName: Full=Probable methionyl-tRNA synthetase;        
    1::498     4e-33  30%  551 aa  SYM_CHLPN RecName: Full=Methionyl-tRNA synthetase;       
   12::548     6e-33  31%  621 aa  SYM_BIFLI RecName: Full=Methionyl-tRNA synthetase;       
    1::667     8e-33  30%  693 aa  SYM_STRM5 RecName: Full=Methionyl-tRNA synthetase;       
   12::548     8e-33  31%  621 aa  SYM_BIFLO RecName: Full=Methionyl-tRNA synthetase;       
    8::728     1e-32  32%  728 aa  SYM_NITMU RecName: Full=Methionyl-tRNA synthetase;       
   26::694     1e-32  30%  713 aa  SYM_COLP3 RecName: Full=Methionyl-tRNA synthetase;       
    7::510     1e-32  31%  551 aa  SYM_CHLAB RecName: Full=Methionyl-tRNA synthetase;       
  263::773     1e-32  28%  898 aa  SYMC_BOVIN RecName: Full=Methionyl-tRNA synthetase, cytoplasmic;   
    2::686     1e-32  31%  690 aa  SYM1_SORC5 RecName: Full=Methionyl-tRNA synthetase 1;       
    6::747     1e-32  33%  811 aa  SYM_TREPA RecName: Full=Methionyl-tRNA synthetase;       
    8::706     3e-32  31%  706 aa  SYM_NITEU RecName: Full=Methionyl-tRNA synthetase;       
   10::518     3e-32  25%  547 aa  SYM_BUCAT RecName: Full=Methionyl-tRNA synthetase;       
   10::518     3e-32  25%  547 aa  SYM_BUCAI RecName: Full=Methionyl-tRNA synthetase;       
   10::518     3e-32  25%  547 aa  SYM_BUCA5 RecName: Full=Methionyl-tRNA synthetase;       
    9::679     9e-32  30%  679 aa  SYM_PSEA7 RecName: Full=Methionyl-tRNA synthetase;       
    1::696     1e-31  31%  718 aa  SYM_AZOSE RecName: Full=Methionyl-tRNA synthetase;       
    5::692     2e-31  30%  692 aa  SYM_SHESH RecName: Full=Methionyl-tRNA synthetase;       
    9::677     2e-31  29%  677 aa  SYM_PSEAE RecName: Full=Methionyl-tRNA synthetase;       
    9::678     2e-31  29%  678 aa  SYM_PSEAB RecName: Full=Methionyl-tRNA synthetase;       
    9::677     2e-31  29%  677 aa  SYM_PSEA8 RecName: Full=Methionyl-tRNA synthetase;       
    4::494     2e-31  25%  555 aa  SYM_BLOPB RecName: Full=Methionyl-tRNA synthetase;       
    8::701     2e-31  32%  701 aa  SYM_NITEC RecName: Full=Methionyl-tRNA synthetase;       
    5::678     4e-31  29%  683 aa  SYM_SHEFN RecName: Full=Methionyl-tRNA synthetase;       
    6::523     6e-31  31%  572 aa  SYM_MARMM RecName: Full=Methionyl-tRNA synthetase;       
   13::527     8e-31  29%  612 aa  SYM_CORK4 RecName: Full=Methionyl-tRNA synthetase;       
   31::717     1e-30  29%  741 aa  SYM_HALWD RecName: Full=Methionyl-tRNA synthetase;       
    5::689     1e-30  28%  689 aa  SYM_SHEDO RecName: Full=Methionyl-tRNA synthetase;       
   39::856     4e-30  29%  917 aa  SYMC_CAEEL RecName: Full=Methionyl-tRNA synthetase, cytoplasmic;   
    8::499     5e-30  25%  550 aa  SYM_RUTMC RecName: Full=Methionyl-tRNA synthetase;       
    6::525     6e-30  29%  573 aa  SYM_SILST RecName: Full=Methionyl-tRNA synthetase;       
  221::661     6e-30  29%  782 aa  SYMC_SCHPO RecName: Full=Probable methionyl-tRNA synthetase,
    8::511     8e-30  27%  543 aa  SYM_THEVO RecName: Full=Methionyl-tRNA synthetase;       
    6::526     2e-29  30%  572 aa  SYM_SILPO RecName: Full=Methionyl-tRNA synthetase;       
    5::689     2e-29  28%  689 aa  SYM_SHEB2 RecName: Full=Methionyl-tRNA synthetase;       
    6::525     1e-28  29%  574 aa  SYM_STRAW RecName: Full=Methionyl-tRNA synthetase;       
    6::525     8e-28  28%  572 aa  SYM_RHOS4 RecName: Full=Methionyl-tRNA synthetase;       
    6::525     8e-28  28%  572 aa  SYM_RHOS1 RecName: Full=Methionyl-tRNA synthetase;       
    6::522     2e-27  27%  572 aa  SYM_RHOS5 RecName: Full=Methionyl-tRNA synthetase;       
    1::508     2e-27  25%  545 aa  SYM_BUCBP RecName: Full=Methionyl-tRNA synthetase;       
  263::773     2e-27  27%  900 aa  SYMC_HUMAN RecName: Full=Methionyl-tRNA synthetase, cytoplasmic;   
  195::717     5e-27  27%  751 aa  SYMC_YEAST RecName: Full=Methionyl-tRNA synthetase, cytoplasmic;   
    9::513     7e-27  28%  570 aa  SYM_JANSC RecName: Full=Methionyl-tRNA synthetase;       
    1::646     2e-26  27%  729 aa  SYM_BORHD RecName: Full=Methionyl-tRNA synthetase;       
    6::525     3e-26  27%  572 aa  SYM_RHOSK RecName: Full=Methionyl-tRNA synthetase;       
    6::521     3e-26  27%  572 aa  SYM_DINSH RecName: Full=Methionyl-tRNA synthetase;       
    5::537     1e-25  31%  776 aa  SYM_NANEQ RecName: Full=Methionyl-tRNA synthetase;       
    5::497     4e-25  26%  550 aa  SYM_WIGBR RecName: Full=Methionyl-tRNA synthetase;       
    6::511     4e-25  28%  572 aa  SYM_PARDP RecName: Full=Methionyl-tRNA synthetase;       
   10::509     6e-25  23%  547 aa  SYM_BAUCH RecName: Full=Methionyl-tRNA synthetase;       
    6::519     1e-24  28%  569 aa  SYM_CAUSK RecName: Full=Methionyl-tRNA synthetase;       
    8::507     2e-24  23%  545 aa  SYM_VESOH RecName: Full=Methionyl-tRNA synthetase;       
    6::519     2e-24  28%  569 aa  SYM_CAUCR RecName: Full=Methionyl-tRNA synthetase;       
    6::519     2e-24  28%  569 aa  SYM_CAUCN RecName: Full=Methionyl-tRNA synthetase;       
    6::495     4e-24  22%  545 aa  SYM_BUCAP RecName: Full=Methionyl-tRNA synthetase;       
    6::522     5e-24  27%  572 aa  SYM_ROSDO RecName: Full=Methionyl-tRNA synthetase;       
    1::468     1e-23  27%  550 aa  SYM_MIMIV RecName: Full=Methionyl-tRNA synthetase;       
    4::496     3e-23  23%  545 aa  SYM_BLOFL RecName: Full=Methionyl-tRNA synthetase;       
  367::449     1e-16  49%  529 aa  SYYC_DANRE RecName: Full=Tyrosyl-tRNA synthetase, cytoplasmic;     
  365::442     1e-16  49%  527 aa  SYYC_CHICK RecName: Full=Tyrosyl-tRNA synthetase, cytoplasmic;     
    4::109     1e-16  37%  110 aa  YGJH_ECOLI RecName: Full=tRNA-binding protein ygjH;
  364::448     2e-16  49%  528 aa  SYYC_XENTR RecName: Full=Tyrosyl-tRNA synthetase, cytoplasmic;     
  366::443     2e-16  48%  528 aa  SYYC_RAT RecName: Full=Tyrosyl-tRNA synthetase, cytoplasmic;       
  366::443     2e-16  48%  528 aa  SYYC_PONAB RecName: Full=Tyrosyl-tRNA synthetase, cytoplasmic;     
  366::443     2e-16  48%  528 aa  SYYC_MOUSE RecName: Full=Tyrosyl-tRNA synthetase, cytoplasmic;     
  366::443     2e-16  48%  528 aa  SYYC_HUMAN RecName: Full=Tyrosyl-tRNA synthetase, cytoplasmic;     
  366::443     7e-16  47%  528 aa  SYYC_BOVIN RecName: Full=Tyrosyl-tRNA synthetase, cytoplasmic;     
  364::448     9e-16  48%  528 aa  SYYC_XENLA RecName: Full=Tyrosyl-tRNA synthetase, cytoplasmic;     
   41::89      4e-15  35%  894 aa  SYV_BDEBA RecName: Full=Valyl-tRNA synthetase;       
   50::193     1e-14  31%  874 aa  SYV_STRCO RecName: Full=Valyl-tRNA synthetase;       
   38::193     1e-14  30%  881 aa  SYV_CLOAB RecName: Full=Valyl-tRNA synthetase;       
   38::86      1e-14  34%  878 aa  SYV_CARHZ RecName: Full=Valyl-tRNA synthetase;       
   61::108     1e-14  32%  927 aa  SYI_SYNWW RecName: Full=Isoleucyl-tRNA synthetase;       
  151::248     1e-14  37%  312 aa  AIMP1_HUMAN RecName: Full=Aminoacyl tRNA synthetase
  149::246     2e-14  38%  310 aa  AIMP1_MOUSE RecName: Full=Aminoacyl tRNA synthetase
   50::193     2e-14  32%  874 aa  SYV_STRAW RecName: Full=Valyl-tRNA synthetase;       
   39::192     3e-14  29%  877 aa  SYV_METTH RecName: Full=Valyl-tRNA synthetase;       
  198::295     3e-14  36%  359 aa  AIMP1_CRIGR RecName: Full=Aminoacyl tRNA synthetase
   37::174     6e-14  31%  883 aa  SYV_STRT2 RecName: Full=Valyl-tRNA synthetase;       
   37::174     6e-14  31%  883 aa  SYV_STRT1 RecName: Full=Valyl-tRNA synthetase;       
   41::91      6e-14  37%  883 aa  SYV_LACCA RecName: Full=Valyl-tRNA synthetase;       
  518::759     6e-14  31% 1044 aa  SYI_METTH RecName: Full=Isoleucyl-tRNA synthetase;       
   31::135     1e-13  33%  839 aa  SYV_MYCMO RecName: Full=Valyl-tRNA synthetase;       
   42::177     1e-13  32%  880 aa  SYV_BACSU RecName: Full=Valyl-tRNA synthetase;       
   37::174     1e-13  34%  883 aa  SYV_STRA5 RecName: Full=Valyl-tRNA synthetase;       
   37::174     1e-13  34%  884 aa  SYV_STRA3 RecName: Full=Valyl-tRNA synthetase;       
   37::174     1e-13  34%  884 aa  SYV_STRA1 RecName: Full=Valyl-tRNA synthetase;       
  365::719     2e-13  27%  862 aa  SYV_THETH RecName: Full=Valyl-tRNA synthetase;       
  365::719     2e-13  27%  862 aa  SYV_THET8 RecName: Full=Valyl-tRNA synthetase;       
   37::174     2e-13  32%  883 aa  SYV_STRR6 RecName: Full=Valyl-tRNA synthetase;       
   37::174     2e-13  34%  883 aa  SYV_STRPN RecName: Full=Valyl-tRNA synthetase;       
   38::193     2e-13  29%  880 aa  SYV_CLOTE RecName: Full=Valyl-tRNA synthetase;       
   37::174     2e-13  32%  883 aa  SYV_STRMU RecName: Full=Valyl-tRNA synthetase;       
   38::173     2e-13  32%  879 aa  SYV_LACJO RecName: Full=Valyl-tRNA synthetase;       
  526::782     2e-13  31%  938 aa  SYI_SYMTH RecName: Full=Isoleucyl-tRNA synthetase;       
  531::772     2e-13  29% 1061 aa  SYI_NATPD RecName: Full=Isoleucyl-tRNA synthetase;       
   35::191     3e-13  29%  879 aa  SYV_THETN RecName: Full=Valyl-tRNA synthetase;       
   36::173     3e-13  33%  882 aa  SYV_STRP8 RecName: Full=Valyl-tRNA synthetase;       
   36::173     3e-13  33%  882 aa  SYV_STRP3 RecName: Full=Valyl-tRNA synthetase;       
   36::173     3e-13  33%  882 aa  SYV_STRP1 RecName: Full=Valyl-tRNA synthetase;       
   35::189     3e-13  31%  855 aa  SYV_SOLUE RecName: Full=Valyl-tRNA synthetase;       
   39::177     3e-13  32%  880 aa  SYV_GEOKA RecName: Full=Valyl-tRNA synthetase;       
   39::176     3e-13  35%  880 aa  SYV_ENTFA RecName: Full=Valyl-tRNA synthetase;       
  453::569     3e-13  35%  884 aa  SYV_DESVH RecName: Full=Valyl-tRNA synthetase;       
   42::177     3e-13  31%  880 aa  SYV_BACLD RecName: Full=Valyl-tRNA synthetase;       
   60::100     3e-13  31%  897 aa  SYI_MYCS5 RecName: Full=Isoleucyl-tRNA synthetase;       
  450::743     4e-13  32%  896 aa  SYV_SPHWW RecName: Full=Valyl-tRNA synthetase;       
  480::596     4e-13  36%  931 aa  SYV_SPHAL RecName: Full=Valyl-tRNA synthetase;       
  453::569     4e-13  33%  882 aa  SYV_LEPIN RecName: Full=Valyl-tRNA synthetase;       
  453::569     4e-13  33%  882 aa  SYV_LEPIC RecName: Full=Valyl-tRNA synthetase;       
   39::177     5e-13  30%  880 aa  SYV_BACST RecName: Full=Valyl-tRNA synthetase;       
   58::105     5e-13  33%  925 aa  SYI_CARHZ RecName: Full=Isoleucyl-tRNA synthetase;       
   69::118     7e-13  30%  831 aa  SYV_SULAC RecName: Full=Valyl-tRNA synthetase;       
   45::619     7e-13  31%  819 aa  SYL_DEIGD RecName: Full=Leucyl-tRNA synthetase;       
   41::620     7e-13  31%  804 aa  SYL_BACP2 RecName: Full=Leucyl-tRNA synthetase;       
  523::624     7e-13  39% 1049 aa  SYI_METTP RecName: Full=Isoleucyl-tRNA synthetase;       
   36::173     9e-13  33%  882 aa  SYV_STRPM RecName: Full=Valyl-tRNA synthetase;       
   36::173     9e-13  32%  882 aa  SYV_STRP6 RecName: Full=Valyl-tRNA synthetase;       
   39::176     9e-13  32%  882 aa  SYV_LACSS RecName: Full=Valyl-tRNA synthetase;       
  282::372     1e-12  40%  450 aa  YLF4_SCHPO RecName: Full=Uncharacterized tRNA-binding protein
  435::719     1e-12  30%  862 aa  SYV_THET2 RecName: Full=Valyl-tRNA synthetase;       
   42::177     1e-12  34%  881 aa  SYV_BACCZ RecName: Full=Valyl-tRNA synthetase;       
   42::177     1e-12  34%  881 aa  SYV_BACC1 RecName: Full=Valyl-tRNA synthetase;       
   34::127     2e-12  34%  876 aa  SYV_STAAR RecName: Full=Valyl-tRNA synthetase;       
   34::127     2e-12  35%  876 aa  SYV_STAAB RecName: Full=Valyl-tRNA synthetase;       
   40::178     2e-12  32%  882 aa  SYV_LISIN RecName: Full=Valyl-tRNA synthetase;       
   38::173     2e-12  31%  879 aa  SYV_LACAC RecName: Full=Valyl-tRNA synthetase;       
   41::729     2e-12  30%  804 aa  SYL_BACSK RecName: Full=Leucyl-tRNA synthetase;       
   34::127     2e-12  33%  876 aa  SYV_STAAW RecName: Full=Valyl-tRNA synthetase;       
   34::127     2e-12  33%  876 aa  SYV_STAAT RecName: Full=Valyl-tRNA synthetase;       
   34::127     2e-12  33%  876 aa  SYV_STAAS RecName: Full=Valyl-tRNA synthetase;       
   34::127     2e-12  33%  876 aa  SYV_STAAN RecName: Full=Valyl-tRNA synthetase;       
   34::127     2e-12  33%  876 aa  SYV_STAAM RecName: Full=Valyl-tRNA synthetase;       
   34::127     2e-12  33%  876 aa  SYV_STAAE RecName: Full=Valyl-tRNA synthetase;       
   34::127     2e-12  33%  876 aa  SYV_STAAC RecName: Full=Valyl-tRNA synthetase;       
   34::127     2e-12  33%  876 aa  SYV_STAA9 RecName: Full=Valyl-tRNA synthetase;       
   34::127     2e-12  33%  876 aa  SYV_STAA8 RecName: Full=Valyl-tRNA synthetase;       
   34::127     2e-12  33%  876 aa  SYV_STAA3 RecName: Full=Valyl-tRNA synthetase;       
   34::127     2e-12  33%  876 aa  SYV_STAA2 RecName: Full=Valyl-tRNA synthetase;       
   34::127     2e-12  33%  876 aa  SYV_STAA1 RecName: Full=Valyl-tRNA synthetase;       
   44::179     2e-12  31%  883 aa  SYV_LISMO RecName: Full=Valyl-tRNA synthetase;       
  312::561     2e-12  35%  880 aa  SYV_BACHD RecName: Full=Valyl-tRNA synthetase;       
   41::685     2e-12  28%  805 aa  SYL_LYSSC RecName: Full=Leucyl-tRNA synthetase;       
  518::619     2e-12  42% 1045 aa  SYI_METTM RecName: Full=Isoleucyl-tRNA synthetase;       
  516::656     2e-12  35%  938 aa  SYI_DESVV RecName: Full=Isoleucyl-tRNA synthetase;       
   59::200     2e-12  29%  938 aa  SYI_DESVM RecName: Full=Isoleucyl-tRNA synthetase;       
  516::656     2e-12  35%  938 aa  SYI_DESVH RecName: Full=Isoleucyl-tRNA synthetase;       
   39::193     3e-12  34%  913 aa  SYV_THEEB RecName: Full=Valyl-tRNA synthetase;       
   52::201     3e-12  31%  809 aa  SYV_SULTO RecName: Full=Valyl-tRNA synthetase;       
  309::564     3e-12  32%  880 aa  SYV_LACLA RecName: Full=Valyl-tRNA synthetase;       
   42::90      3e-12  35%  913 aa  SYV_DEIRA RecName: Full=Valyl-tRNA synthetase;       
   41::176     4e-12  32%  880 aa  SYV_BACSK RecName: Full=Valyl-tRNA synthetase;       
   42::177     4e-12  33%  881 aa  SYV_BACHK RecName: Full=Valyl-tRNA synthetase;       
   42::177     4e-12  33%  881 aa  SYV_BACCR RecName: Full=Valyl-tRNA synthetase;       
   42::177     4e-12  33%  881 aa  SYV_BACAN RecName: Full=Valyl-tRNA synthetase;       
   43::198     4e-12  28%  823 aa  SYV_AERPE RecName: Full=Valyl-tRNA synthetase;       
   35::659     4e-12  28%  859 aa  SYL_FUSNN RecName: Full=Leucyl-tRNA synthetase;       
   30::602     4e-12  31%  805 aa  SYL_BREBN RecName: Full=Leucyl-tRNA synthetase;       
   34::172     5e-12  33%  876 aa  SYV_STAS1 RecName: Full=Valyl-tRNA synthetase;       
   41::179     5e-12  31%  883 aa  SYV_LISMF RecName: Full=Valyl-tRNA synthetase;       
   33::602     5e-12  32%  805 aa  SYL_GEOSW RecName: Full=Leucyl-tRNA synthetase;       
   41::620     5e-12  30%  804 aa  SYL_BACSU RecName: Full=Leucyl-tRNA synthetase;       
   41::602     5e-12  31%  804 aa  SYL_BACLD RecName: Full=Leucyl-tRNA synthetase;       
   34::85      6e-12  34%  876 aa  SYV_STAHJ RecName: Full=Valyl-tRNA synthetase;       
   34::171     6e-12  28%  876 aa  SYV_STACT RecName: Full=Valyl-tRNA synthetase;       
   31::136     6e-12  28%  832 aa  SYV_MYCS5 RecName: Full=Valyl-tRNA synthetase;       
   34::172     6e-12  32%  875 aa  SYV_ANOFW RecName: Full=Valyl-tRNA synthetase;       
   30::602     6e-12  30%  804 aa  SYL_STAHJ RecName: Full=Leucyl-tRNA synthetase;       
   30::620     6e-12  29%  804 aa  SYL_STAES RecName: Full=Leucyl-tRNA synthetase;       
   30::620     6e-12  29%  804 aa  SYL_STAEQ RecName: Full=Leucyl-tRNA synthetase;       
   41::620     6e-12  30%  804 aa  SYL_BACA2 RecName: Full=Leucyl-tRNA synthetase;       
   58::202     6e-12  32%  930 aa  SYI_MOOTA RecName: Full=Isoleucyl-tRNA synthetase;       
   34::85      8e-12  34%  876 aa  SYV_STAES RecName: Full=Valyl-tRNA synthetase;       
   34::85      8e-12  34%  876 aa  SYV_STAEQ RecName: Full=Valyl-tRNA synthetase;       
  349::575     8e-12  33%  876 aa  SYV_MYCTU RecName: Full=Valyl-tRNA synthetase;       
  349::575     8e-12  33%  876 aa  SYV_MYCBO RecName: Full=Valyl-tRNA synthetase;       
   41::178     8e-12  32%  889 aa  SYV_LACPL RecName: Full=Valyl-tRNA synthetase;       
   37::192     8e-12  26%  880 aa  SYV_CLOPE RecName: Full=Valyl-tRNA synthetase;       
   41::602     8e-12  31%  805 aa  SYL_ANOFW RecName: Full=Leucyl-tRNA synthetase;       
  526::644     8e-12  37%  932 aa  SYI_THETN RecName: Full=Isoleucyl-tRNA synthetase;       
  459::577     8e-12  39%  986 aa  SYI_SULSO RecName: Full=Isoleucyl-tRNA synthetase;       
   50::114     8e-12  33% 1066 aa  SYI_PYRHO RecName: Full=Isoleucyl-tRNA synthetase;       
  612::678     8e-12  48% 1080 aa  SYI_METKA RecName: Full=Isoleucyl-tRNA synthetase;       
  518::619     8e-12  39% 1062 aa  SYI_METHJ RecName: Full=Isoleucyl-tRNA synthetase;       
  453::752     1e-11  33%  932 aa  SYV_CORJK RecName: Full=Valyl-tRNA synthetase;       
  518::619     1e-11  39% 1059 aa  SYI_METMJ RecName: Full=Isoleucyl-tRNA synthetase;       
  516::771     1e-11  28% 1036 aa  SYI_CHLMU RecName: Full=Isoleucyl-tRNA synthetase;       
  209::294     1e-11  39%  376 aa  G4P1_YEAST RecName: Full=GU4 nucleic-binding protein 1;       
   31::623     1e-11  29%  807 aa  SYL_STAAW RecName: Full=Leucyl-tRNA synthetase;       
   31::621     1e-11  29%  805 aa  SYL_STAAT RecName: Full=Leucyl-tRNA synthetase;       
   30::622     1e-11  29%  806 aa  SYL_STAAS RecName: Full=Leucyl-tRNA synthetase;       
   30::620     1e-11  29%  804 aa  SYL_STAAR RecName: Full=Leucyl-tRNA synthetase;       
   30::620     1e-11  29%  804 aa  SYL_STAAN RecName: Full=Leucyl-tRNA synthetase;       
   30::620     1e-11  29%  804 aa  SYL_STAAM RecName: Full=Leucyl-tRNA synthetase;       
   31::621     1e-11  29%  805 aa  SYL_STAAE RecName: Full=Leucyl-tRNA synthetase;       
   31::621     1e-11  29%  805 aa  SYL_STAAC RecName: Full=Leucyl-tRNA synthetase;       
   30::620     1e-11  29%  804 aa  SYL_STAAB RecName: Full=Leucyl-tRNA synthetase;       
   31::621     1e-11  29%  805 aa  SYL_STAA9 RecName: Full=Leucyl-tRNA synthetase;       
   31::621     1e-11  29%  805 aa  SYL_STAA8 RecName: Full=Leucyl-tRNA synthetase;       
   31::621     1e-11  29%  805 aa  SYL_STAA3 RecName: Full=Leucyl-tRNA synthetase;       
   31::621     1e-11  29%  805 aa  SYL_STAA2 RecName: Full=Leucyl-tRNA synthetase;       
   30::620     1e-11  29%  804 aa  SYL_STAA1 RecName: Full=Leucyl-tRNA synthetase;       
   40::210     1e-11  26%  801 aa  SYL_MESFL RecName: Full=Leucyl-tRNA synthetase;       
   35::743     1e-11  26%  813 aa  SYL_DEHE1 RecName: Full=Leucyl-tRNA synthetase;       
   33::748     1e-11  28%  824 aa  SYL_ALKMQ RecName: Full=Leucyl-tRNA synthetase;       
  549::653     1e-11  37% 1065 aa  SYI_PYRKO RecName: Full=Isoleucyl-tRNA synthetase;       
   50::114     1e-11  33% 1066 aa  SYI_PYRFU RecName: Full=Isoleucyl-tRNA synthetase;       
   53::131     2e-11  30%  899 aa  SYV_PELCD RecName: Full=Valyl-tRNA synthetase;       
   37::191     2e-11  34%  897 aa  SYV_GLOVI RecName: Full=Valyl-tRNA synthetase;       
   43::199     2e-11  29%  819 aa  SYL_THETN RecName: Full=Leucyl-tRNA synthetase;       
   35::743     2e-11  26%  813 aa  SYL_DEHSC RecName: Full=Leucyl-tRNA synthetase;       
   35::743     2e-11  26%  813 aa  SYL_DEHSB RecName: Full=Leucyl-tRNA synthetase;       
  470::647     2e-11  31% 1074 aa  SYI_HALMA RecName: Full=Isoleucyl-tRNA synthetase;       
   60::120     2e-11  31%  956 aa  SYV_TREPA RecName: Full=Valyl-tRNA synthetase;       
   39::191     2e-11  32%  910 aa  SYV_SYNY3 RecName: Full=Valyl-tRNA synthetase;       
  468::754     2e-11  28%  918 aa  SYV_PROMP RecName: Full=Valyl-tRNA synthetase;       
   34::116     2e-11  34% 1165 aa  SYV_AQUAE RecName: Full=Valyl-tRNA synthetase;       
   40::639     2e-11  30%  822 aa  SYL_SULDN RecName: Full=Leucyl-tRNA synthetase;       
   48::195     2e-11  29%  805 aa  SYL_PELLD RecName: Full=Leucyl-tRNA synthetase;       
   31::203     2e-11  25%  812 aa  SYL_CLONN RecName: Full=Leucyl-tRNA synthetase;       
  533::642     2e-11  37% 1059 aa  SYI_HALWD RecName: Full=Isoleucyl-tRNA synthetase;       
  470::579     3e-11  40%  909 aa  SYV_SYNP6 RecName: Full=Valyl-tRNA synthetase;       
   46::94      3e-11  34%  911 aa  SYV_SYMTH RecName: Full=Valyl-tRNA synthetase;       
   30::602     3e-11  30%  804 aa  SYL_STAS1 RecName: Full=Leucyl-tRNA synthetase;       
   29::194     3e-11  27%  804 aa  SYL_MYCMS RecName: Full=Leucyl-tRNA synthetase;       
   33::730     3e-11  31%  805 aa  SYL_GEOTN RecName: Full=Leucyl-tRNA synthetase;       
   33::730     3e-11  31%  805 aa  SYL_GEOKA RecName: Full=Leucyl-tRNA synthetase;       
   31::759     3e-11  28%  819 aa  SYL_FERNB RecName: Full=Leucyl-tRNA synthetase;       
  523::776     3e-11  29% 1058 aa  SYI_METBU RecName: Full=Isoleucyl-tRNA synthetase;       
  523::638     3e-11  34% 1058 aa  SYI_METBF RecName: Full=Isoleucyl-tRNA synthetase;       
  550::656     3e-11  41% 1084 aa  SYI_CHLTE RecName: Full=Isoleucyl-tRNA synthetase;       
  397::707     4e-11  32%  884 aa  SYV_ZYMMO RecName: Full=Valyl-tRNA synthetase;       
   40::88      4e-11  33%  914 aa  SYV_METKA RecName: Full=Valyl-tRNA synthetase;       
  311::711     4e-11  29%  873 aa  SYV_MESFL RecName: Full=Valyl-tRNA synthetase;       
   47::727     4e-11  28%  804 aa  SYL_LACDB RecName: Full=Leucyl-tRNA synthetase;       
   47::727     4e-11  28%  804 aa  SYL_LACDA RecName: Full=Leucyl-tRNA synthetase;       
   33::622     4e-11  31%  817 aa  SYL_CALS8 RecName: Full=Leucyl-tRNA synthetase;       
   31::696     4e-11  28%  806 aa  SYL_BACHD RecName: Full=Leucyl-tRNA synthetase;       
   45::180     5e-11  33%  883 aa  SYV_OCEIH RecName: Full=Valyl-tRNA synthetase;       
   31::135     5e-11  30%  822 aa  SYV_MYCH2 RecName: Full=Valyl-tRNA synthetase;       
   40::118     5e-11  29%  887 aa  SYV_GEOSL RecName: Full=Valyl-tRNA synthetase;       
   28::194     5e-11  29%  807 aa  SYL_MYCPU RecName: Full=Leucyl-tRNA synthetase;       
   35::764     5e-11  29%  829 aa  SYL_MOOTA RecName: Full=Leucyl-tRNA synthetase;       
   29::600     5e-11  31%  802 aa  SYL_MACCJ RecName: Full=Leucyl-tRNA synthetase;       
   34::625     5e-11  27%  802 aa  SYL_ALKOO RecName: Full=Leucyl-tRNA synthetase;       
   58::199     5e-11  30%  932 aa  SYI_THEPX RecName: Full=Isoleucyl-tRNA synthetase;       
   58::199     5e-11  30%  932 aa  SYI_THEP3 RecName: Full=Isoleucyl-tRNA synthetase;       
   38::83      7e-11  36%  914 aa  SYV_SYNPX RecName: Full=Valyl-tRNA synthetase;       
   31::135     7e-11  30%  822 aa  SYV_MYCHJ RecName: Full=Valyl-tRNA synthetase;       
   31::135     7e-11  30%  822 aa  SYV_MYCH7 RecName: Full=Valyl-tRNA synthetase;       
  369::725     7e-11  32%  903 aa  SYV_CORGL RecName: Full=Valyl-tRNA synthetase;       
   40::194     7e-11  27%  804 aa  SYL_MYCCT RecName: Full=Leucyl-tRNA synthetase;       
   29::197     7e-11  24%  812 aa  SYL_CLOTE RecName: Full=Leucyl-tRNA synthetase;       
  528::642     7e-11  36%  939 aa  SYI_SULSY RecName: Full=Isoleucyl-tRNA synthetase;       
  533::800     7e-11  29%  947 aa  SYI_PERMH RecName: Full=Isoleucyl-tRNA synthetase;       
   59::200     7e-11  31%  937 aa  SYI_LAWIP RecName: Full=Isoleucyl-tRNA synthetase;       
   36::174     9e-11  34%  891 aa  SYV_PYRHO RecName: Full=Valyl-tRNA synthetase;       
   32::777     9e-11  29%  862 aa  SYL_SYNAS RecName: Full=Leucyl-tRNA synthetase;       
   41::726     9e-11  29%  802 aa  SYL_BACWK RecName: Full=Leucyl-tRNA synthetase;       
   39::90      9e-11  36% 1049 aa  SYI_SULIM RecName: Full=Isoleucyl-tRNA synthetase;       
   39::90      9e-11  36% 1049 aa  SYI_SULIA RecName: Full=Isoleucyl-tRNA synthetase;       
   50::114     9e-11  34% 1067 aa  SYI_PYRAB RecName: Full=Isoleucyl-tRNA synthetase;       
  557::678     9e-11  39%  968 aa  SYI_PROMM RecName: Full=Isoleucyl-tRNA synthetase;       
  490::651     9e-11  32%  927 aa  SYI_PELCD RecName: Full=Isoleucyl-tRNA synthetase;       
  516::756     9e-11  27% 1036 aa  SYI_CHLTR RecName: Full=Isoleucyl-tRNA synthetase;       
  516::756     9e-11  27% 1036 aa  SYI_CHLTA RecName: Full=Isoleucyl-tRNA synthetase;       
   31::82      1e-10  35%  875 aa  SYV_PELUB RecName: Full=Valyl-tRNA synthetase;       
   34::763     1e-10  28%  824 aa  SYL_THEMA RecName: Full=Leucyl-tRNA synthetase;       
   41::721     1e-10  27%  801 aa  SYL_EXIS2 RecName: Full=Leucyl-tRNA synthetase;       
   31::765     1e-10  30%  820 aa  SYL_CHLCV RecName: Full=Leucyl-tRNA synthetase;       
   41::684     1e-10  27%  802 aa  SYL_BACC2 RecName: Full=Leucyl-tRNA synthetase;       
  536::648     1e-10  35%  940 aa  SYI_MARMS RecName: Full=Isoleucyl-tRNA synthetase;       
  526::679     1e-10  33%  914 aa  SYI_LEPBL RecName: Full=Isoleucyl-tRNA synthetase;       
  526::679     1e-10  33%  914 aa  SYI_LEPBJ RecName: Full=Isoleucyl-tRNA synthetase;       
  529::651     1e-10  38%  924 aa  SYI_DICNV RecName: Full=Isoleucyl-tRNA synthetase;       
   59::99      1e-10  35%  938 aa  SYI_DESDA RecName: Full=Isoleucyl-tRNA synthetase;       
  516::756     1e-10  27% 1036 aa  SYI_CHLTB RecName: Full=Isoleucyl-tRNA synthetase;       
  516::756     1e-10  27% 1036 aa  SYI_CHLT2 RecName: Full=Isoleucyl-tRNA synthetase;       
   47::123     1e-10  47%  786 aa  SYFB_WOLSU RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
  469::586     1e-10  33%  811 aa  SYV_SPHEL RecName: Full=Valyl-tRNA synthetase;       
   36::86      1e-10  30%  987 aa  SYV_RHOSK RecName: Full=Valyl-tRNA synthetase;       
  451::573     1e-10  34%  873 aa  SYV_PARD8 RecName: Full=Valyl-tRNA synthetase;       
   24::176     1e-10  32%  751 aa  SYV_NANEQ RecName: Full=Valyl-tRNA synthetase;       
   30::197     1e-10  23%  816 aa  SYL_CLOPS RecName: Full=Leucyl-tRNA synthetase;       
   31::197     1e-10  23%  816 aa  SYL_CLOPE RecName: Full=Leucyl-tRNA synthetase;       
   31::194     1e-10  23%  816 aa  SYL_CLOP1 RecName: Full=Leucyl-tRNA synthetase;       
   41::726     1e-10  29%  802 aa  SYL_BACCN RecName: Full=Leucyl-tRNA synthetase;       
  466::678     1e-10  40%  968 aa  SYI_SYNS3 RecName: Full=Isoleucyl-tRNA synthetase;       
   59::200     1e-10  30%  934 aa  SYI_DESDG RecName: Full=Isoleucyl-tRNA synthetase;       
   58::199     1e-10  31%  930 aa  SYI_DESAP RecName: Full=Isoleucyl-tRNA synthetase;       
  521::655     1e-10  31%  937 aa  SYI_DESAD RecName: Full=Isoleucyl-tRNA synthetase;       
  481::817     1e-10  28% 1078 aa  SYI_DEIRA RecName: Full=Isoleucyl-tRNA synthetase;       
   79::127     2e-10  34%  842 aa  SYV_SULSO RecName: Full=Valyl-tRNA synthetase;       
   34::763     2e-10  29%  824 aa  SYL_THEP1 RecName: Full=Leucyl-tRNA synthetase;       
   41::684     2e-10  28%  802 aa  SYL_BACHK RecName: Full=Leucyl-tRNA synthetase;       
   41::684     2e-10  28%  802 aa  SYL_BACCZ RecName: Full=Leucyl-tRNA synthetase;       
   41::684     2e-10  27%  802 aa  SYL_BACCR RecName: Full=Leucyl-tRNA synthetase;       
   41::684     2e-10  27%  802 aa  SYL_BACCQ RecName: Full=Leucyl-tRNA synthetase;       
   41::684     2e-10  27%  802 aa  SYL_BACC7 RecName: Full=Leucyl-tRNA synthetase;       
   41::684     2e-10  27%  802 aa  SYL_BACC4 RecName: Full=Leucyl-tRNA synthetase;       
   41::684     2e-10  28%  802 aa  SYL_BACC3 RecName: Full=Leucyl-tRNA synthetase;       
   41::684     2e-10  27%  802 aa  SYL_BACC1 RecName: Full=Leucyl-tRNA synthetase;       
   41::684     2e-10  28%  802 aa  SYL_BACC0 RecName: Full=Leucyl-tRNA synthetase;       
   41::684     2e-10  28%  802 aa  SYL_BACAN RecName: Full=Leucyl-tRNA synthetase;       
   41::684     2e-10  28%  802 aa  SYL_BACAH RecName: Full=Leucyl-tRNA synthetase;       
   41::684     2e-10  28%  802 aa  SYL_BACAC RecName: Full=Leucyl-tRNA synthetase;       
   41::684     2e-10  28%  802 aa  SYL_BACAA RecName: Full=Leucyl-tRNA synthetase;       
  471::646     2e-10  29% 1070 aa  SYI_HALSA RecName: Full=Isoleucyl-tRNA synthetase;       
  578::777     2e-10  28% 1044 aa  SYI_BORT9 RecName: Full=Isoleucyl-tRNA synthetase;       
   27::404     2e-10  30%  476 aa  SYC_THEGJ RecName: Full=Cysteinyl-tRNA synthetase;       
   52::97      3e-10  38%  929 aa  SYV_PROMM RecName: Full=Valyl-tRNA synthetase;       
   31::167     3e-10  26%  827 aa  SYV_MYCPU RecName: Full=Valyl-tRNA synthetase;       
   31::624     3e-10  32%  823 aa  SYL_THEM4 RecName: Full=Leucyl-tRNA synthetase;       
   48::602     3e-10  30%  804 aa  SYL_OCEIH RecName: Full=Leucyl-tRNA synthetase;       
   35::753     3e-10  27%  827 aa  SYL_DESHY RecName: Full=Leucyl-tRNA synthetase;       
   35::753     3e-10  27%  827 aa  SYL_DESHD RecName: Full=Leucyl-tRNA synthetase;       
  521::642     3e-10  32% 1066 aa  SYI_METLZ RecName: Full=Isoleucyl-tRNA synthetase;       
  527::650     3e-10  36%  923 aa  SYI_GEOSL RecName: Full=Isoleucyl-tRNA synthetase;       
  536::657     3e-10  38%  955 aa  SYI_CYAP4 RecName: Full=Isoleucyl-tRNA synthetase;       
   36::174     3e-10  35%  891 aa  SYV_PYRFU RecName: Full=Valyl-tRNA synthetase;       
   36::174     3e-10  32%  891 aa  SYV_PYRAB RecName: Full=Valyl-tRNA synthetase;       
  358::584     3e-10  31%  882 aa  SYV_MYCPA RecName: Full=Valyl-tRNA synthetase;       
   41::193     3e-10  29%  887 aa  SYV_DESPS RecName: Full=Valyl-tRNA synthetase;       
  374::635     3e-10  33%  919 aa  SYV_CORDI RecName: Full=Valyl-tRNA synthetase;       
  454::578     3e-10  33%  901 aa  SYV_CHLTE RecName: Full=Valyl-tRNA synthetase;       
   36::84      3e-10  41%  863 aa  SYV_ARCFU RecName: Full=Valyl-tRNA synthetase;       
   45::616     3e-10  31%  817 aa  SYL_RUBXD RecName: Full=Leucyl-tRNA synthetase;       
   35::225     3e-10  29%  824 aa  SYL_GEOSL RecName: Full=Leucyl-tRNA synthetase;       
   29::210     3e-10  23%  811 aa  SYL_CLOK5 RecName: Full=Leucyl-tRNA synthetase;       
   41::207     3e-10  24%  819 aa  SYL_CHLTR RecName: Full=Leucyl-tRNA synthetase;       
   41::207     3e-10  24%  819 aa  SYL_CHLTA RecName: Full=Leucyl-tRNA synthetase;       
  578::777     3e-10  26% 1044 aa  SYI_BORHD RecName: Full=Isoleucyl-tRNA synthetase;       
   62::110     4e-10  35%  894 aa  SYV_WOLSU RecName: Full=Valyl-tRNA synthetase;       
   35::756     4e-10  28%  830 aa  SYL_HALOH RecName: Full=Leucyl-tRNA synthetase;       
   48::623     4e-10  29%  823 aa  SYL_DEIRA RecName: Full=Leucyl-tRNA synthetase;       
  572::686     4e-10  34% 1104 aa  SYI_UNCMA RecName: Full=Isoleucyl-tRNA synthetase;       
   36::87      4e-10  37% 1047 aa  SYI_SULTO RecName: Full=Isoleucyl-tRNA synthetase;       
  525::774     4e-10  29%  981 aa  SYI_PYRAE RecName: Full=Isoleucyl-tRNA synthetase;       
   52::102     4e-10  31%  888 aa  SYI_MYCPU RecName: Full=Isoleucyl-tRNA synthetase;       
  584::833     4e-10  25% 1110 aa  SYI_CYTH3 RecName: Full=Isoleucyl-tRNA synthetase;       
   36::183     6e-10  28%  888 aa  SYV_PYRKO RecName: Full=Valyl-tRNA synthetase;       
  492::613     6e-10  34%  952 aa  SYV_NITWN RecName: Full=Valyl-tRNA synthetase;       
   52::190     6e-10  33%  887 aa  SYV_FUSNN RecName: Full=Valyl-tRNA synthetase;       
  439::647     6e-10  33%  903 aa  SYV_COREF RecName: Full=Valyl-tRNA synthetase;       
   31::212     6e-10  26%  806 aa  SYL_UREU1 RecName: Full=Leucyl-tRNA synthetase;       
   31::206     6e-10  26%  820 aa  SYL_CHLFF RecName: Full=Leucyl-tRNA synthetase;       
  523::642     6e-10  31% 1058 aa  SYI_METAC RecName: Full=Isoleucyl-tRNA synthetase;       
   58::202     6e-10  30%  929 aa  SYI_HALOH RecName: Full=Isoleucyl-tRNA synthetase;       
   58::199     6e-10  33%  931 aa  SYI_DESRM RecName: Full=Isoleucyl-tRNA synthetase;       
  526::632     6e-10  35%  923 aa  SYI_BRAHW RecName: Full=Isoleucyl-tRNA synthetase;       
   33::702     7e-10  29%  829 aa  SYL_DESVV RecName: Full=Leucyl-tRNA synthetase;       
   33::702     7e-10  29%  829 aa  SYL_DESVH RecName: Full=Leucyl-tRNA synthetase;       
   30::763     7e-10  27%  825 aa  SYL_CLOTH RecName: Full=Leucyl-tRNA synthetase;       
   31::633     7e-10  27%  806 aa  SYL_CLOD6 RecName: Full=Leucyl-tRNA synthetase;       
   31::215     7e-10  26%  820 aa  SYL_CHLAB RecName: Full=Leucyl-tRNA synthetase;       
   36::86      1e-09  30%  987 aa  SYV_RHOS4 RecName: Full=Valyl-tRNA synthetase;       
   36::86      1e-09  30%  987 aa  SYV_RHOS1 RecName: Full=Valyl-tRNA synthetase;       
  458::568     1e-09  36%  876 aa  SYV_BACFR RecName: Full=Valyl-tRNA synthetase;       
  458::568     1e-09  36%  876 aa  SYV_BACFN RecName: Full=Valyl-tRNA synthetase;       
   41::207     1e-09  24%  819 aa  SYL_CHLTB RecName: Full=Leucyl-tRNA synthetase;       
   41::207     1e-09  24%  819 aa  SYL_CHLT2 RecName: Full=Leucyl-tRNA synthetase;       
   35::209     1e-09  27%  821 aa  SYL_CARHZ RecName: Full=Leucyl-tRNA synthetase;       
   59::99      1e-09  32%  900 aa  SYI_UREPA RecName: Full=Isoleucyl-tRNA synthetase;       
  519::639     1e-09  33%  900 aa  SYI_MYCPE RecName: Full=Isoleucyl-tRNA synthetase;       
  496::774     1e-09  27% 1043 aa  SYI_CHLPN RecName: Full=Isoleucyl-tRNA synthetase;       
   41::92      1e-09  32%  880 aa  SYV_DEHE1 RecName: Full=Valyl-tRNA synthetase;       
   39::755     1e-09  28%  827 aa  SYL_DESPS RecName: Full=Leucyl-tRNA synthetase;       
   42::221     1e-09  30%  289 aa  SYLB_AQUAE RecName: Full=Leucyl-tRNA synthetase subunit beta;      
  432::679     1e-09  35%  974 aa  SYI_SYNPX RecName: Full=Isoleucyl-tRNA synthetase;       
  517::711     1e-09  33%  954 aa  SYI_SYNP6 RecName: Full=Isoleucyl-tRNA synthetase;       
   69::109     1e-09  36%  965 aa  SYI_PROM5 RecName: Full=Isoleucyl-tRNA synthetase;       
  523::642     1e-09  30% 1058 aa  SYI_METMA RecName: Full=Isoleucyl-tRNA synthetase;       
   58::199     1e-09  31%  922 aa  SYI_DESHY RecName: Full=Isoleucyl-tRNA synthetase;       
   58::199     1e-09  31%  922 aa  SYI_DESHD RecName: Full=Isoleucyl-tRNA synthetase;       
  419::700     1e-09  32%  959 aa  SYI_CYAP7 RecName: Full=Isoleucyl-tRNA synthetase;       
  527::777     1e-09  25% 1042 aa  SYI_BORGA RecName: Full=Isoleucyl-tRNA synthetase;       
  365::559     2e-09  28%  865 aa  SYV_THEMA RecName: Full=Valyl-tRNA synthetase;       
   34::92      2e-09  43%  860 aa  SYV_SALTO RecName: Full=Valyl-tRNA synthetase;       
  459::574     2e-09  36%  876 aa  SYV_PORGI RecName: Full=Valyl-tRNA synthetase;       
  459::574     2e-09  36%  876 aa  SYV_PORG3 RecName: Full=Valyl-tRNA synthetase;       
  359::585     2e-09  31%  886 aa  SYV_MYCLE RecName: Full=Valyl-tRNA synthetase;       
   41::120     2e-09  34%  896 aa  SYV_GRABC RecName: Full=Valyl-tRNA synthetase;       
   33::134     2e-09  34%  920 aa  SYV_COXBU RecName: Full=Valyl-tRNA synthetase;       
   73::263     2e-09  25%  862 aa  SYL_RENSM RecName: Full=Leucyl-tRNA synthetase;       
   35::740     2e-09  27%  823 aa  SYL_PELPD RecName: Full=Leucyl-tRNA synthetase;       
   28::195     2e-09  32%  793 aa  SYL_MYCPN RecName: Full=Leucyl-tRNA synthetase;       
   34::628     2e-09  29%  809 aa  SYL_CAMLR RecName: Full=Leucyl-tRNA synthetase;       
   48::197     2e-09  27%  796 aa  SYL_BDEBA RecName: Full=Leucyl-tRNA synthetase;       
   45::197     2e-09  32%  909 aa  SYV_TREDE RecName: Full=Valyl-tRNA synthetase;       
   50::95      2e-09  38%  933 aa  SYV_PROMT RecName: Full=Valyl-tRNA synthetase;       
  351::702     2e-09  28%  837 aa  SYV_MYCGE RecName: Full=Valyl-tRNA synthetase;       
   39::96      2e-09  34%  862 aa  SYV_LEIXX RecName: Full=Valyl-tRNA synthetase;       
   42::94      2e-09  36% 1014 aa  SYV_ANASP RecName: Full=Valyl-tRNA synthetase;       
   36::632     2e-09  27%  861 aa  SYL_SYMTH RecName: Full=Leucyl-tRNA synthetase;       
   32::749     2e-09  28%  863 aa  SYL_SALRD RecName: Full=Leucyl-tRNA synthetase;       
   47::741     2e-09  28%  804 aa  SYL_LACAC RecName: Full=Leucyl-tRNA synthetase;       
   35::629     2e-09  29%  826 aa  SYL_DESAP RecName: Full=Leucyl-tRNA synthetase;       
   43::666     2e-09  28%  863 aa  SYL_DESAA RecName: Full=Leucyl-tRNA synthetase;       
  513::623     2e-09  34% 1043 aa  SYI_THET8 RecName: Full=Isoleucyl-tRNA synthetase;       
  513::623     2e-09  34% 1043 aa  SYI_THET2 RecName: Full=Isoleucyl-tRNA synthetase;       
   41::88      2e-09  36% 1076 aa  SYI_METB6 RecName: Full=Isoleucyl-tRNA synthetase;       
  407::607     3e-09  31%  958 aa  SYV_BRAJA RecName: Full=Valyl-tRNA synthetase;       
   31::225     3e-09  28%  824 aa  SYL_SYNWW RecName: Full=Leucyl-tRNA synthetase;       
   37::619     3e-09  30%  885 aa  SYL_HALSA RecName: Full=Leucyl-tRNA synthetase;       
   36::218     3e-09  26%  874 aa  SYL_AZOC5 RecName: Full=Leucyl-tRNA synthetase;       
  557::673     3e-09  33%  941 aa  SYI_ZYMMO RecName: Full=Isoleucyl-tRNA synthetase;       
  552::671     3e-09  31% 1091 aa  SYI_TREPS RecName: Full=Isoleucyl-tRNA synthetase;       
  552::671     3e-09  31% 1091 aa  SYI_TREPA RecName: Full=Isoleucyl-tRNA synthetase;       
   58::114     3e-09  28%  924 aa  SYI_GEOKA RecName: Full=Isoleucyl-tRNA synthetase;       
   47::147     3e-09  40%  792 aa  SYFB_PSEAE RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
  460::569     4e-09  37%  869 aa  SYV_MYCPE RecName: Full=Valyl-tRNA synthetase;       
   41::92      4e-09  33%  880 aa  SYV_DEHSC RecName: Full=Valyl-tRNA synthetase;       
  460::570     4e-09  34%  879 aa  SYV_BACTN RecName: Full=Valyl-tRNA synthetase;       
   35::225     4e-09  27%  824 aa  SYL_GEOMG RecName: Full=Leucyl-tRNA synthetase;       
   59::197     4e-09  30%  929 aa  SYI_NEIMA RecName: Full=Isoleucyl-tRNA synthetase;       
   58::114     4e-09  28%  924 aa  SYI_GEOTN RecName: Full=Isoleucyl-tRNA synthetase;       
   58::199     4e-09  31%  920 aa  SYI_CALS8 RecName: Full=Isoleucyl-tRNA synthetase;       
   58::199     4e-09  32%  920 aa  SYI_ANATD RecName: Full=Isoleucyl-tRNA synthetase;       
   47::147     4e-09  43%  790 aa  SYFB_HAHCH RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
  442::694     5e-09  28%  861 aa  SYV_THELT RecName: Full=Valyl-tRNA synthetase;       
   34::624     5e-09  29%  815 aa  SYL_THELT RecName: Full=Leucyl-tRNA synthetase;       
   31::736     5e-09  29%  845 aa  SYL_PARUW RecName: Full=Leucyl-tRNA synthetase;       
   47::741     5e-09  28%  804 aa  SYL_LACH4 RecName: Full=Leucyl-tRNA synthetase;       
   47::741     5e-09  28%  804 aa  SYL_LACGA RecName: Full=Leucyl-tRNA synthetase;       
   33::629     5e-09  28%  824 aa  SYL_GEOBB RecName: Full=Leucyl-tRNA synthetase;       
   33::749     5e-09  29%  829 aa  SYL_DESDG RecName: Full=Leucyl-tRNA synthetase;       
   34::777     5e-09  27%  842 aa  SYL_BORT9 RecName: Full=Leucyl-tRNA synthetase;       
  586::630     5e-09  56% 1072 aa  SYIC_YEAST RecName: Full=Isoleucyl-tRNA synthetase, cytoplasmic;   
   47::123     5e-09  40%  794 aa  SYFB_THETN RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   51::96      6e-09  34%  933 aa  SYV_PROMA RecName: Full=Valyl-tRNA synthetase;       
  475::590     6e-09  33%  910 aa  SYV_BRUSU RecName: Full=Valyl-tRNA synthetase;       
  475::590     6e-09  33%  910 aa  SYV_BRUME RecName: Full=Valyl-tRNA synthetase;       
   42::717     6e-09  29%  833 aa  SYL_STRU0 RecName: Full=Leucyl-tRNA synthetase;       
   48::601     6e-09  30%  803 aa  SYL_LACCB RecName: Full=Leucyl-tRNA synthetase;       
   48::601     6e-09  30%  803 aa  SYL_LACC3 RecName: Full=Leucyl-tRNA synthetase;       
   41::678     6e-09  28%  819 aa  SYL_CHLMU RecName: Full=Leucyl-tRNA synthetase;       
   58::231     6e-09  30%  919 aa  SYI_THEMA RecName: Full=Isoleucyl-tRNA synthetase;       
   69::109     6e-09  36%  965 aa  SYI_PROMP RecName: Full=Isoleucyl-tRNA synthetase;       
   58::184     6e-09  34%  925 aa  SYI_BREBN RecName: Full=Isoleucyl-tRNA synthetase;       
  580::646     6e-09  39% 1262 aa  SYIC_MOUSE RecName: Full=Isoleucyl-tRNA synthetase, cytoplasmic;   
   66::125     8e-09  38%  881 aa  SYV_THEFY RecName: Full=Valyl-tRNA synthetase;       
   36::115     8e-09  34%  906 aa  SYV_CAUCR RecName: Full=Valyl-tRNA synthetase;       
   35::225     8e-09  26%  858 aa  SYL_VIBSL RecName: Full=Leucyl-tRNA synthetase;       
   36::748     8e-09  28%  810 aa  SYL_SOLUE RecName: Full=Leucyl-tRNA synthetase;       
   33::199     8e-09  24%  867 aa  SYL_PHEZH RecName: Full=Leucyl-tRNA synthetase;       
  538::613     8e-09  37%  792 aa  SYL_MYCGE RecName: Full=Leucyl-tRNA synthetase;       
   30::619     8e-09  28%  807 aa  SYL_LACSS RecName: Full=Leucyl-tRNA synthetase;       
   47::741     8e-09  27%  804 aa  SYL_LACJO RecName: Full=Leucyl-tRNA synthetase;       
   33::629     8e-09  28%  824 aa  SYL_GEOSM RecName: Full=Leucyl-tRNA synthetase;       
   35::225     8e-09  29%  824 aa  SYL_GEOSF RecName: Full=Leucyl-tRNA synthetase;       
   48::726     8e-09  28%  804 aa  SYL_ENTFA RecName: Full=Leucyl-tRNA synthetase;       
   28::178     8e-09  29%  806 aa  SYL_CHLPB RecName: Full=Leucyl-tRNA synthetase;       
   58::231     8e-09  30%  919 aa  SYI_THEP1 RecName: Full=Isoleucyl-tRNA synthetase;       
   61::101     8e-09  36%  988 aa  SYI_SYNY3 RecName: Full=Isoleucyl-tRNA synthetase;       
  532::644     8e-09  34%  932 aa  SYI_SACD2 RecName: Full=Isoleucyl-tRNA synthetase;       
  594::752     8e-09  38%  993 aa  SYI_RHILO RecName: Full=Isoleucyl-tRNA synthetase;       
  536::649     8e-09  35%  929 aa  SYI_NEIMF RecName: Full=Isoleucyl-tRNA synthetase;       
   59::197     8e-09  30%  929 aa  SYI_NEIG2 RecName: Full=Isoleucyl-tRNA synthetase;       
   59::197     8e-09  30%  929 aa  SYI_NEIG1 RecName: Full=Isoleucyl-tRNA synthetase;       
  578::777     8e-09  26% 1042 aa  SYI_BORBZ RecName: Full=Isoleucyl-tRNA synthetase;       
  578::777     8e-09  26% 1042 aa  SYI_BORBU RecName: Full=Isoleucyl-tRNA synthetase;       
   58::98      8e-09  36%  922 aa  SYI_BACLD RecName: Full=Isoleucyl-tRNA synthetase;       
   58::109     8e-09  29%  921 aa  SYI_BACC4 RecName: Full=Isoleucyl-tRNA synthetase;       
   58::109     8e-09  29%  921 aa  SYI_BACC2 RecName: Full=Isoleucyl-tRNA synthetase;       
   58::113     8e-09  34%  896 aa  SYI_ACHLI RecName: Full=Isoleucyl-tRNA synthetase;       
  580::646     8e-09  39% 1262 aa  SYIC_HUMAN RecName: Full=Isoleucyl-tRNA synthetase, cytoplasmic;   
   58::109     8e-09  29%  921 aa  SYI1_BACCR RecName: Full=Isoleucyl-tRNA synthetase 1;       
   47::126     8e-09  42%  792 aa  SYFB_PSEU2 RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::126     8e-09  42%  792 aa  SYFB_PSESM RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::126     8e-09  42%  792 aa  SYFB_PSE14 RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   36::87      1e-08  39%  874 aa  SYV_UREPA RecName: Full=Valyl-tRNA synthetase;       
   31::212     1e-08  26%  806 aa  SYL_UREPA RecName: Full=Leucyl-tRNA synthetase;       
   31::212     1e-08  26%  806 aa  SYL_UREP2 RecName: Full=Leucyl-tRNA synthetase;       
   35::760     1e-08  25%  829 aa  SYL_SYNFM RecName: Full=Leucyl-tRNA synthetase;       
   42::717     1e-08  30%  833 aa  SYL_STRSV RecName: Full=Leucyl-tRNA synthetase;       
   42::717     1e-08  31%  833 aa  SYL_STRPS RecName: Full=Leucyl-tRNA synthetase;       
   41::725     1e-08  29%  803 aa  SYL_LISMF RecName: Full=Leucyl-tRNA synthetase;       
   41::725     1e-08  29%  803 aa  SYL_LISMC RecName: Full=Leucyl-tRNA synthetase;       
   32::116     1e-08  28%  847 aa  SYL_GLOVI RecName: Full=Leucyl-tRNA synthetase;       
   33::764     1e-08  26%  834 aa  SYL_DESVM RecName: Full=Leucyl-tRNA synthetase;       
   35::662     1e-08  25%  863 aa  SYL_DESAH RecName: Full=Leucyl-tRNA synthetase;       
   31::197     1e-08  24%  816 aa  SYL_CLOB8 RecName: Full=Leucyl-tRNA synthetase;       
   48::195     1e-08  28%  805 aa  SYL_CHLT3 RecName: Full=Leucyl-tRNA synthetase;       
   41::645     1e-08  28%  820 aa  SYL_CHLPN RecName: Full=Leucyl-tRNA synthetase;       
   30::654     1e-08  28%  853 aa  SYL_BRAHW RecName: Full=Leucyl-tRNA synthetase;       
   58::113     1e-08  31%  917 aa  SYI_STAAW RecName: Full=Isoleucyl-tRNA synthetase;       
   58::113     1e-08  31%  917 aa  SYI_STAAT RecName: Full=Isoleucyl-tRNA synthetase;       
   58::113     1e-08  31%  917 aa  SYI_STAAS RecName: Full=Isoleucyl-tRNA synthetase;       
   58::113     1e-08  31%  917 aa  SYI_STAAR RecName: Full=Isoleucyl-tRNA synthetase;       
   58::113     1e-08  31%  917 aa  SYI_STAAN RecName: Full=Isoleucyl-tRNA synthetase;       
   58::113     1e-08  31%  917 aa  SYI_STAAM RecName: Full=Isoleucyl-tRNA synthetase;       
   58::113     1e-08  31%  917 aa  SYI_STAAE RecName: Full=Isoleucyl-tRNA synthetase;       
   58::113     1e-08  31%  917 aa  SYI_STAAC RecName: Full=Isoleucyl-tRNA synthetase;       
   58::113     1e-08  31%  917 aa  SYI_STAAB RecName: Full=Isoleucyl-tRNA synthetase;       
   58::113     1e-08  31%  917 aa  SYI_STAA9 RecName: Full=Isoleucyl-tRNA synthetase;       
   58::113     1e-08  31%  917 aa  SYI_STAA8 RecName: Full=Isoleucyl-tRNA synthetase;       
   58::113     1e-08  31%  917 aa  SYI_STAA3 RecName: Full=Isoleucyl-tRNA synthetase;       
   58::113     1e-08  31%  917 aa  SYI_STAA2 RecName: Full=Isoleucyl-tRNA synthetase;       
   58::113     1e-08  31%  917 aa  SYI_STAA1 RecName: Full=Isoleucyl-tRNA synthetase;       
  526::643     1e-08  33%  914 aa  SYI_LEPIN RecName: Full=Isoleucyl-tRNA synthetase;       
  526::643     1e-08  33%  914 aa  SYI_LEPIC RecName: Full=Isoleucyl-tRNA synthetase;       
  541::766     1e-08  30%  944 aa  SYI_IDILO RecName: Full=Isoleucyl-tRNA synthetase;       
   45::203     1e-08  31% 1064 aa  SYI_AERPE RecName: Full=Isoleucyl-tRNA synthetase;       
  516::657     1e-08  35%  971 aa  SYI_ACAM1 RecName: Full=Isoleucyl-tRNA synthetase;       
   58::113     1e-08  31%  917 aa  SYI1_STAAU RecName: Full=Isoleucyl-tRNA synthetase;       
   32::133     1e-08  32%  855 aa  SYV_WOLTR RecName: Full=Valyl-tRNA synthetase;       
   50::177     1e-08  29%  878 aa  SYV_METJA RecName: Full=Valyl-tRNA synthetase;       
   45::143     1e-08  35%  823 aa  SYV_ANAMM RecName: Full=Valyl-tRNA synthetase;       
  452::569     1e-08  32%  877 aa  SYV_AMOA5 RecName: Full=Valyl-tRNA synthetase;       
   35::225     1e-08  25%  857 aa  SYL_VIBVU RecName: Full=Leucyl-tRNA synthetase;       
   35::775     1e-08  26%  857 aa  SYL_VIBPA RecName: Full=Leucyl-tRNA synthetase;       
   35::225     1e-08  25%  862 aa  SYL_VIBHB RecName: Full=Leucyl-tRNA synthetase;       
   42::717     1e-08  29%  833 aa  SYL_STRSY RecName: Full=Leucyl-tRNA synthetase;       
   42::717     1e-08  29%  833 aa  SYL_STRS7 RecName: Full=Leucyl-tRNA synthetase;       
   42::717     1e-08  29%  833 aa  SYL_STRS2 RecName: Full=Leucyl-tRNA synthetase;       
   42::717     1e-08  29%  833 aa  SYL_STRPZ RecName: Full=Leucyl-tRNA synthetase;       
   42::717     1e-08  29%  833 aa  SYL_STRPM RecName: Full=Leucyl-tRNA synthetase;       
   42::717     1e-08  29%  833 aa  SYL_STRPG RecName: Full=Leucyl-tRNA synthetase;       
   42::717     1e-08  29%  833 aa  SYL_STRPF RecName: Full=Leucyl-tRNA synthetase;       
   42::717     1e-08  29%  833 aa  SYL_STRPD RecName: Full=Leucyl-tRNA synthetase;       
   42::717     1e-08  29%  833 aa  SYL_STRPC RecName: Full=Leucyl-tRNA synthetase;       
   42::717     1e-08  29%  833 aa  SYL_STRPB RecName: Full=Leucyl-tRNA synthetase;       
   42::717     1e-08  31%  833 aa  SYL_STRP8 RecName: Full=Leucyl-tRNA synthetase;       
   42::717     1e-08  29%  833 aa  SYL_STRP6 RecName: Full=Leucyl-tRNA synthetase;       
   42::717     1e-08  30%  833 aa  SYL_STRGC RecName: Full=Leucyl-tRNA synthetase;       
   42::717     1e-08  29%  833 aa  SYL_STRA5 RecName: Full=Leucyl-tRNA synthetase;       
   42::717     1e-08  29%  833 aa  SYL_STRA3 RecName: Full=Leucyl-tRNA synthetase;       
   42::717     1e-08  29%  833 aa  SYL_STRA1 RecName: Full=Leucyl-tRNA synthetase;       
   34::221     1e-08  29%  810 aa  SYL_OENOB RecName: Full=Leucyl-tRNA synthetase;       
   34::748     1e-08  25%  826 aa  SYL_NATTJ RecName: Full=Leucyl-tRNA synthetase;       
   41::725     1e-08  30%  803 aa  SYL_LISW6 RecName: Full=Leucyl-tRNA synthetase;       
   41::725     1e-08  29%  803 aa  SYL_LISMO RecName: Full=Leucyl-tRNA synthetase;       
   41::725     1e-08  29%  803 aa  SYL_LISMH RecName: Full=Leucyl-tRNA synthetase;       
   41::725     1e-08  29%  803 aa  SYL_LISIN RecName: Full=Leucyl-tRNA synthetase;       
   58::199     1e-08  28%  911 aa  SYI_THELT RecName: Full=Isoleucyl-tRNA synthetase;       
  532::643     1e-08  34%  934 aa  SYI_TERTT RecName: Full=Isoleucyl-tRNA synthetase;       
  534::628     1e-08  47% 1039 aa  SYI_METJA RecName: Full=Isoleucyl-tRNA synthetase;       
  608::670     1e-08  41% 1014 aa  SYI_DEHSC RecName: Full=Isoleucyl-tRNA synthetase;       
  359::623     1e-08  31% 1043 aa  SYI_CHLAB RecName: Full=Isoleucyl-tRNA synthetase;       
  527::777     1e-08  24% 1042 aa  SYI_BORAP RecName: Full=Isoleucyl-tRNA synthetase;       
  673::717     1e-08  49% 1141 aa  SYI_BACFR RecName: Full=Isoleucyl-tRNA synthetase;       
  673::717     1e-08  49% 1141 aa  SYI_BACFN RecName: Full=Isoleucyl-tRNA synthetase;       
   58::109     1e-08  31%  921 aa  SYI_BACCQ RecName: Full=Isoleucyl-tRNA synthetase;       
   58::109     1e-08  31%  921 aa  SYI_BACC7 RecName: Full=Isoleucyl-tRNA synthetase;       
   58::109     1e-08  31%  921 aa  SYI1_BACCZ RecName: Full=Isoleucyl-tRNA synthetase 1;       
   47::128     1e-08  46%  809 aa  SYFB_DEHSC RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::141     1e-08  41%  800 aa  SYFB_ANADE RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   27::408     1e-08  29%  476 aa  SYC_PYRKO RecName: Full=Cysteinyl-tRNA synthetase;       
   22::406     1e-08  28%  477 aa  SYC_PYRFU RecName: Full=Cysteinyl-tRNA synthetase;       
    4::109     1e-08  31%  110 aa  CSAA_BACSU RecName: Full=Protein csaA;
   37::177     2e-08  32%  855 aa  SYV_METTP RecName: Full=Valyl-tRNA synthetase;       
   50::177     2e-08  28%  886 aa  SYV_METMP RecName: Full=Valyl-tRNA synthetase;       
  417::590     2e-08  29%  907 aa  SYV_BARQU RecName: Full=Valyl-tRNA synthetase;       
   35::226     2e-08  26%  857 aa  SYL_THEEB RecName: Full=Leucyl-tRNA synthetase;       
   42::717     2e-08  31%  833 aa  SYL_STRZT RecName: Full=Leucyl-tRNA synthetase;       
   42::717     2e-08  30%  833 aa  SYL_STRZP RecName: Full=Leucyl-tRNA synthetase;       
   42::717     2e-08  31%  833 aa  SYL_STRZJ RecName: Full=Leucyl-tRNA synthetase;       
   42::717     2e-08  31%  833 aa  SYL_STRPN RecName: Full=Leucyl-tRNA synthetase;       
   42::717     2e-08  31%  833 aa  SYL_STRPJ RecName: Full=Leucyl-tRNA synthetase;       
   42::717     2e-08  31%  833 aa  SYL_STRPI RecName: Full=Leucyl-tRNA synthetase;       
   42::717     2e-08  30%  833 aa  SYL_STRP7 RecName: Full=Leucyl-tRNA synthetase;       
   42::717     2e-08  31%  833 aa  SYL_STRP4 RecName: Full=Leucyl-tRNA synthetase;       
   42::717     2e-08  29%  833 aa  SYL_STRP3 RecName: Full=Leucyl-tRNA synthetase;       
   42::717     2e-08  29%  833 aa  SYL_STRP1 RecName: Full=Leucyl-tRNA synthetase;       
   42::717     2e-08  29%  833 aa  SYL_STREM RecName: Full=Leucyl-tRNA synthetase;       
   42::717     2e-08  29%  833 aa  SYL_STRE4 RecName: Full=Leucyl-tRNA synthetase;       
   33::208     2e-08  22%  859 aa  SYL_MAGSM RecName: Full=Leucyl-tRNA synthetase;       
   35::625     2e-08  26%  827 aa  SYL_DESRM RecName: Full=Leucyl-tRNA synthetase;       
   29::197     2e-08  22%  813 aa  SYL_CLOBL RecName: Full=Leucyl-tRNA synthetase;       
   29::197     2e-08  22%  813 aa  SYL_CLOBH RecName: Full=Leucyl-tRNA synthetase;       
   29::197     2e-08  22%  813 aa  SYL_CLOB1 RecName: Full=Leucyl-tRNA synthetase;       
   38::637     2e-08  27%  821 aa  SYL_CAMC5 RecName: Full=Leucyl-tRNA synthetase;       
   34::207     2e-08  23%  634 aa  SYLA_AQUAE RecName: Full=Leucyl-tRNA synthetase subunit alpha;     
   59::197     2e-08  29%  929 aa  SYI_NEIMB RecName: Full=Isoleucyl-tRNA synthetase;       
   59::197     2e-08  29%  929 aa  SYI_NEIM0 RecName: Full=Isoleucyl-tRNA synthetase;       
  577::641     2e-08  40%  892 aa  SYI_MYCAP RecName: Full=Isoleucyl-tRNA synthetase;       
   58::109     2e-08  33%  921 aa  SYI_BACWK RecName: Full=Isoleucyl-tRNA synthetase;       
   58::109     2e-08  29%  921 aa  SYI_BACC3 RecName: Full=Isoleucyl-tRNA synthetase;       
   58::109     2e-08  29%  921 aa  SYI_BACC0 RecName: Full=Isoleucyl-tRNA synthetase;       
   58::109     2e-08  29%  921 aa  SYI_BACAC RecName: Full=Isoleucyl-tRNA synthetase;       
   58::109     2e-08  29%  921 aa  SYI_BACAA RecName: Full=Isoleucyl-tRNA synthetase;       
   58::109     2e-08  29%  921 aa  SYI1_BACHK RecName: Full=Isoleucyl-tRNA synthetase 1;       
   58::109     2e-08  29%  921 aa  SYI1_BACC1 RecName: Full=Isoleucyl-tRNA synthetase 1;       
   58::109     2e-08  29%  921 aa  SYI1_BACAN RecName: Full=Isoleucyl-tRNA synthetase 1;       
   47::123     2e-08  42%  793 aa  SYFB_PSEPK RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   27::310     2e-08  29%  476 aa  SYC_PYRHO RecName: Full=Cysteinyl-tRNA synthetase;       
   38::88      2e-08  35%  871 aa  SYV_NITSB RecName: Full=Valyl-tRNA synthetase;       
   40::88      2e-08  34%  869 aa  SYV_METBF RecName: Full=Valyl-tRNA synthetase;       
   42::92      2e-08  35%  874 aa  SYV_HELPY RecName: Full=Valyl-tRNA synthetase;       
   40::90      2e-08  34%  872 aa  SYV_HELPJ RecName: Full=Valyl-tRNA synthetase;       
   42::717     2e-08  30%  833 aa  SYL_STRTD RecName: Full=Leucyl-tRNA synthetase;       
   42::717     2e-08  30%  833 aa  SYL_STRT2 RecName: Full=Leucyl-tRNA synthetase;       
   42::717     2e-08  30%  833 aa  SYL_STRT1 RecName: Full=Leucyl-tRNA synthetase;       
   49::717     2e-08  31%  833 aa  SYL_STRR6 RecName: Full=Leucyl-tRNA synthetase;       
   49::717     2e-08  31%  833 aa  SYL_STRP2 RecName: Full=Leucyl-tRNA synthetase;       
  561::758     2e-08  29%  819 aa  SYL_NITOC RecName: Full=Leucyl-tRNA synthetase;       
   48::620     2e-08  30%  805 aa  SYL_LACS1 RecName: Full=Leucyl-tRNA synthetase;       
   41::653     2e-08  31%  829 aa  SYL_LACLS RecName: Full=Leucyl-tRNA synthetase;       
   41::653     2e-08  31%  829 aa  SYL_LACLM RecName: Full=Leucyl-tRNA synthetase;       
   41::653     2e-08  31%  829 aa  SYL_LACLA RecName: Full=Leucyl-tRNA synthetase;       
   36::200     2e-08  29%  814 aa  SYL_HERA2 RecName: Full=Leucyl-tRNA synthetase;       
   56::643     2e-08  30%  842 aa  SYL_ARTAT RecName: Full=Leucyl-tRNA synthetase;       
  542::666     2e-08  35%  952 aa  SYI_VIBFM RecName: Full=Isoleucyl-tRNA synthetase;       
  542::666     2e-08  35%  952 aa  SYI_VIBF1 RecName: Full=Isoleucyl-tRNA synthetase;       
   58::111     2e-08  35%  918 aa  SYI_THENN RecName: Full=Isoleucyl-tRNA synthetase;       
  542::658     2e-08  38%  953 aa  SYI_THEEB RecName: Full=Isoleucyl-tRNA synthetase;       
   58::113     2e-08  32%  861 aa  SYI_MYCPN RecName: Full=Isoleucyl-tRNA synthetase;       
  487::655     2e-08  30%  933 aa  SYI_FUSNN RecName: Full=Isoleucyl-tRNA synthetase;       
  542::663     2e-08  35%  959 aa  SYI_CYAP8 RecName: Full=Isoleucyl-tRNA synthetase;       
  513::630     2e-08  33% 1018 aa  SYI_ARCFU RecName: Full=Isoleucyl-tRNA synthetase;       
  272::356     2e-08  41%  413 aa  SYIM_CIOIN RecName: Full=Probable isoleucyl-tRNA synthetase,
  583::647     2e-08  41% 1141 aa  SYIC_CAEEL RecName: Full=Isoleucyl-tRNA synthetase, cytoplasmic;   
   47::125     2e-08  44%  821 aa  SYFB_THEEB RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   32::133     3e-08  31%  864 aa  SYV_WOLPM RecName: Full=Valyl-tRNA synthetase;       
   35::122     3e-08  31% 1020 aa  SYV_SILPO RecName: Full=Valyl-tRNA synthetase;       
  492::607     3e-08  32%  927 aa  SYV_RHILO RecName: Full=Valyl-tRNA synthetase;       
  371::722     3e-08  26%  799 aa  SYV_PYRAE RecName: Full=Valyl-tRNA synthetase;       
  433::722     3e-08  31%  893 aa  SYV_NOCFA RecName: Full=Valyl-tRNA synthetase;       
   33::111     3e-08  37%  921 aa  SYV_METCA RecName: Full=Valyl-tRNA synthetase;       
   46::210     3e-08  26%  856 aa  SYL_PROM2 RecName: Full=Leucyl-tRNA synthetase;       
   33::630     3e-08  29%  828 aa  SYL_PETMO RecName: Full=Leucyl-tRNA synthetase;       
   48::195     3e-08  28%  807 aa  SYL_PELPB RecName: Full=Leucyl-tRNA synthetase;       
   35::225     3e-08  26%  824 aa  SYL_GEOUR RecName: Full=Leucyl-tRNA synthetase;       
   35::652     3e-08  26%  861 aa  SYL_BAUCH RecName: Full=Leucyl-tRNA synthetase;       
   32::794     3e-08  32%  959 aa  SYL_AERPE RecName: Full=Leucyl-tRNA synthetase;       
  538::764     3e-08  32%  942 aa  SYI_VIBPA RecName: Full=Isoleucyl-tRNA synthetase;       
  594::672     3e-08  36% 1100 aa  SYI_TREDE RecName: Full=Isoleucyl-tRNA synthetase;       
  612::716     3e-08  38% 1137 aa  SYI_PORGI RecName: Full=Isoleucyl-tRNA synthetase;       
   57::97      3e-08  34%  905 aa  SYI_PELUB RecName: Full=Isoleucyl-tRNA synthetase;       
  546::672     3e-08  31%  953 aa  SYI_BORPE RecName: Full=Isoleucyl-tRNA synthetase;       
  546::672     3e-08  31%  953 aa  SYI_BORPA RecName: Full=Isoleucyl-tRNA synthetase;       
  546::672     3e-08  31%  953 aa  SYI_BORBR RecName: Full=Isoleucyl-tRNA synthetase;       
  694::738     3e-08  49% 1162 aa  SYI_BACTN RecName: Full=Isoleucyl-tRNA synthetase;       
  552::673     3e-08  33%  956 aa  SYI_AQUAE RecName: Full=Isoleucyl-tRNA synthetase;       
   47::128     3e-08  42%  809 aa  SYFB_DEHE1 RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   27::407     3e-08  30%  476 aa  SYC_THEON RecName: Full=Cysteinyl-tRNA synthetase;       
   27::310     3e-08  29%  477 aa  SYC_PYRAB RecName: Full=Cysteinyl-tRNA synthetase;       
   27::294     3e-08  27%  466 aa  SYC_BACHD RecName: Full=Cysteinyl-tRNA synthetase;       
   28::78      4e-08  37%  768 aa  SYV_PICTO RecName: Full=Valyl-tRNA synthetase;       
  449::587     4e-08  32%  861 aa  SYV_MYCGA RecName: Full=Valyl-tRNA synthetase;       
   49::99      4e-08  32%  899 aa  SYV_HELHP RecName: Full=Valyl-tRNA synthetase;       
  482::590     4e-08  32%  907 aa  SYV_BARHE RecName: Full=Valyl-tRNA synthetase;       
   35::83      4e-08  34%  931 aa  SYV_ALCBS RecName: Full=Valyl-tRNA synthetase;       
   48::197     4e-08  29%  803 aa  SYL_LEUCK RecName: Full=Leucyl-tRNA synthetase;       
   32::699     4e-08  25%  806 aa  SYL_HELAH RecName: Full=Leucyl-tRNA synthetase;       
   49::626     4e-08  26%  802 aa  SYL_FINM2 RecName: Full=Leucyl-tRNA synthetase;       
   29::617     4e-08  27%  812 aa  SYL_CLOAB RecName: Full=Leucyl-tRNA synthetase;       
   35::779     4e-08  28%  872 aa  SYL_CHRVO RecName: Full=Leucyl-tRNA synthetase;       
   48::195     4e-08  27%  805 aa  SYL_CHLCH RecName: Full=Leucyl-tRNA synthetase;       
   34::627     4e-08  27%  809 aa  SYL_CAMJD RecName: Full=Leucyl-tRNA synthetase;       
   34::734     4e-08  26%  840 aa  SYL_BORBZ RecName: Full=Leucyl-tRNA synthetase;       
   34::734     4e-08  26%  840 aa  SYL_BORBU RecName: Full=Leucyl-tRNA synthetase;       
   34::734     4e-08  26%  840 aa  SYL_BORAP RecName: Full=Leucyl-tRNA synthetase;       
   83::280     4e-08  28%  994 aa  SYLM_NEUCR RecName: Full=Leucyl-tRNA synthetase, mitochondrial;    
   58::199     4e-08  30%  908 aa  SYI_THEM4 RecName: Full=Isoleucyl-tRNA synthetase;       
  540::649     4e-08  35%  942 aa  SYI_PSEHT RecName: Full=Isoleucyl-tRNA synthetase;       
   69::109     4e-08  34%  965 aa  SYI_PROM2 RecName: Full=Isoleucyl-tRNA synthetase;       
   58::199     4e-08  32%  919 aa  SYI_PETMO RecName: Full=Isoleucyl-tRNA synthetase;       
   58::199     4e-08  30%  926 aa  SYI_NATTJ RecName: Full=Isoleucyl-tRNA synthetase;       
  538::695     4e-08  27% 1117 aa  SYI_EHRRW RecName: Full=Isoleucyl-tRNA synthetase;       
  538::695     4e-08  27% 1118 aa  SYI_EHRRG RecName: Full=Isoleucyl-tRNA synthetase;       
   58::109     4e-08  33%  921 aa  SYI_BACCN RecName: Full=Isoleucyl-tRNA synthetase;       
  581::625     4e-08  49% 1064 aa  SYIC_SCHPO RecName: Full=Isoleucyl-tRNA synthetase, cytoplasmic;   
   47::143     4e-08  43%  781 aa  SYFB_THIDA RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::125     4e-08  42%  811 aa  SYFB_SYNP6 RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::125     4e-08  42%  810 aa  SYFB_SYNE7 RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   33::293     4e-08  30%  457 aa  SYC_DEHSB RecName: Full=Cysteinyl-tRNA synthetase;       
  492::607     5e-08  32%  957 aa  SYV_RHOPA RecName: Full=Valyl-tRNA synthetase;       
   32::83      5e-08  35%  882 aa  SYV_ONYPE RecName: Full=Valyl-tRNA synthetase;       
   39::87      5e-08  36%  872 aa  SYV_MYCMS RecName: Full=Valyl-tRNA synthetase;       
  460::576     5e-08  32%  876 aa  SYV_GRAFK RecName: Full=Valyl-tRNA synthetase;       
   33::210     5e-08  25%  878 aa  SYL_TREPS RecName: Full=Leucyl-tRNA synthetase;       
   33::210     5e-08  25%  878 aa  SYL_TREPA RecName: Full=Leucyl-tRNA synthetase;       
   35::225     5e-08  24%  859 aa  SYL_SHESR RecName: Full=Leucyl-tRNA synthetase;       
   35::225     5e-08  24%  859 aa  SYL_SHESM RecName: Full=Leucyl-tRNA synthetase;       
   35::225     5e-08  24%  859 aa  SYL_SHESA RecName: Full=Leucyl-tRNA synthetase;       
   35::225     5e-08  24%  859 aa  SYL_SHEON RecName: Full=Leucyl-tRNA synthetase;       
   35::225     5e-08  24%  863 aa  SYL_SHEDO RecName: Full=Leucyl-tRNA synthetase;       
   35::225     5e-08  24%  859 aa  SYL_SHEB9 RecName: Full=Leucyl-tRNA synthetase;       
   35::225     5e-08  24%  859 aa  SYL_SHEB5 RecName: Full=Leucyl-tRNA synthetase;       
   35::225     5e-08  24%  859 aa  SYL_SHEB2 RecName: Full=Leucyl-tRNA synthetase;       
   35::225     5e-08  24%  859 aa  SYL_SHEAM RecName: Full=Leucyl-tRNA synthetase;       
   35::225     5e-08  28%  868 aa  SYL_PSEPW RecName: Full=Leucyl-tRNA synthetase;       
   35::217     5e-08  22%  860 aa  SYL_MANSM RecName: Full=Leucyl-tRNA synthetase;       
   49::207     5e-08  24%  835 aa  SYL_ELUMP RecName: Full=Leucyl-tRNA synthetase;       
   48::205     5e-08  28%  807 aa  SYL_CHLTE RecName: Full=Leucyl-tRNA synthetase;       
   48::195     5e-08  27%  805 aa  SYL_CHLL2 RecName: Full=Leucyl-tRNA synthetase;       
   55::642     5e-08  28%  843 aa  SYL_ARTS2 RecName: Full=Leucyl-tRNA synthetase;       
   34::625     5e-08  29%  803 aa  SYL_ACHLI RecName: Full=Leucyl-tRNA synthetase;       
   64::113     5e-08  31%  901 aa  SYI_MYCGA RecName: Full=Isoleucyl-tRNA synthetase;       
   48::99      5e-08  34%  942 aa  SYI_BLOPB RecName: Full=Isoleucyl-tRNA synthetase;       
  587::811     5e-08  29% 1056 aa  SYI_BDEBA RecName: Full=Isoleucyl-tRNA synthetase;       
   48::200     5e-08  28%  938 aa  SYI_BAUCH RecName: Full=Isoleucyl-tRNA synthetase;       
   58::114     5e-08  34%  921 aa  SYI_BACHD RecName: Full=Isoleucyl-tRNA synthetase;       
   47::123     5e-08  41%  792 aa  SYFB_PSEF5 RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::126     5e-08  44%  799 aa  SYFB_PARUW RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   33::293     5e-08  30%  458 aa  SYC_DEHE1 RecName: Full=Cysteinyl-tRNA synthetase;       
   30::562     7e-08  39%  790 aa  SYV_THEVO RecName: Full=Valyl-tRNA synthetase;       
   37::87      7e-08  38%  814 aa  SYV_RICPR RecName: Full=Valyl-tRNA synthetase;       
  506::627     7e-08  32%  947 aa  SYV_AGRT5 RecName: Full=Valyl-tRNA synthetase;       
   35::225     7e-08  24%  857 aa  SYL_VIBVY RecName: Full=Leucyl-tRNA synthetase;       
   42::654     7e-08  32%  833 aa  SYL_STRMU RecName: Full=Leucyl-tRNA synthetase;       
   38::219     7e-08  29%  849 aa  SYL_SPHAL RecName: Full=Leucyl-tRNA synthetase;       
   77::659     7e-08  28%  854 aa  SYL_SORC5 RecName: Full=Leucyl-tRNA synthetase;       
   35::225     7e-08  24%  859 aa  SYL_SHESW RecName: Full=Leucyl-tRNA synthetase;       
   35::225     7e-08  24%  859 aa  SYL_SHEPC RecName: Full=Leucyl-tRNA synthetase;       
   35::225     7e-08  24%  859 aa  SYL_SHEB8 RecName: Full=Leucyl-tRNA synthetase;       
   48::201     7e-08  29%  805 aa  SYL_PROVI RecName: Full=Leucyl-tRNA synthetase;       
  540::689     7e-08  29%  806 aa  SYL_PROA2 RecName: Full=Leucyl-tRNA synthetase;       
   30::152     7e-08  27%  806 aa  SYL_LACRJ RecName: Full=Leucyl-tRNA synthetase;       
   30::152     7e-08  27%  806 aa  SYL_LACRD RecName: Full=Leucyl-tRNA synthetase;       
   32::616     7e-08  26%  806 aa  SYL_HELPY RecName: Full=Leucyl-tRNA synthetase;       
   32::616     7e-08  27%  806 aa  SYL_HELPH RecName: Full=Leucyl-tRNA synthetase;       
   58::199     7e-08  31%  910 aa  SYI_THEAB RecName: Full=Isoleucyl-tRNA synthetase;       
   69::139     7e-08  33%  968 aa  SYI_PROMS RecName: Full=Isoleucyl-tRNA synthetase;       
  548::677     7e-08  32%  969 aa  SYI_PROMA RecName: Full=Isoleucyl-tRNA synthetase;       
   59::109     7e-08  34%  968 aa  SYI_PROM9 RecName: Full=Isoleucyl-tRNA synthetase;       
   69::109     7e-08  35%  969 aa  SYI_PROM4 RecName: Full=Isoleucyl-tRNA synthetase;       
   69::139     7e-08  34%  968 aa  SYI_PROM0 RecName: Full=Isoleucyl-tRNA synthetase;       
  533::651     7e-08  38%  937 aa  SYI_PECCP RecName: Full=Isoleucyl-tRNA synthetase;       
   61::101     7e-08  28%  886 aa  SYI_MYCHJ RecName: Full=Isoleucyl-tRNA synthetase;       
   59::112     7e-08  33%  941 aa  SYI_HALHL RecName: Full=Isoleucyl-tRNA synthetase;       
   58::114     7e-08  35%  923 aa  SYI_GEOSW RecName: Full=Isoleucyl-tRNA synthetase;       
   58::199     7e-08  36%  912 aa  SYI_FERPE RecName: Full=Isoleucyl-tRNA synthetase;       
  527::777     7e-08  24% 1044 aa  SYI_BORRA RecName: Full=Isoleucyl-tRNA synthetase;       
  542::666     7e-08  34%  952 aa  SYI_ALISL RecName: Full=Isoleucyl-tRNA synthetase;       
   47::125     7e-08  44%  810 aa  SYFB_SYNY3 RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   48::124     7e-08  42%  811 aa  SYFB_OCEIH RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   36::87      9e-08  38%  814 aa  SYV_RICTY RecName: Full=Valyl-tRNA synthetase;       
   36::87      9e-08  37%  859 aa  SYV_RICFE RecName: Full=Valyl-tRNA synthetase;       
   36::87      9e-08  37%  812 aa  SYV_RICCN RecName: Full=Valyl-tRNA synthetase;       
   36::87      9e-08  38%  813 aa  SYV_RICCK RecName: Full=Valyl-tRNA synthetase;       
   36::87      9e-08  38%  812 aa  SYV_RICBR RecName: Full=Valyl-tRNA synthetase;       
   36::87      9e-08  38%  812 aa  SYV_RICB8 RecName: Full=Valyl-tRNA synthetase;       
   36::87      9e-08  37%  812 aa  SYV_RICAE RecName: Full=Valyl-tRNA synthetase;       
   35::225     9e-08  24%  858 aa  SYL_VIBFM RecName: Full=Leucyl-tRNA synthetase;       
   35::225     9e-08  24%  858 aa  SYL_VIBF1 RecName: Full=Leucyl-tRNA synthetase;       
   41::746     9e-08  26%  862 aa  SYL_PROMT RecName: Full=Leucyl-tRNA synthetase;       
   35::225     9e-08  28%  815 aa  SYL_MARMS RecName: Full=Leucyl-tRNA synthetase;       
   32::745     9e-08  24%  806 aa  SYL_HELPJ RecName: Full=Leucyl-tRNA synthetase;       
   34::627     9e-08  27%  809 aa  SYL_CAMJR RecName: Full=Leucyl-tRNA synthetase;       
   34::627     9e-08  27%  809 aa  SYL_CAMJJ RecName: Full=Leucyl-tRNA synthetase;       
   35::225     9e-08  24%  858 aa  SYL_ALISL RecName: Full=Leucyl-tRNA synthetase;       
   58::109     9e-08  30%  916 aa  SYI_STAS1 RecName: Full=Isoleucyl-tRNA synthetase;       
   61::101     9e-08  28%  886 aa  SYI_MYCH7 RecName: Full=Isoleucyl-tRNA synthetase;       
  582::626     9e-08  51% 1034 aa  SYI_METMP RecName: Full=Isoleucyl-tRNA synthetase;       
   58::778     9e-08  31%  932 aa  SYI_LACPL RecName: Full=Isoleucyl-tRNA synthetase;       
   83::123     9e-08  40%  960 aa  SYI_GLUOX RecName: Full=Isoleucyl-tRNA synthetase;       
  531::669     9e-08  33%  935 aa  SYI_FRAP2 RecName: Full=Isoleucyl-tRNA synthetase;       
  610::670     9e-08  39% 1014 aa  SYI_DEHE1 RecName: Full=Isoleucyl-tRNA synthetase;       
   58::98      9e-08  33%  953 aa  SYI_BORPD RecName: Full=Isoleucyl-tRNA synthetase;       
  559::632     9e-08  35% 1067 aa  SYIC_DICDI RecName: Full=Probable isoleucyl-tRNA synthetase,
   36::87      1e-07  36%  812 aa  SYV_RICRS RecName: Full=Valyl-tRNA synthetase;       
   36::87      1e-07  36%  812 aa  SYV_RICRO RecName: Full=Valyl-tRNA synthetase;       
   36::87      1e-07  36%  812 aa  SYV_RICPU RecName: Full=Valyl-tRNA synthetase;       
  301::547     1e-07  28%  869 aa  SYV_METAC RecName: Full=Valyl-tRNA synthetase;       
   48::211     1e-07  26%  806 aa  SYL_TROWT RecName: Full=Leucyl-tRNA synthetase;       
   48::211     1e-07  26%  806 aa  SYL_TROW8 RecName: Full=Leucyl-tRNA synthetase;       
   33::200     1e-07  22%  858 aa  SYL_TREDE RecName: Full=Leucyl-tRNA synthetase;       
   35::208     1e-07  22%  863 aa  SYL_SHESH RecName: Full=Leucyl-tRNA synthetase;       
   35::198     1e-07  22%  859 aa  SYL_SHEPA RecName: Full=Leucyl-tRNA synthetase;       
   35::198     1e-07  22%  859 aa  SYL_SHEHH RecName: Full=Leucyl-tRNA synthetase;       
   35::225     1e-07  23%  873 aa  SYL_PSEAE RecName: Full=Leucyl-tRNA synthetase;       
   35::225     1e-07  23%  873 aa  SYL_PSEAB RecName: Full=Leucyl-tRNA synthetase;       
   35::225     1e-07  23%  873 aa  SYL_PSEA8 RecName: Full=Leucyl-tRNA synthetase;       
   35::795     1e-07  25%  873 aa  SYL_PSEA7 RecName: Full=Leucyl-tRNA synthetase;       
   35::225     1e-07  24%  858 aa  SYL_PHOPR RecName: Full=Leucyl-tRNA synthetase;       
   36::199     1e-07  26%  879 aa  SYL_OLICO RecName: Full=Leucyl-tRNA synthetase;       
   34::631     1e-07  27%  815 aa  SYL_NITSB RecName: Full=Leucyl-tRNA synthetase;       
   35::198     1e-07  24%  887 aa  SYL_METCA RecName: Full=Leucyl-tRNA synthetase;       
  544::624     1e-07  39%  808 aa  SYL_LEUMM RecName: Full=Leucyl-tRNA synthetase;       
   35::734     1e-07  27%  817 aa  SYL_HALHL RecName: Full=Leucyl-tRNA synthetase;       
   34::627     1e-07  27%  809 aa  SYL_CAMJE RecName: Full=Leucyl-tRNA synthetase;       
   34::627     1e-07  27%  809 aa  SYL_CAMJ8 RecName: Full=Leucyl-tRNA synthetase;       
   33::195     1e-07  25%  813 aa  SYL_CAMHC RecName: Full=Leucyl-tRNA synthetase;       
   41::197     1e-07  25%  838 aa  SYL1_RHIL3 RecName: Full=Leucyl-tRNA synthetase 1;       
  412::693     1e-07  31%  952 aa  SYI_MICAN RecName: Full=Isoleucyl-tRNA synthetase;       
  589::633     1e-07  49% 1040 aa  SYI_META3 RecName: Full=Isoleucyl-tRNA synthetase;       
  536::649     1e-07  34%  939 aa  SYI_MARAV RecName: Full=Isoleucyl-tRNA synthetase;       
  531::643     1e-07  35%  935 aa  SYI_FRATW RecName: Full=Isoleucyl-tRNA synthetase;       
  531::643     1e-07  35%  935 aa  SYI_FRATT RecName: Full=Isoleucyl-tRNA synthetase;       
  531::643     1e-07  35%  935 aa  SYI_FRATO RecName: Full=Isoleucyl-tRNA synthetase;       
  531::643     1e-07  35%  935 aa  SYI_FRATN RecName: Full=Isoleucyl-tRNA synthetase;       
  531::643     1e-07  35%  935 aa  SYI_FRATM RecName: Full=Isoleucyl-tRNA synthetase;       
  531::643     1e-07  35%  935 aa  SYI_FRATH RecName: Full=Isoleucyl-tRNA synthetase;       
  531::643     1e-07  35%  935 aa  SYI_FRATF RecName: Full=Isoleucyl-tRNA synthetase;       
  531::643     1e-07  35%  935 aa  SYI_FRAT1 RecName: Full=Isoleucyl-tRNA synthetase;       
  552::666     1e-07  32%  945 aa  SYI_BURXL RecName: Full=Isoleucyl-tRNA synthetase;       
  552::666     1e-07  32%  945 aa  SYI_BURPP RecName: Full=Isoleucyl-tRNA synthetase;       
  536::677     1e-07  32% 1103 aa  SYI_BIFLO RecName: Full=Isoleucyl-tRNA synthetase;       
   58::98      1e-07  35%  921 aa  SYI_BACSU RecName: Full=Isoleucyl-tRNA synthetase;       
   41::196     1e-07  31% 1033 aa  SYI_BACAH RecName: Full=Isoleucyl-tRNA synthetase;       
   47::123     1e-07  41%  792 aa  SYFB_PSEPF RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   38::388     1e-07  29%  485 aa  SYC_GEOMG RecName: Full=Cysteinyl-tRNA synthetase;       
   33::293     1e-07  31%  457 aa  SYC_DEHSC RecName: Full=Cysteinyl-tRNA synthetase;       
   30::562     2e-07  38%  791 aa  SYV_THEAC RecName: Full=Valyl-tRNA synthetase;       
   35::188     2e-07  30%  874 aa  SYV_PETMO RecName: Full=Valyl-tRNA synthetase;       
   36::87      2e-07  38%  854 aa  SYV_ORITB RecName: Full=Valyl-tRNA synthetase;       
   46::210     2e-07  25%  856 aa  SYL_PROM9 RecName: Full=Leucyl-tRNA synthetase;       
   46::210     2e-07  25%  856 aa  SYL_PROM0 RecName: Full=Leucyl-tRNA synthetase;       
   27::667     2e-07  25%  831 aa  SYL_NEOSM RecName: Full=Leucyl-tRNA synthetase;       
   53::215     2e-07  24%  866 aa  SYL_LEIXX RecName: Full=Leucyl-tRNA synthetase;       
   35::850     2e-07  23%  911 aa  SYL_DELAS RecName: Full=Leucyl-tRNA synthetase;       
   34::215     2e-07  26%  842 aa  SYL_BORRA RecName: Full=Leucyl-tRNA synthetase;       
   34::215     2e-07  26%  842 aa  SYL_BORDL RecName: Full=Leucyl-tRNA synthetase;       
  588::635     2e-07  42% 1060 aa  SYI_THEFY RecName: Full=Isoleucyl-tRNA synthetase;       
  534::652     2e-07  32%  932 aa  SYI_PASMU RecName: Full=Isoleucyl-tRNA synthetase;       
   58::123     2e-07  30%  939 aa  SYI_DESPS RecName: Full=Isoleucyl-tRNA synthetase;       
  552::666     2e-07  32%  945 aa  SYI_BURP8 RecName: Full=Isoleucyl-tRNA synthetase;       
  527::622     2e-07  31% 1044 aa  SYI_BORDL RecName: Full=Isoleucyl-tRNA synthetase;       
  546::667     2e-07  31%  953 aa  SYI_BORA1 RecName: Full=Isoleucyl-tRNA synthetase;       
   47::125     2e-07  44%  810 aa  SYFB_ANASP RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   40::181     2e-07  33%  869 aa  SYV_METMA RecName: Full=Valyl-tRNA synthetase;       
   36::116     2e-07  33%  888 aa  SYV_GLUOX RecName: Full=Valyl-tRNA synthetase;       
   38::136     2e-07  35%  802 aa  SYV_EHRCJ RecName: Full=Valyl-tRNA synthetase;       
   46::251     2e-07  27%  878 aa  SYL_PROMM RecName: Full=Leucyl-tRNA synthetase;       
   46::251     2e-07  27%  878 aa  SYL_PROM3 RecName: Full=Leucyl-tRNA synthetase;       
   40::118     2e-07  30%  799 aa  SYL_MYCPE RecName: Full=Leucyl-tRNA synthetase;       
  541::621     2e-07  38%  805 aa  SYL_LACF3 RecName: Full=Leucyl-tRNA synthetase;       
   42::640     2e-07  26%  830 aa  SYL_HELHP RecName: Full=Leucyl-tRNA synthetase;       
   48::172     2e-07  29%  816 aa  SYL_CHLPD RecName: Full=Leucyl-tRNA synthetase;       
  624::667     2e-07  48% 1114 aa  SYI_PROAC RecName: Full=Isoleucyl-tRNA synthetase;       
   60::100     2e-07  32%  885 aa  SYI_MYCMO RecName: Full=Isoleucyl-tRNA synthetase;       
   58::129     2e-07  33%  914 aa  SYI_MACCJ RecName: Full=Isoleucyl-tRNA synthetase;       
  533::651     2e-07  34%  937 aa  SYI_ERWCT RecName: Full=Isoleucyl-tRNA synthetase;       
  573::690     2e-07  32%  967 aa  SYI_AGRT5 RecName: Full=Isoleucyl-tRNA synthetase;       
  103::723     2e-07  32% 1000 aa  SYIM_CHICK RecName: Full=Isoleucyl-tRNA synthetase, mitochondrial; 
  580::777     2e-07  27% 1030 aa  SYI2_PSEFL RecName: Full=Isoleucyl-tRNA synthetase 2;       
   47::125     2e-07  44%  810 aa  SYFB_ANAVT RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   36::296     2e-07  27%  487 aa  SYC_THEYD RecName: Full=Cysteinyl-tRNA synthetase;       
   36::87      3e-07  39%  812 aa  SYV_RICAH RecName: Full=Valyl-tRNA synthetase;       
  506::627     3e-07  35%  947 aa  SYV_RHIME RecName: Full=Valyl-tRNA synthetase;       
  450::548     3e-07  32%  872 aa  SYV_NATPD RecName: Full=Valyl-tRNA synthetase;       
   31::111     3e-07  34%  921 aa  SYV_LEGPH RecName: Full=Valyl-tRNA synthetase;       
   31::111     3e-07  34%  921 aa  SYV_LEGPA RecName: Full=Valyl-tRNA synthetase;       
   38::86      3e-07  30%  943 aa  SYV_DECAR RecName: Full=Valyl-tRNA synthetase;       
   38::173     3e-07  33%  875 aa  SYV_BORGA RecName: Full=Valyl-tRNA synthetase;       
  541::734     3e-07  29%  817 aa  SYL_THISH RecName: Full=Leucyl-tRNA synthetase;       
   35::761     3e-07  28%  857 aa  SYL_THIDA RecName: Full=Leucyl-tRNA synthetase;       
  559::618     3e-07  42%  816 aa  SYL_RUTMC RecName: Full=Leucyl-tRNA synthetase;       
   46::210     3e-07  25%  856 aa  SYL_PROMS RecName: Full=Leucyl-tRNA synthetase;       
   45::213     3e-07  29%  848 aa  SYL_NOVAD RecName: Full=Leucyl-tRNA synthetase;       
   41::119     3e-07  29%  864 aa  SYL_LEPBL RecName: Full=Leucyl-tRNA synthetase;       
   41::119     3e-07  29%  864 aa  SYL_LEPBJ RecName: Full=Leucyl-tRNA synthetase;       
   35::198     3e-07  27%  820 aa  SYL_COXBU RecName: Full=Leucyl-tRNA synthetase;       
   35::198     3e-07  27%  820 aa  SYL_COXBR RecName: Full=Leucyl-tRNA synthetase;       
   35::198     3e-07  27%  820 aa  SYL_COXBN RecName: Full=Leucyl-tRNA synthetase;       
   35::198     3e-07  27%  820 aa  SYL_COXB2 RecName: Full=Leucyl-tRNA synthetase;       
   35::198     3e-07  27%  820 aa  SYL_COXB1 RecName: Full=Leucyl-tRNA synthetase;       
   36::199     3e-07  25%  874 aa  SYL_BRASB RecName: Full=Leucyl-tRNA synthetase;       
   34::176     3e-07  26%  840 aa  SYL_BORGA RecName: Full=Leucyl-tRNA synthetase;       
   58::113     3e-07  30%  916 aa  SYI_STAHJ RecName: Full=Isoleucyl-tRNA synthetase;       
  586::651     3e-07  39%  938 aa  SYI_SODGM RecName: Full=Isoleucyl-tRNA synthetase;       
  433::677     3e-07  30%  967 aa  SYI_PROMT RecName: Full=Isoleucyl-tRNA synthetase;       
  433::677     3e-07  30%  967 aa  SYI_PROM1 RecName: Full=Isoleucyl-tRNA synthetase;       
   61::101     3e-07  28%  886 aa  SYI_MYCH2 RecName: Full=Isoleucyl-tRNA synthetase;       
   58::109     3e-07  30%  921 aa  SYI_LISMO RecName: Full=Isoleucyl-tRNA synthetase;       
   58::109     3e-07  30%  921 aa  SYI_LISMH RecName: Full=Isoleucyl-tRNA synthetase;       
   58::109     3e-07  30%  921 aa  SYI_LISMF RecName: Full=Isoleucyl-tRNA synthetase;       
   58::109     3e-07  30%  921 aa  SYI_LISMC RecName: Full=Isoleucyl-tRNA synthetase;       
   58::109     3e-07  30%  921 aa  SYI_LISIN RecName: Full=Isoleucyl-tRNA synthetase;       
   58::199     3e-07  36%  913 aa  SYI_FERNB RecName: Full=Isoleucyl-tRNA synthetase;       
  533::651     3e-07  38%  938 aa  SYI_ENTS8 RecName: Full=Isoleucyl-tRNA synthetase;       
  544::662     3e-07  35%  948 aa  SYI_EDWI9 RecName: Full=Isoleucyl-tRNA synthetase;       
   50::101     3e-07  35%  959 aa  SYI_CYAA5 RecName: Full=Isoleucyl-tRNA synthetase;       
  533::646     3e-07  38%  938 aa  SYI_CITK8 RecName: Full=Isoleucyl-tRNA synthetase;       
   64::118     3e-07  34%  972 aa  SYI_BRUSU RecName: Full=Isoleucyl-tRNA synthetase;       
   64::118     3e-07  34%  972 aa  SYI_BRUME RecName: Full=Isoleucyl-tRNA synthetase;       
   64::118     3e-07  34%  972 aa  SYI_BRUAB RecName: Full=Isoleucyl-tRNA synthetase;       
   64::118     3e-07  34%  972 aa  SYI_BRUA2 RecName: Full=Isoleucyl-tRNA synthetase;       
   58::98      3e-07  34%  923 aa  SYI_BACSK RecName: Full=Isoleucyl-tRNA synthetase;       
   38::86      3e-07  32% 1035 aa  SYV_RHOBA RecName: Full=Valyl-tRNA synthetase;       
   31::111     3e-07  34%  921 aa  SYV_LEGPL RecName: Full=Valyl-tRNA synthetase;       
   38::187     3e-07  29%  881 aa  SYV_HALSA RecName: Full=Valyl-tRNA synthetase;       
   38::187     3e-07  29%  881 aa  SYV_HALS3 RecName: Full=Valyl-tRNA synthetase;       
   35::609     3e-07  26%  819 aa  SYL_SACD2 RecName: Full=Leucyl-tRNA synthetase;       
   46::164     3e-07  26%  872 aa  SYL_PROM4 RecName: Full=Leucyl-tRNA synthetase;       
   41::746     3e-07  29%  862 aa  SYL_PROM1 RecName: Full=Leucyl-tRNA synthetase;       
   35::226     3e-07  27%  827 aa  SYL_PELTS RecName: Full=Leucyl-tRNA synthetase;       
   35::225     3e-07  24%  851 aa  SYL_PELCD RecName: Full=Leucyl-tRNA synthetase;       
   48::199     3e-07  30%  805 aa  SYL_PEDPA RecName: Full=Leucyl-tRNA synthetase;       
   34::765     3e-07  26%  835 aa  SYL_LAWIP RecName: Full=Leucyl-tRNA synthetase;       
   29::149     3e-07  34%  809 aa  SYL_LACBA RecName: Full=Leucyl-tRNA synthetase;       
   35::219     3e-07  26%  861 aa  SYL_HAHCH RecName: Full=Leucyl-tRNA synthetase;       
   35::225     3e-07  23%  860 aa  SYL_EDWI9 RecName: Full=Leucyl-tRNA synthetase;       
   33::198     3e-07  23%  864 aa  SYL_BURPS RecName: Full=Leucyl-tRNA synthetase;       
   33::198     3e-07  23%  864 aa  SYL_BURP6 RecName: Full=Leucyl-tRNA synthetase;       
   33::198     3e-07  23%  864 aa  SYL_BURP1 RecName: Full=Leucyl-tRNA synthetase;       
   33::198     3e-07  23%  864 aa  SYL_BURP0 RecName: Full=Leucyl-tRNA synthetase;       
   33::198     3e-07  23%  864 aa  SYL_BURMS RecName: Full=Leucyl-tRNA synthetase;       
   33::198     3e-07  23%  864 aa  SYL_BURMA RecName: Full=Leucyl-tRNA synthetase;       
   33::198     3e-07  23%  864 aa  SYL_BURM9 RecName: Full=Leucyl-tRNA synthetase;       
   33::198     3e-07  23%  864 aa  SYL_BURM7 RecName: Full=Leucyl-tRNA synthetase;       
   35::225     3e-07  23%  858 aa  SYL_AERS4 RecName: Full=Leucyl-tRNA synthetase;       
   37::107     3e-07  31%  950 aa  SYL2_METS5 RecName: Full=Leucyl-tRNA synthetase 2;       
  533::646     3e-07  38%  938 aa  SYI_SHIBS RecName: Full=Isoleucyl-tRNA synthetase;       
  533::759     3e-07  28%  937 aa  SYI_PHOLL RecName: Full=Isoleucyl-tRNA synthetase;       
   58::104     3e-07  34%  895 aa  SYI_MYCGE RecName: Full=Isoleucyl-tRNA synthetase;       
   58::109     3e-07  30%  921 aa  SYI_LISW6 RecName: Full=Isoleucyl-tRNA synthetase;       
   58::114     3e-07  28%  921 aa  SYI_KOSOT RecName: Full=Isoleucyl-tRNA synthetase;       
  536::632     3e-07  35%  941 aa  SYI_HAHCH RecName: Full=Isoleucyl-tRNA synthetase;       
   58::758     3e-07  29%  911 aa  SYI_EXIS2 RecName: Full=Isoleucyl-tRNA synthetase;       
  593::688     3e-07  36%  946 aa  SYI_CHRSD RecName: Full=Isoleucyl-tRNA synthetase;       
   48::99      3e-07  33%  953 aa  SYI_BLOFL RecName: Full=Isoleucyl-tRNA synthetase;       
  575::692     3e-07  29%  971 aa  SYI_BARHE RecName: Full=Isoleucyl-tRNA synthetase;       
   41::196     3e-07  31% 1033 aa  SYI2_BACCR RecName: Full=Isoleucyl-tRNA synthetase 2;       
   58::98      3e-07  36%  918 aa  SYI1_OCEIH RecName: Full=Isoleucyl-tRNA synthetase 1;       
  180::285     4e-07  36% 1104 aa  SYV_YEAST RecName: Full=Valyl-tRNA synthetase, mitochondrial;      
   37::96      4e-07  30%  856 aa  SYV_TROWT RecName: Full=Valyl-tRNA synthetase;       
   37::96      4e-07  30%  856 aa  SYV_TROW8 RecName: Full=Valyl-tRNA synthetase;       
  129::680     4e-07  38%  980 aa  SYV_SCHPO RecName: Full=Valyl-tRNA synthetase;       
   33::92      4e-07  40%  862 aa  SYV_SALAI RecName: Full=Valyl-tRNA synthetase;       
  379::677     4e-07  27%  838 aa  SYV_MYCPN RecName: Full=Valyl-tRNA synthetase;       
  363::557     4e-07  25%  867 aa  SYV_FERNB RecName: Full=Valyl-tRNA synthetase;       
   38::173     4e-07  32%  875 aa  SYV_BORBU RecName: Full=Valyl-tRNA synthetase;       
  494::570     4e-07  39%  875 aa  SYV_BACV8 RecName: Full=Valyl-tRNA synthetase;       
   34::196     4e-07  24%  819 aa  SYL_WOLSU RecName: Full=Leucyl-tRNA synthetase;       
   40::125     4e-07  31%  864 aa  SYL_SYNR3 RecName: Full=Leucyl-tRNA synthetase;       
  644::831     4e-07  31%  888 aa  SYL_RHOP5 RecName: Full=Leucyl-tRNA synthetase;       
   33::678     4e-07  33%  967 aa  SYL_PYRKO RecName: Full=Leucyl-tRNA synthetase;       
    2::68      4e-07  39%  977 aa  SYL_NANEQ RecName: Full=Leucyl-tRNA synthetase;       
   35::787     4e-07  28%  856 aa  SYL_CYAP8 RecName: Full=Leucyl-tRNA synthetase;       
   35::784     4e-07  30%  853 aa  SYL_CYAA5 RecName: Full=Leucyl-tRNA synthetase;       
   35::225     4e-07  23%  859 aa  SYL_AERHH RecName: Full=Leucyl-tRNA synthetase;       
  533::646     4e-07  36%  938 aa  SYI_YERP3 RecName: Full=Isoleucyl-tRNA synthetase;       
  533::646     4e-07  36%  938 aa  SYI_YERE8 RecName: Full=Isoleucyl-tRNA synthetase;       
  542::666     4e-07  31%  952 aa  SYI_VIBSL RecName: Full=Isoleucyl-tRNA synthetase;       
  539::657     4e-07  31%  918 aa  SYI_SULNB RecName: Full=Isoleucyl-tRNA synthetase;       
  551::667     4e-07  34%  943 aa  SYI_STRMK RecName: Full=Isoleucyl-tRNA synthetase;       
  551::667     4e-07  34%  943 aa  SYI_STRM5 RecName: Full=Isoleucyl-tRNA synthetase;       
  584::627     4e-07  43% 1047 aa  SYI_STRCO RecName: Full=Isoleucyl-tRNA synthetase;       
  584::627     4e-07  43% 1047 aa  SYI_STRAW RecName: Full=Isoleucyl-tRNA synthetase;       
  533::646     4e-07  38%  938 aa  SYI_SHISS RecName: Full=Isoleucyl-tRNA synthetase;       
  533::646     4e-07  38%  938 aa  SYI_SHIFL RecName: Full=Isoleucyl-tRNA synthetase;       
  533::646     4e-07  38%  938 aa  SYI_SHIDS RecName: Full=Isoleucyl-tRNA synthetase;       
  533::646     4e-07  38%  938 aa  SYI_SHIB3 RecName: Full=Isoleucyl-tRNA synthetase;       
  589::721     4e-07  31%  940 aa  SYI_SHESH RecName: Full=Isoleucyl-tRNA synthetase;       
  563::779     4e-07  29% 1038 aa  SYI_PARUW RecName: Full=Isoleucyl-tRNA synthetase;       
  531::648     4e-07  30%  915 aa  SYI_LEPBP RecName: Full=Isoleucyl-tRNA synthetase;       
  531::648     4e-07  30%  915 aa  SYI_LEPBA RecName: Full=Isoleucyl-tRNA synthetase;       
  533::646     4e-07  38%  938 aa  SYI_KLEP3 RecName: Full=Isoleucyl-tRNA synthetase;       
  552::788     4e-07  27%  937 aa  SYI_HYDS0 RecName: Full=Isoleucyl-tRNA synthetase;       
  533::646     4e-07  38%  938 aa  SYI_ESCF3 RecName: Full=Isoleucyl-tRNA synthetase;       
  533::646     4e-07  38%  938 aa  SYI_ECOUT RecName: Full=Isoleucyl-tRNA synthetase;       
  533::646     4e-07  38%  938 aa  SYI_ECOSM RecName: Full=Isoleucyl-tRNA synthetase;       
  533::646     4e-07  38%  938 aa  SYI_ECOSE RecName: Full=Isoleucyl-tRNA synthetase;       
  533::646     4e-07  38%  938 aa  SYI_ECOLU RecName: Full=Isoleucyl-tRNA synthetase;       
  533::646     4e-07  38%  938 aa  SYI_ECOLI RecName: Full=Isoleucyl-tRNA synthetase;       
  533::646     4e-07  38%  938 aa  SYI_ECOLC RecName: Full=Isoleucyl-tRNA synthetase;       
  533::646     4e-07  38%  938 aa  SYI_ECOL6 RecName: Full=Isoleucyl-tRNA synthetase;       
  533::646     4e-07  38%  938 aa  SYI_ECOL5 RecName: Full=Isoleucyl-tRNA synthetase;       
  533::646     4e-07  38%  938 aa  SYI_ECOK1 RecName: Full=Isoleucyl-tRNA synthetase;       
  533::646     4e-07  38%  938 aa  SYI_ECOHS RecName: Full=Isoleucyl-tRNA synthetase;       
  533::646     4e-07  38%  938 aa  SYI_ECODH RecName: Full=Isoleucyl-tRNA synthetase;       
  533::646     4e-07  38%  938 aa  SYI_ECOBW RecName: Full=Isoleucyl-tRNA synthetase;       
  533::646     4e-07  38%  938 aa  SYI_ECO8A RecName: Full=Isoleucyl-tRNA synthetase;       
  533::646     4e-07  38%  938 aa  SYI_ECO81 RecName: Full=Isoleucyl-tRNA synthetase;       
  533::646     4e-07  38%  938 aa  SYI_ECO7I RecName: Full=Isoleucyl-tRNA synthetase;       
  533::646     4e-07  38%  938 aa  SYI_ECO5E RecName: Full=Isoleucyl-tRNA synthetase;       
  533::646     4e-07  38%  938 aa  SYI_ECO57 RecName: Full=Isoleucyl-tRNA synthetase;       
  533::646     4e-07  38%  938 aa  SYI_ECO55 RecName: Full=Isoleucyl-tRNA synthetase;       
  533::646     4e-07  38%  938 aa  SYI_ECO45 RecName: Full=Isoleucyl-tRNA synthetase;       
  533::646     4e-07  38%  938 aa  SYI_ECO27 RecName: Full=Isoleucyl-tRNA synthetase;       
  533::646     4e-07  38%  938 aa  SYI_ECO24 RecName: Full=Isoleucyl-tRNA synthetase;       
  576::761     4e-07  27% 1043 aa  SYI_CHLCV RecName: Full=Isoleucyl-tRNA synthetase;       
  552::666     4e-07  32%  945 aa  SYI_BURM1 RecName: Full=Isoleucyl-tRNA synthetase;       
  552::666     4e-07  32%  945 aa  SYI_BURCM RecName: Full=Isoleucyl-tRNA synthetase;       
  552::666     4e-07  32%  945 aa  SYI_BURA4 RecName: Full=Isoleucyl-tRNA synthetase;       
  455::644     4e-07  40%  960 aa  SYI_ANASP RecName: Full=Isoleucyl-tRNA synthetase;       
   34::254     4e-07  24% 1022 aa  SYI2_OCEIH RecName: Full=Isoleucyl-tRNA synthetase 2;       
   50::123     4e-07  39%  778 aa  SYFB_SULDN RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::148     4e-07  35%  791 aa  SYFB_METCA RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   50::123     4e-07  41%  792 aa  SYFB_AZOSE RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   36::324     4e-07  29%  460 aa  SYC_THENN RecName: Full=Cysteinyl-tRNA synthetase;       
   38::309     4e-07  28%  493 aa  SYC_SYNFM RecName: Full=Cysteinyl-tRNA synthetase;       
   36::578     6e-07  36%  810 aa  SYV_EHRRW RecName: Full=Valyl-tRNA synthetase;       
   38::580     6e-07  36%  812 aa  SYV_EHRRG RecName: Full=Valyl-tRNA synthetase;       
   32::83      6e-07  33%  870 aa  SYV_CAMJR RecName: Full=Valyl-tRNA synthetase;       
   32::83      6e-07  33%  870 aa  SYV_CAMJE RecName: Full=Valyl-tRNA synthetase;       
  336::385     6e-07  33% 1264 aa  SYVC_HUMAN RecName: Full=Valyl-tRNA synthetase;       
   43::233     6e-07  26%  877 aa  SYL_THICR RecName: Full=Leucyl-tRNA synthetase;       
   47::219     6e-07  21%  830 aa  SYL_THEFY RecName: Full=Leucyl-tRNA synthetase;       
   37::658     6e-07  28%  862 aa  SYL_RHORT RecName: Full=Leucyl-tRNA synthetase;       
   48::726     6e-07  27%  807 aa  SYL_CHLP8 RecName: Full=Leucyl-tRNA synthetase;       
   34::628     6e-07  25%  811 aa  SYL_CAMFF RecName: Full=Leucyl-tRNA synthetase;       
   33::198     6e-07  23%  864 aa  SYL_BURTA RecName: Full=Leucyl-tRNA synthetase;       
  533::646     6e-07  37%  938 aa  SYI_YERPY RecName: Full=Isoleucyl-tRNA synthetase;       
  533::646     6e-07  37%  938 aa  SYI_YERPS RecName: Full=Isoleucyl-tRNA synthetase;       
  533::646     6e-07  37%  938 aa  SYI_YERPP RecName: Full=Isoleucyl-tRNA synthetase;       
  533::646     6e-07  37%  938 aa  SYI_YERPN RecName: Full=Isoleucyl-tRNA synthetase;       
  533::646     6e-07  37%  938 aa  SYI_YERPG RecName: Full=Isoleucyl-tRNA synthetase;       
  533::646     6e-07  37%  938 aa  SYI_YERPE RecName: Full=Isoleucyl-tRNA synthetase;       
  533::646     6e-07  37%  938 aa  SYI_YERPB RecName: Full=Isoleucyl-tRNA synthetase;       
  533::646     6e-07  37%  938 aa  SYI_YERPA RecName: Full=Isoleucyl-tRNA synthetase;       
   59::99      6e-07  30%  915 aa  SYI_WOLSU RecName: Full=Isoleucyl-tRNA synthetase;       
  538::656     6e-07  36%  942 aa  SYI_VIBHB RecName: Full=Isoleucyl-tRNA synthetase;       
  577::637     6e-07  36%  955 aa  SYI_VESOH RecName: Full=Isoleucyl-tRNA synthetase;       
   58::109     6e-07  33%  915 aa  SYI_STACT RecName: Full=Isoleucyl-tRNA synthetase;       
   66::153     6e-07  34%  970 aa  SYI_SILPO RecName: Full=Isoleucyl-tRNA synthetase;       
  535::648     6e-07  36%  944 aa  SYI_SALTY RecName: Full=Isoleucyl-tRNA synthetase;       
  535::648     6e-07  36%  944 aa  SYI_SALTI RecName: Full=Isoleucyl-tRNA synthetase;       
  535::648     6e-07  36%  944 aa  SYI_SALPK RecName: Full=Isoleucyl-tRNA synthetase;       
  535::648     6e-07  36%  944 aa  SYI_SALPA RecName: Full=Isoleucyl-tRNA synthetase;       
  535::648     6e-07  36%  944 aa  SYI_SALG2 RecName: Full=Isoleucyl-tRNA synthetase;       
  535::648     6e-07  36%  944 aa  SYI_SALEP RecName: Full=Isoleucyl-tRNA synthetase;       
  535::648     6e-07  36%  944 aa  SYI_SALCH RecName: Full=Isoleucyl-tRNA synthetase;       
  659::748     6e-07  38%  999 aa  SYI_NITWN RecName: Full=Isoleucyl-tRNA synthetase;       
  593::653     6e-07  38%  938 aa  SYI_MANSM RecName: Full=Isoleucyl-tRNA synthetase;       
  565::752     6e-07  31%  957 aa  SYI_LARHH RecName: Full=Isoleucyl-tRNA synthetase;       
   58::113     6e-07  33%  937 aa  SYI_LACBA RecName: Full=Isoleucyl-tRNA synthetase;       
  587::647     6e-07  38%  941 aa  SYI_HAEIN RecName: Full=Isoleucyl-tRNA synthetase;       
  587::647     6e-07  38%  941 aa  SYI_HAEIG RecName: Full=Isoleucyl-tRNA synthetase;       
  587::647     6e-07  38%  941 aa  SYI_HAEIE RecName: Full=Isoleucyl-tRNA synthetase;       
  587::647     6e-07  38%  941 aa  SYI_HAEI8 RecName: Full=Isoleucyl-tRNA synthetase;       
   62::102     6e-07  36%  983 aa  SYI_GLOVI RecName: Full=Isoleucyl-tRNA synthetase;       
  549::692     6e-07  26% 1120 aa  SYI_EHRCJ RecName: Full=Isoleucyl-tRNA synthetase;       
  552::666     6e-07  31%  945 aa  SYI_BURVG RecName: Full=Isoleucyl-tRNA synthetase;       
  552::666     6e-07  31%  945 aa  SYI_BURTA RecName: Full=Isoleucyl-tRNA synthetase;       
  552::666     6e-07  31%  945 aa  SYI_BURS3 RecName: Full=Isoleucyl-tRNA synthetase;       
  552::666     6e-07  31%  945 aa  SYI_BURCJ RecName: Full=Isoleucyl-tRNA synthetase;       
  552::666     6e-07  31%  945 aa  SYI_BURCH RecName: Full=Isoleucyl-tRNA synthetase;       
  552::666     6e-07  31%  945 aa  SYI_BURCC RecName: Full=Isoleucyl-tRNA synthetase;       
  552::666     6e-07  31%  945 aa  SYI_BURCA RecName: Full=Isoleucyl-tRNA synthetase;       
  549::667     6e-07  36%  953 aa  SYI_AERHH RecName: Full=Isoleucyl-tRNA synthetase;       
  552::666     6e-07  31%  945 aa  SYI1_BURPS RecName: Full=Isoleucyl-tRNA synthetase 1;       
  552::666     6e-07  31%  945 aa  SYI1_BURMA RecName: Full=Isoleucyl-tRNA synthetase 1;       
   29::192     8e-07  25%  834 aa  SYL_RICCK RecName: Full=Leucyl-tRNA synthetase;       
   41::119     8e-07  37%  863 aa  SYL_LEPIN RecName: Full=Leucyl-tRNA synthetase;       
   41::119     8e-07  37%  863 aa  SYL_LEPIC RecName: Full=Leucyl-tRNA synthetase;       
   48::152     8e-07  32%  808 aa  SYL_LACPL RecName: Full=Leucyl-tRNA synthetase;       
   35::217     8e-07  21%  860 aa  SYL_HAES1 RecName: Full=Leucyl-tRNA synthetase;       
   38::633     8e-07  26%  821 aa  SYL_CAMC1 RecName: Full=Leucyl-tRNA synthetase;       
   36::121     8e-07  26%  874 aa  SYL_BRAJA RecName: Full=Leucyl-tRNA synthetase;       
   35::210     8e-07  26%  873 aa  SYL_AZOSB RecName: Full=Leucyl-tRNA synthetase;       
   35::217     8e-07  21%  860 aa  SYL_ACTSZ RecName: Full=Leucyl-tRNA synthetase;       
   35::210     8e-07  21%  834 aa  SYL_ACTP7 RecName: Full=Leucyl-tRNA synthetase;       
   32::231     8e-07  21%  897 aa  SYL_ACIAC RecName: Full=Leucyl-tRNA synthetase;       
  592::708     8e-07  34%  943 aa  SYI_PSEE4 RecName: Full=Isoleucyl-tRNA synthetase;       
  544::662     8e-07  31%  954 aa  SYI_PHOPR RecName: Full=Isoleucyl-tRNA synthetase;       
  586::646     8e-07  41%  938 aa  SYI_ERWT9 RecName: Full=Isoleucyl-tRNA synthetase;       
   46::132     8e-07  44%  779 aa  SYFB_WOLPM RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::124     8e-07  49%  787 aa  SYFB_NEIMA RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   35::129     8e-07  42%  803 aa  SYFB_CHLCH RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   33::111     1e-06  32%  949 aa  SYV_IDILO RecName: Full=Valyl-tRNA synthetase;       
  336::385     1e-06  33% 1264 aa  SYVC_RAT RecName: Full=Valyl-tRNA synthetase;       
   51::242     1e-06  25%  865 aa  SYL_SYNP6 RecName: Full=Leucyl-tRNA synthetase;       
   35::225     1e-06  23%  860 aa  SYL_SODGM RecName: Full=Leucyl-tRNA synthetase;       
   36::199     1e-06  25%  876 aa  SYL_RHIME RecName: Full=Leucyl-tRNA synthetase;       
   33::686     1e-06  32%  967 aa  SYL_PYRAB RecName: Full=Leucyl-tRNA synthetase;       
   37::219     1e-06  26%  865 aa  SYL_MARMM RecName: Full=Leucyl-tRNA synthetase;       
   35::198     1e-06  27%  866 aa  SYL_LARHH RecName: Full=Leucyl-tRNA synthetase;       
   35::630     1e-06  26%  846 aa  SYL_HELMI RecName: Full=Leucyl-tRNA synthetase;       
   35::198     1e-06  22%  861 aa  SYL_HAEDU RecName: Full=Leucyl-tRNA synthetase;       
   35::225     1e-06  23%  860 aa  SYL_ERWCT RecName: Full=Leucyl-tRNA synthetase;       
   35::225     1e-06  29%  864 aa  SYL_ALHEH RecName: Full=Leucyl-tRNA synthetase;       
   59::197     1e-06  28%  929 aa  SYI_THIDA RecName: Full=Isoleucyl-tRNA synthetase;       
  519::615     1e-06  35% 1050 aa  SYI_SULAC RecName: Full=Isoleucyl-tRNA synthetase;       
   60::100     1e-06  35%  900 aa  SYI_ONYPE RecName: Full=Isoleucyl-tRNA synthetase;       
  574::691     1e-06  30%  969 aa  SYI_CAUCR RecName: Full=Isoleucyl-tRNA synthetase;       
  545::658     1e-06  33%  939 aa  SYI_AZOSE RecName: Full=Isoleucyl-tRNA synthetase;       
  549::667     1e-06  33%  953 aa  SYI_AERS4 RecName: Full=Isoleucyl-tRNA synthetase;       
   41::196     1e-06  32% 1033 aa  SYI2_BACHK RecName: Full=Isoleucyl-tRNA synthetase 2;       
   41::196     1e-06  32% 1033 aa  SYI2_BACAN RecName: Full=Isoleucyl-tRNA synthetase 2;       
   41::125     1e-06  44%  789 aa  SYFB_ZYMMO RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
  224::447     1e-06  29%  474 aa  SYC_THENV RecName: Full=Cysteinyl-tRNA synthetase;       
   53::112     1e-06  33%  870 aa  SYV_PROAC RecName: Full=Valyl-tRNA synthetase;       
   35::226     1e-06  26%  929 aa  SYL_TRIEI RecName: Full=Leucyl-tRNA synthetase;       
   33::120     1e-06  27%  857 aa  SYL_SYNPX RecName: Full=Leucyl-tRNA synthetase;       
  618::781     1e-06  34%  859 aa  SYL_PSYIN RecName: Full=Leucyl-tRNA synthetase;       
   50::803     1e-06  24%  864 aa  SYL_PROM5 RecName: Full=Leucyl-tRNA synthetase;       
   35::225     1e-06  22%  860 aa  SYL_PECCP RecName: Full=Leucyl-tRNA synthetase;       
   63::236     1e-06  24%  848 aa  SYL_NOCSJ RecName: Full=Leucyl-tRNA synthetase;       
   35::217     1e-06  21%  861 aa  SYL_HAEIN RecName: Full=Leucyl-tRNA synthetase;       
   35::217     1e-06  21%  861 aa  SYL_HAEIG RecName: Full=Leucyl-tRNA synthetase;       
   35::217     1e-06  21%  861 aa  SYL_HAEI8 RecName: Full=Leucyl-tRNA synthetase;       
   34::733     1e-06  25%  829 aa  SYL_ANAMM RecName: Full=Leucyl-tRNA synthetase;       
   36::199     1e-06  25%  876 aa  SYL_AGRT5 RecName: Full=Leucyl-tRNA synthetase;       
   35::120     1e-06  30%  855 aa  SYL_ACAM1 RecName: Full=Leucyl-tRNA synthetase;       
  591::635     1e-06  44% 1081 aa  SYI_TETTH RecName: Full=Isoleucyl-tRNA synthetase;       
   58::113     1e-06  30%  916 aa  SYI_STAEQ RecName: Full=Isoleucyl-tRNA synthetase;       
  589::654     1e-06  36%  940 aa  SYI_SHELP RecName: Full=Isoleucyl-tRNA synthetase;       
  589::762     1e-06  28%  940 aa  SYI_SHEB9 RecName: Full=Isoleucyl-tRNA synthetase;       
  589::762     1e-06  28%  940 aa  SYI_SHEB8 RecName: Full=Isoleucyl-tRNA synthetase;       
  589::762     1e-06  28%  940 aa  SYI_SHEB5 RecName: Full=Isoleucyl-tRNA synthetase;       
  589::762     1e-06  28%  940 aa  SYI_SHEB2 RecName: Full=Isoleucyl-tRNA synthetase;       
   61::110     1e-06  33%  941 aa  SYI_PSYA2 RecName: Full=Isoleucyl-tRNA synthetase;       
  527::677     1e-06  32% 1053 aa  SYI_MYCPA RecName: Full=Isoleucyl-tRNA synthetase;       
   60::639     1e-06  31%  908 aa  SYI_MESFL RecName: Full=Isoleucyl-tRNA synthetase;       
  620::689     1e-06  34%  966 aa  SYI_CUPTR RecName: Full=Isoleucyl-tRNA synthetase;       
  575::701     1e-06  30%  971 aa  SYI_BARQU RecName: Full=Isoleucyl-tRNA synthetase;       
   41::618     1e-06  31% 1033 aa  SYI2_BACCZ RecName: Full=Isoleucyl-tRNA synthetase 2;       
   41::618     1e-06  31% 1033 aa  SYI2_BACC1 RecName: Full=Isoleucyl-tRNA synthetase 2;       
  536::607     2e-06  40%  815 aa  SYL_VESOH RecName: Full=Leucyl-tRNA synthetase;       
   33::207     2e-06  23%  876 aa  SYL_VARPS RecName: Full=Leucyl-tRNA synthetase;       
   35::773     2e-06  30%  852 aa  SYL_SYNP2 RecName: Full=Leucyl-tRNA synthetase;       
   51::242     2e-06  25%  865 aa  SYL_SYNE7 RecName: Full=Leucyl-tRNA synthetase;       
   35::198     2e-06  22%  859 aa  SYL_SHEWM RecName: Full=Leucyl-tRNA synthetase;       
   33::810     2e-06  28%  967 aa  SYL_PYRHO RecName: Full=Leucyl-tRNA synthetase;       
   32::790     2e-06  24%  868 aa  SYL_PSEE4 RecName: Full=Leucyl-tRNA synthetase;       
   46::166     2e-06  26%  858 aa  SYL_PROMP RecName: Full=Leucyl-tRNA synthetase;       
   41::119     2e-06  28%  867 aa  SYL_LEPBP RecName: Full=Leucyl-tRNA synthetase;       
   41::119     2e-06  28%  867 aa  SYL_LEPBA RecName: Full=Leucyl-tRNA synthetase;       
   35::217     2e-06  21%  860 aa  SYL_HAES2 RecName: Full=Leucyl-tRNA synthetase;       
   34::207     2e-06  26%  813 aa  SYL_FRATW RecName: Full=Leucyl-tRNA synthetase;       
   34::207     2e-06  26%  813 aa  SYL_FRATT RecName: Full=Leucyl-tRNA synthetase;       
   34::207     2e-06  26%  813 aa  SYL_FRATM RecName: Full=Leucyl-tRNA synthetase;       
   34::207     2e-06  26%  813 aa  SYL_FRAT1 RecName: Full=Leucyl-tRNA synthetase;       
   35::198     2e-06  22%  864 aa  SYL_BURP8 RecName: Full=Leucyl-tRNA synthetase;       
   35::210     2e-06  21%  861 aa  SYL_ACTPJ RecName: Full=Leucyl-tRNA synthetase;       
   35::210     2e-06  21%  861 aa  SYL_ACTP2 RecName: Full=Leucyl-tRNA synthetase;       
  538::656     2e-06  35%  948 aa  SYI_VIBVY RecName: Full=Isoleucyl-tRNA synthetase;       
  538::656     2e-06  35%  948 aa  SYI_VIBVU RecName: Full=Isoleucyl-tRNA synthetase;       
  592::657     2e-06  38%  949 aa  SYI_VIBCM RecName: Full=Isoleucyl-tRNA synthetase;       
  592::657     2e-06  38%  949 aa  SYI_VIBCH RecName: Full=Isoleucyl-tRNA synthetase;       
  592::657     2e-06  38%  949 aa  SYI_VIBC3 RecName: Full=Isoleucyl-tRNA synthetase;       
  521::638     2e-06  33%  930 aa  SYI_STRMU RecName: Full=Isoleucyl-tRNA synthetase;       
   58::113     2e-06  30%  916 aa  SYI_STAES RecName: Full=Isoleucyl-tRNA synthetase;       
   58::113     2e-06  30%  871 aa  SYI_STAEP RecName: Full=Isoleucyl-tRNA synthetase;       
  589::762     2e-06  29%  940 aa  SYI_SHESW RecName: Full=Isoleucyl-tRNA synthetase;       
  589::762     2e-06  27%  940 aa  SYI_SHESR RecName: Full=Isoleucyl-tRNA synthetase;       
  589::762     2e-06  27%  940 aa  SYI_SHESM RecName: Full=Isoleucyl-tRNA synthetase;       
  589::762     2e-06  27%  940 aa  SYI_SHESA RecName: Full=Isoleucyl-tRNA synthetase;       
  589::762     2e-06  29%  940 aa  SYI_SHEPC RecName: Full=Isoleucyl-tRNA synthetase;       
  575::677     2e-06  34%  959 aa  SYI_RALME RecName: Full=Isoleucyl-tRNA synthetase;       
  617::686     2e-06  34%  963 aa  SYI_RALEJ RecName: Full=Isoleucyl-tRNA synthetase;       
  536::657     2e-06  31%  943 aa  SYI_PSEPF RecName: Full=Isoleucyl-tRNA synthetase;       
  531::657     2e-06  31%  943 aa  SYI_PSEMY RecName: Full=Isoleucyl-tRNA synthetase;       
  592::657     2e-06  38%  943 aa  SYI_PSEAE RecName: Full=Isoleucyl-tRNA synthetase;       
  592::657     2e-06  38%  943 aa  SYI_PSEAB RecName: Full=Isoleucyl-tRNA synthetase;       
  592::657     2e-06  38%  943 aa  SYI_PSEA8 RecName: Full=Isoleucyl-tRNA synthetase;       
  592::657     2e-06  38%  943 aa  SYI_PSEA7 RecName: Full=Isoleucyl-tRNA synthetase;       
  544::702     2e-06  32%  959 aa  SYI_NOSP7 RecName: Full=Isoleucyl-tRNA synthetase;       
  530::649     2e-06  32%  911 aa  SYI_NAUPA RecName: Full=Isoleucyl-tRNA synthetase;       
   58::109     2e-06  33%  932 aa  SYI_LACLA RecName: Full=Isoleucyl-tRNA synthetase;       
   58::121     2e-06  30%  928 aa  SYI_LACJO RecName: Full=Isoleucyl-tRNA synthetase;       
   58::121     2e-06  32%  927 aa  SYI_LACH4 RecName: Full=Isoleucyl-tRNA synthetase;       
   58::640     2e-06  34%  930 aa  SYI_LACF3 RecName: Full=Isoleucyl-tRNA synthetase;       
   60::198     2e-06  30%  925 aa  SYI_CHRVO RecName: Full=Isoleucyl-tRNA synthetase;       
  565::657     2e-06  37%  943 aa  SYI_AZOVD RecName: Full=Isoleucyl-tRNA synthetase;       
  584::658     2e-06  33%  919 aa  SYI_ARCB4 RecName: Full=Isoleucyl-tRNA synthetase;       
   34::124     2e-06  41%  793 aa  SYFB_THICR RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   54::125     2e-06  42%  814 aa  SYFB_SYNPX RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   55::148     2e-06  40%  794 aa  SYFB_DECAR RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   39::111     2e-06  34%  465 aa  SYC_BURCJ RecName: Full=Cysteinyl-tRNA synthetase;       
   37::85      2e-06  35%  965 aa  SYV_JANMA RecName: Full=Valyl-tRNA synthetase;       
  352::591     2e-06  31%  940 aa  SYV_CHLFF RecName: Full=Valyl-tRNA synthetase;       
   32::120     2e-06  28%  907 aa  SYL_VEREI RecName: Full=Leucyl-tRNA synthetase;       
   33::678     2e-06  32%  967 aa  SYL_THEON RecName: Full=Leucyl-tRNA synthetase;       
   38::87      2e-06  44%  969 aa  SYL_STAMF RecName: Full=Leucyl-tRNA synthetase;       
   32::207     2e-06  21%  892 aa  SYL_RHOFD RecName: Full=Leucyl-tRNA synthetase;       
   42::205     2e-06  25%  862 aa  SYL_MAGSA RecName: Full=Leucyl-tRNA synthetase;       
   35::217     2e-06  21%  861 aa  SYL_HAEIE RecName: Full=Leucyl-tRNA synthetase;       
   54::775     2e-06  28% 1026 aa  SYI_THEAC RecName: Full=Isoleucyl-tRNA synthetase;       
  521::638     2e-06  32%  933 aa  SYI_STRPM RecName: Full=Isoleucyl-tRNA synthetase;       
  521::638     2e-06  32%  933 aa  SYI_STRP1 RecName: Full=Isoleucyl-tRNA synthetase;       
  589::654     2e-06  36%  940 aa  SYI_SHEWM RecName: Full=Isoleucyl-tRNA synthetase;       
  533::759     2e-06  30%  938 aa  SYI_SERP5 RecName: Full=Isoleucyl-tRNA synthetase;       
  575::677     2e-06  32%  959 aa  SYI_RALPJ RecName: Full=Isoleucyl-tRNA synthetase;       
  617::681     2e-06  35%  964 aa  SYI_RALEH RecName: Full=Isoleucyl-tRNA synthetase;       
  592::657     2e-06  38%  943 aa  SYI_PSEPK RecName: Full=Isoleucyl-tRNA synthetase;       
  592::657     2e-06  38%  943 aa  SYI_PSEPG RecName: Full=Isoleucyl-tRNA synthetase;       
  592::657     2e-06  38%  943 aa  SYI_PSEP1 RecName: Full=Isoleucyl-tRNA synthetase;       
  585::645     2e-06  39%  936 aa  SYI_PROMH RecName: Full=Isoleucyl-tRNA synthetase;       
   58::624     2e-06  34%  931 aa  SYI_LACRJ RecName: Full=Isoleucyl-tRNA synthetase;       
  531::669     2e-06  32%  935 aa  SYI_HAEDU RecName: Full=Isoleucyl-tRNA synthetase;       
  487::533     2e-06  43%  628 aa  SYI_ANTLO RecName: Full=Isoleucyl-tRNA synthetase;       
   48::131     2e-06  46%  815 aa  SYFB_RALEJ RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   45::124     2e-06  36%  793 aa  SYFB_NITOC RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::124     2e-06  44%  798 aa  SYFB_MAGSA RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::124     2e-06  34%  798 aa  SYFB_FUSNN RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   27::305     2e-06  30%  480 aa  SYC_THET8 RecName: Full=Cysteinyl-tRNA synthetase;       
   37::294     2e-06  31%  468 aa  SYC_MYCA1 RecName: Full=Cysteinyl-tRNA synthetase;       
   37::295     2e-06  28%  457 aa  SYC_LARHH RecName: Full=Cysteinyl-tRNA synthetase;       
   39::111     2e-06  34%  465 aa  SYC_BURM1 RecName: Full=Cysteinyl-tRNA synthetase;       
   39::111     2e-06  34%  465 aa  SYC_BURCH RecName: Full=Cysteinyl-tRNA synthetase;       
   39::111     2e-06  34%  465 aa  SYC_BURCC RecName: Full=Cysteinyl-tRNA synthetase;       
   39::111     2e-06  34%  465 aa  SYC_BURCA RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     2e-06  32%  461 aa  SYC_AZOSE RecName: Full=Cysteinyl-tRNA synthetase;       
   37::294     2e-06  31%  468 aa  SYC1_MYCPA RecName: Full=Cysteinyl-tRNA synthetase 1;       
   54::102     3e-06  35%  960 aa  SYV_BORPA RecName: Full=Valyl-tRNA synthetase;       
   54::102     3e-06  35%  960 aa  SYV_BORBR RecName: Full=Valyl-tRNA synthetase;       
   35::225     3e-06  23%  863 aa  SYL_SHEFN RecName: Full=Leucyl-tRNA synthetase;       
  630::796     3e-06  28%  878 aa  SYL_RHOPS RecName: Full=Leucyl-tRNA synthetase;       
   33::686     3e-06  33%  967 aa  SYL_PYRFU RecName: Full=Leucyl-tRNA synthetase;       
   35::785     3e-06  27%  868 aa  SYL_PSEPK RecName: Full=Leucyl-tRNA synthetase;       
   35::785     3e-06  27%  868 aa  SYL_PSEPG RecName: Full=Leucyl-tRNA synthetase;       
   35::785     3e-06  27%  868 aa  SYL_PSEP1 RecName: Full=Leucyl-tRNA synthetase;       
   25::670     3e-06  29%  937 aa  SYL_METTH RecName: Full=Leucyl-tRNA synthetase;       
   46::211     3e-06  26%  855 aa  SYL_HYPNA RecName: Full=Leucyl-tRNA synthetase;       
   35::225     3e-06  22%  860 aa  SYL_ERWT9 RecName: Full=Leucyl-tRNA synthetase;       
   33::131     3e-06  27%  944 aa  SYL_BACTN RecName: Full=Leucyl-tRNA synthetase;       
   34::196     3e-06  27%  821 aa  SYL_ARCB4 RecName: Full=Leucyl-tRNA synthetase;       
  521::638     3e-06  32%  933 aa  SYI_STRP8 RecName: Full=Isoleucyl-tRNA synthetase;       
  521::638     3e-06  32%  933 aa  SYI_STRP6 RecName: Full=Isoleucyl-tRNA synthetase;       
  592::657     3e-06  38%  943 aa  SYI_PSEPW RecName: Full=Isoleucyl-tRNA synthetase;       
  534::658     3e-06  29%  930 aa  SYI_HELHP RecName: Full=Isoleucyl-tRNA synthetase;       
  534::651     3e-06  31%  936 aa  SYI_COXBU RecName: Full=Isoleucyl-tRNA synthetase;       
  534::651     3e-06  31%  936 aa  SYI_COXBR RecName: Full=Isoleucyl-tRNA synthetase;       
  534::651     3e-06  31%  936 aa  SYI_COXBN RecName: Full=Isoleucyl-tRNA synthetase;       
  534::651     3e-06  31%  936 aa  SYI_COXB2 RecName: Full=Isoleucyl-tRNA synthetase;       
  534::651     3e-06  31%  936 aa  SYI_COXB1 RecName: Full=Isoleucyl-tRNA synthetase;       
  541::655     3e-06  31%  919 aa  SYI_CAMC5 RecName: Full=Isoleucyl-tRNA synthetase;       
  639::719     3e-06  36% 1002 aa  SYI_BRAJA RecName: Full=Isoleucyl-tRNA synthetase;       
  534::652     3e-06  34%  938 aa  SYI_ACTP7 RecName: Full=Isoleucyl-tRNA synthetase;       
  534::652     3e-06  34%  938 aa  SYI_ACTP2 RecName: Full=Isoleucyl-tRNA synthetase;       
   68::108     3e-06  34%  945 aa  SYI_ACIAD RecName: Full=Isoleucyl-tRNA synthetase;       
   45::124     3e-06  40%  800 aa  SYFB_STAEQ RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::124     3e-06  44%  800 aa  SYFB_RHORT RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   48::129     3e-06  41%  810 aa  SYFB_CHLTE RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   48::127     3e-06  46%  794 aa  SYFB_CHLAB RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   36::308     3e-06  29%  460 aa  SYC_THESQ RecName: Full=Cysteinyl-tRNA synthetase;       
   36::308     3e-06  29%  460 aa  SYC_THEP1 RecName: Full=Cysteinyl-tRNA synthetase;       
   38::299     3e-06  28%  461 aa  SYC_DELAS RecName: Full=Cysteinyl-tRNA synthetase;       
   39::111     3e-06  34%  465 aa  SYC_BURA4 RecName: Full=Cysteinyl-tRNA synthetase;       
   39::111     3e-06  34%  465 aa  SYC2_BURS3 RecName: Full=Cysteinyl-tRNA synthetase 2;       
   37::115     4e-06  35%  918 aa  SYV_NITEU RecName: Full=Valyl-tRNA synthetase;       
   31::570     4e-06  34%  955 aa  SYV_BUCAI RecName: Full=Valyl-tRNA synthetase;       
  137::670     4e-06  39% 1060 aa  SYVM_MOUSE RecName: Full=Valyl-tRNA synthetase, mitochondrial;     
  285::334     4e-06  38% 1217 aa  SYVC_TAKRU RecName: Full=Valyl-tRNA synthetase;       
  335::384     4e-06  32% 1263 aa  SYVC_MOUSE RecName: Full=Valyl-tRNA synthetase;       
   35::225     4e-06  22%  858 aa  SYL_VIBCH RecName: Full=Leucyl-tRNA synthetase;       
   35::225     4e-06  22%  858 aa  SYL_VIBC3 RecName: Full=Leucyl-tRNA synthetase;       
   35::120     4e-06  27%  869 aa  SYL_SYNY3 RecName: Full=Leucyl-tRNA synthetase;       
   43::206     4e-06  23%  904 aa  SYL_ROSCS RecName: Full=Leucyl-tRNA synthetase;       
   49::132     4e-06  30%  950 aa  SYL_RHOBA RecName: Full=Leucyl-tRNA synthetase;       
   39::211     4e-06  20%  886 aa  SYL_POLSJ RecName: Full=Leucyl-tRNA synthetase;       
   42::205     4e-06  22%  897 aa  SYL_METPP RecName: Full=Leucyl-tRNA synthetase;       
   48::806     4e-06  27%  875 aa  SYL_GRABC RecName: Full=Leucyl-tRNA synthetase;       
   35::198     4e-06  23%  864 aa  SYL_BURVG RecName: Full=Leucyl-tRNA synthetase;       
   35::198     4e-06  23%  864 aa  SYL_BURS3 RecName: Full=Leucyl-tRNA synthetase;       
   35::198     4e-06  23%  864 aa  SYL_BURCM RecName: Full=Leucyl-tRNA synthetase;       
   35::198     4e-06  23%  864 aa  SYL_BURCJ RecName: Full=Leucyl-tRNA synthetase;       
   35::198     4e-06  23%  864 aa  SYL_BURCH RecName: Full=Leucyl-tRNA synthetase;       
   35::198     4e-06  23%  864 aa  SYL_BURCC RecName: Full=Leucyl-tRNA synthetase;       
   35::198     4e-06  23%  864 aa  SYL_BURCA RecName: Full=Leucyl-tRNA synthetase;       
   35::198     4e-06  23%  864 aa  SYL_BURA4 RecName: Full=Leucyl-tRNA synthetase;       
  644::829     4e-06  29%  886 aa  SYL_BART1 RecName: Full=Leucyl-tRNA synthetase;       
   33::119     4e-06  28%  943 aa  SYL_BACFR RecName: Full=Leucyl-tRNA synthetase;       
   33::119     4e-06  28%  943 aa  SYL_BACFN RecName: Full=Leucyl-tRNA synthetase;       
   34::736     4e-06  33%  923 aa  SYL_AMOA5 RecName: Full=Leucyl-tRNA synthetase;       
   44::663     4e-06  26%  864 aa  SYL_ACICJ RecName: Full=Leucyl-tRNA synthetase;       
  540::658     4e-06  33%  919 aa  SYI_SULDN RecName: Full=Isoleucyl-tRNA synthetase;       
  589::762     4e-06  27%  940 aa  SYI_SHEON RecName: Full=Isoleucyl-tRNA synthetase;       
  577::637     4e-06  34%  922 aa  SYI_RUTMC RecName: Full=Isoleucyl-tRNA synthetase;       
   59::197     4e-06  31%  943 aa  SYI_PSEU5 RecName: Full=Isoleucyl-tRNA synthetase;       
  581::656     4e-06  34%  942 aa  SYI_PSEA6 RecName: Full=Isoleucyl-tRNA synthetase;       
   60::639     4e-06  31%  915 aa  SYI_MYCMS RecName: Full=Isoleucyl-tRNA synthetase;       
   58::625     4e-06  36%  931 aa  SYI_LACS1 RecName: Full=Isoleucyl-tRNA synthetase;       
   58::121     4e-06  31%  927 aa  SYI_LACAC RecName: Full=Isoleucyl-tRNA synthetase;       
   75::213     4e-06  28%  959 aa  SYI_HERAR RecName: Full=Isoleucyl-tRNA synthetase;       
  588::651     4e-06  39%  932 aa  SYI_AZOSB RecName: Full=Isoleucyl-tRNA synthetase;       
   45::124     4e-06  40%  800 aa  SYFB_STAES RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::126     4e-06  42%  792 aa  SYFB_NITMU RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::124     4e-06  49%  787 aa  SYFB_NEIG1 RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   48::137     4e-06  41%  793 aa  SYFB_CHLCV RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   57::154     4e-06  38%  820 aa  SYFB_BACTN RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   36::308     4e-06  29%  460 aa  SYC_THEMA RecName: Full=Cysteinyl-tRNA synthetase;       
   39::111     4e-06  34%  465 aa  SYC_BURVG RecName: Full=Cysteinyl-tRNA synthetase;       
   39::111     4e-06  34%  465 aa  SYC_BURCM RecName: Full=Cysteinyl-tRNA synthetase;       
   83::174     5e-06  44%  201 aa  YTPR_BACSU RecName: Full=Putative tRNA-binding protein
   37::115     5e-06  35%  917 aa  SYV_NITEC RecName: Full=Valyl-tRNA synthetase;       
   35::83      5e-06  30%  945 aa  SYV_NEIMB RecName: Full=Valyl-tRNA synthetase;       
  137::187     5e-06  37% 1062 aa  SYVM_PIG RecName: Full=Valyl-tRNA synthetase, mitochondrial;       
   41::665     5e-06  27%  846 aa  SYL_ZYMMO RecName: Full=Leucyl-tRNA synthetase;       
   36::806     5e-06  28%  873 aa  SYL_SYNJA RecName: Full=Leucyl-tRNA synthetase;       
   35::198     5e-06  20%  860 aa  SYL_SHISS RecName: Full=Leucyl-tRNA synthetase;       
   35::198     5e-06  20%  860 aa  SYL_SHIFL RecName: Full=Leucyl-tRNA synthetase;       
   35::198     5e-06  20%  860 aa  SYL_SHIDS RecName: Full=Leucyl-tRNA synthetase;       
   35::198     5e-06  20%  860 aa  SYL_SHIBS RecName: Full=Leucyl-tRNA synthetase;       
   35::198     5e-06  20%  860 aa  SYL_SHIB3 RecName: Full=Leucyl-tRNA synthetase;       
   35::805     5e-06  24%  863 aa  SYL_SHELP RecName: Full=Leucyl-tRNA synthetase;       
   35::198     5e-06  20%  860 aa  SYL_SALAR RecName: Full=Leucyl-tRNA synthetase;       
   43::206     5e-06  23%  904 aa  SYL_ROSS1 RecName: Full=Leucyl-tRNA synthetase;       
   36::199     5e-06  26%  882 aa  SYL_RHOPB RecName: Full=Leucyl-tRNA synthetase;       
   33::207     5e-06  21%  888 aa  SYL_POLNA RecName: Full=Leucyl-tRNA synthetase;       
   35::198     5e-06  20%  860 aa  SYL_KLEP7 RecName: Full=Leucyl-tRNA synthetase;       
   35::198     5e-06  20%  860 aa  SYL_KLEP3 RecName: Full=Leucyl-tRNA synthetase;       
   35::198     5e-06  20%  860 aa  SYL_ESCF3 RecName: Full=Leucyl-tRNA synthetase;       
   35::198     5e-06  20%  860 aa  SYL_ENTS8 RecName: Full=Leucyl-tRNA synthetase;       
   35::198     5e-06  20%  894 aa  SYL_ENT38 RecName: Full=Leucyl-tRNA synthetase;       
   35::198     5e-06  20%  860 aa  SYL_ECOUT RecName: Full=Leucyl-tRNA synthetase;       
   35::198     5e-06  20%  860 aa  SYL_ECOSM RecName: Full=Leucyl-tRNA synthetase;       
   35::198     5e-06  20%  860 aa  SYL_ECOSE RecName: Full=Leucyl-tRNA synthetase;       
   35::198     5e-06  20%  860 aa  SYL_ECOLI RecName: Full=Leucyl-tRNA synthetase;       
   35::198     5e-06  20%  860 aa  SYL_ECOLC RecName: Full=Leucyl-tRNA synthetase;       
   35::198     5e-06  20%  860 aa  SYL_ECOL6 RecName: Full=Leucyl-tRNA synthetase;       
   35::198     5e-06  20%  860 aa  SYL_ECOL5 RecName: Full=Leucyl-tRNA synthetase;       
   35::198     5e-06  20%  860 aa  SYL_ECOK1 RecName: Full=Leucyl-tRNA synthetase;       
   35::198     5e-06  20%  860 aa  SYL_ECOHS RecName: Full=Leucyl-tRNA synthetase;       
   35::198     5e-06  20%  860 aa  SYL_ECOBW RecName: Full=Leucyl-tRNA synthetase;       
   35::198     5e-06  20%  860 aa  SYL_ECO8A RecName: Full=Leucyl-tRNA synthetase;       
   35::198     5e-06  20%  860 aa  SYL_ECO81 RecName: Full=Leucyl-tRNA synthetase;       
   35::198     5e-06  20%  860 aa  SYL_ECO7I RecName: Full=Leucyl-tRNA synthetase;       
   35::198     5e-06  20%  860 aa  SYL_ECO5E RecName: Full=Leucyl-tRNA synthetase;       
   35::198     5e-06  20%  860 aa  SYL_ECO57 RecName: Full=Leucyl-tRNA synthetase;       
   35::198     5e-06  20%  860 aa  SYL_ECO55 RecName: Full=Leucyl-tRNA synthetase;       
   35::198     5e-06  20%  860 aa  SYL_ECO45 RecName: Full=Leucyl-tRNA synthetase;       
   35::198     5e-06  20%  860 aa  SYL_ECO27 RecName: Full=Leucyl-tRNA synthetase;       
   35::198     5e-06  20%  860 aa  SYL_ECO24 RecName: Full=Leucyl-tRNA synthetase;       
   35::788     5e-06  27%  858 aa  SYL_CYAP4 RecName: Full=Leucyl-tRNA synthetase;       
   35::198     5e-06  20%  860 aa  SYL_CITK8 RecName: Full=Leucyl-tRNA synthetase;       
   41::215     5e-06  21%  885 aa  SYL_BORPE RecName: Full=Leucyl-tRNA synthetase;       
   41::215     5e-06  21%  885 aa  SYL_BORPA RecName: Full=Leucyl-tRNA synthetase;       
   41::215     5e-06  21%  885 aa  SYL_BORBR RecName: Full=Leucyl-tRNA synthetase;       
   34::74      5e-06  41%  934 aa  SYL1_SULSO RecName: Full=Leucyl-tRNA synthetase 1;       
  551::667     5e-06  32%  943 aa  SYI_XANC5 RecName: Full=Isoleucyl-tRNA synthetase;       
  551::667     5e-06  32%  943 aa  SYI_XANAC RecName: Full=Isoleucyl-tRNA synthetase;       
  533::650     5e-06  30%  937 aa  SYI_THISH RecName: Full=Isoleucyl-tRNA synthetase;       
  592::657     5e-06  36%  943 aa  SYI_PSEF5 RecName: Full=Isoleucyl-tRNA synthetase;       
   58::98      5e-06  35%  928 aa  SYI_LACCB RecName: Full=Isoleucyl-tRNA synthetase;       
   58::98      5e-06  35%  928 aa  SYI_LACC3 RecName: Full=Isoleucyl-tRNA synthetase;       
  540::654     5e-06  32%  921 aa  SYI_CAMHC RecName: Full=Isoleucyl-tRNA synthetase;       
  586::648     5e-06  38%  941 aa  SYI_BUCCC RecName: Full=Isoleucyl-tRNA synthetase;       
   34::131     5e-06  43%  805 aa  SYFB_RHOS4 RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   34::126     5e-06  47%  803 aa  SYFB_RHOPA RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   38::314     5e-06  26%  472 aa  SYC_SYNP2 RecName: Full=Cysteinyl-tRNA synthetase;       
   39::111     5e-06  30%  465 aa  SYC_BURPS RecName: Full=Cysteinyl-tRNA synthetase;       
   39::111     5e-06  30%  465 aa  SYC_BURP6 RecName: Full=Cysteinyl-tRNA synthetase;       
   39::111     5e-06  30%  465 aa  SYC_BURP1 RecName: Full=Cysteinyl-tRNA synthetase;       
   39::111     5e-06  30%  465 aa  SYC_BURP0 RecName: Full=Cysteinyl-tRNA synthetase;       
   39::111     5e-06  30%  465 aa  SYC_BURMS RecName: Full=Cysteinyl-tRNA synthetase;       
   39::111     5e-06  30%  465 aa  SYC_BURMA RecName: Full=Cysteinyl-tRNA synthetase;       
   39::111     5e-06  30%  465 aa  SYC_BURM9 RecName: Full=Cysteinyl-tRNA synthetase;       
   39::111     5e-06  30%  465 aa  SYC_BURM7 RecName: Full=Cysteinyl-tRNA synthetase;       
   26::370     5e-06  33%  472 aa  SYC_AERPE RecName: Full=Cysteinyl-tRNA synthetase;       
   36::84      6e-06  31%  944 aa  SYV_XANAC RecName: Full=Valyl-tRNA synthetase;       
   41::89      6e-06  36%  926 aa  SYV_NITMU RecName: Full=Valyl-tRNA synthetase;       
  435::551     6e-06  32%  919 aa  SYV_FRATT RecName: Full=Valyl-tRNA synthetase;       
   48::136     6e-06  30%  878 aa  SYL_SYNPW RecName: Full=Leucyl-tRNA synthetase;       
   36::805     6e-06  29%  882 aa  SYL_SYNJB RecName: Full=Leucyl-tRNA synthetase;       
   36::673     6e-06  25%  876 aa  SYL_RHILW RecName: Full=Leucyl-tRNA synthetase;       
   32::785     6e-06  25%  868 aa  SYL_PSEF5 RecName: Full=Leucyl-tRNA synthetase;       
   35::802     6e-06  24%  860 aa  SYL_PROMH RecName: Full=Leucyl-tRNA synthetase;       
   45::674     6e-06  27%  870 aa  SYL_PROMA RecName: Full=Leucyl-tRNA synthetase;       
  630::826     6e-06  29%  883 aa  SYL_NITWN RecName: Full=Leucyl-tRNA synthetase;       
  627::746     6e-06  31%  863 aa  SYL_JANSC RecName: Full=Leucyl-tRNA synthetase;       
   30::119     6e-06  31%  944 aa  SYL_BACV8 RecName: Full=Leucyl-tRNA synthetase;       
   84::742     6e-06  25%  903 aa  SYLM_PONAB RecName: Full=Probable leucyl-tRNA synthetase,
   84::765     6e-06  25%  903 aa  SYLM_HUMAN RecName: Full=Probable leucyl-tRNA synthetase,
   29::96      6e-06  32%  944 aa  SYL2_SULTO RecName: Full=Leucyl-tRNA synthetase 2;       
   36::673     6e-06  25%  876 aa  SYL2_RHIL3 RecName: Full=Leucyl-tRNA synthetase 2;       
  602::667     6e-06  33%  943 aa  SYI_XANOR RecName: Full=Isoleucyl-tRNA synthetase;       
  602::667     6e-06  33%  943 aa  SYI_XANOM RecName: Full=Isoleucyl-tRNA synthetase;       
  602::667     6e-06  33%  943 aa  SYI_XANCP RecName: Full=Isoleucyl-tRNA synthetase;       
  602::667     6e-06  33%  943 aa  SYI_XANCB RecName: Full=Isoleucyl-tRNA synthetase;       
  602::667     6e-06  33%  943 aa  SYI_XANC8 RecName: Full=Isoleucyl-tRNA synthetase;       
  521::638     6e-06  31%  933 aa  SYI_STRP3 RecName: Full=Isoleucyl-tRNA synthetase;       
  589::654     6e-06  36%  940 aa  SYI_SHEPW RecName: Full=Isoleucyl-tRNA synthetase;       
  565::657     6e-06  37%  943 aa  SYI_PSEU2 RecName: Full=Isoleucyl-tRNA synthetase;       
  565::657     6e-06  37%  943 aa  SYI_PSESM RecName: Full=Isoleucyl-tRNA synthetase;       
  565::657     6e-06  37%  943 aa  SYI_PSE14 RecName: Full=Isoleucyl-tRNA synthetase;       
  535::649     6e-06  31%  918 aa  SYI_NITSB RecName: Full=Isoleucyl-tRNA synthetase;       
   58::98      6e-06  33%  939 aa  SYI_METCA RecName: Full=Isoleucyl-tRNA synthetase;       
   72::210     6e-06  27%  958 aa  SYI_JANMA RecName: Full=Isoleucyl-tRNA synthetase;       
  536::650     6e-06  32%  921 aa  SYI_HELAH RecName: Full=Isoleucyl-tRNA synthetase;       
  465::620     6e-06  30%  926 aa  SYI_ENTFA RecName: Full=Isoleucyl-tRNA synthetase;       
   52::99      6e-06  35% 1054 aa  SYI_COREF RecName: Full=Isoleucyl-tRNA synthetase;       
  540::654     6e-06  32%  921 aa  SYI_CAMLR RecName: Full=Isoleucyl-tRNA synthetase;       
   46::145     6e-06  38%  796 aa  SYFB_NOVAD RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   49::127     6e-06  41%  790 aa  SYFB_CHLTR RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   37::295     6e-06  32%  455 aa  SYC_METFK RecName: Full=Cysteinyl-tRNA synthetase;       
   55::602     8e-06  34%  984 aa  SYV_PSYA2 RecName: Full=Valyl-tRNA synthetase;       
   54::102     8e-06  36%  960 aa  SYV_BORPE RecName: Full=Valyl-tRNA synthetase;       
   35::802     8e-06  24%  860 aa  SYL_YERPY RecName: Full=Leucyl-tRNA synthetase;       
   35::802     8e-06  24%  860 aa  SYL_YERPS RecName: Full=Leucyl-tRNA synthetase;       
   35::802     8e-06  24%  860 aa  SYL_YERPP RecName: Full=Leucyl-tRNA synthetase;       
   35::802     8e-06  24%  860 aa  SYL_YERPN RecName: Full=Leucyl-tRNA synthetase;       
   35::802     8e-06  24%  860 aa  SYL_YERPG RecName: Full=Leucyl-tRNA synthetase;       
   35::802     8e-06  24%  860 aa  SYL_YERPE RecName: Full=Leucyl-tRNA synthetase;       
   35::802     8e-06  24%  860 aa  SYL_YERPB RecName: Full=Leucyl-tRNA synthetase;       
   35::802     8e-06  24%  860 aa  SYL_YERPA RecName: Full=Leucyl-tRNA synthetase;       
   35::802     8e-06  24%  860 aa  SYL_YERP3 RecName: Full=Leucyl-tRNA synthetase;       
   36::195     8e-06  29%  835 aa  SYL_SPHWW RecName: Full=Leucyl-tRNA synthetase;       
   35::802     8e-06  24%  860 aa  SYL_SERP5 RecName: Full=Leucyl-tRNA synthetase;       
   35::198     8e-06  21%  860 aa  SYL_SALTY RecName: Full=Leucyl-tRNA synthetase;       
   35::198     8e-06  21%  860 aa  SYL_SALSV RecName: Full=Leucyl-tRNA synthetase;       
   35::198     8e-06  21%  860 aa  SYL_SALPK RecName: Full=Leucyl-tRNA synthetase;       
   35::198     8e-06  21%  860 aa  SYL_SALPC RecName: Full=Leucyl-tRNA synthetase;       
   35::198     8e-06  21%  860 aa  SYL_SALPB RecName: Full=Leucyl-tRNA synthetase;       
   35::198     8e-06  21%  860 aa  SYL_SALPA RecName: Full=Leucyl-tRNA synthetase;       
   35::198     8e-06  21%  860 aa  SYL_SALNS RecName: Full=Leucyl-tRNA synthetase;       
   35::198     8e-06  21%  860 aa  SYL_SALHS RecName: Full=Leucyl-tRNA synthetase;       
   35::198     8e-06  21%  860 aa  SYL_SALG2 RecName: Full=Leucyl-tRNA synthetase;       
   35::198     8e-06  21%  860 aa  SYL_SALEP RecName: Full=Leucyl-tRNA synthetase;       
   35::198     8e-06  21%  860 aa  SYL_SALDC RecName: Full=Leucyl-tRNA synthetase;       
   35::198     8e-06  21%  860 aa  SYL_SALCH RecName: Full=Leucyl-tRNA synthetase;       
   35::198     8e-06  21%  860 aa  SYL_SALA4 RecName: Full=Leucyl-tRNA synthetase;       
   29::211     8e-06  26%  835 aa  SYL_RICFE RecName: Full=Leucyl-tRNA synthetase;       
   28::751     8e-06  25%  831 aa  SYL_RICBR RecName: Full=Leucyl-tRNA synthetase;       
   34::210     8e-06  23%  873 aa  SYL_RHOS5 RecName: Full=Leucyl-tRNA synthetase;       
   35::198     8e-06  20%  860 aa  SYL_PASMU RecName: Full=Leucyl-tRNA synthetase;       
   35::225     8e-06  22%  868 aa  SYL_NITEC RecName: Full=Leucyl-tRNA synthetase;       
   35::198     8e-06  27%  823 aa  SYL_LEGPL RecName: Full=Leucyl-tRNA synthetase;       
   35::198     8e-06  27%  823 aa  SYL_LEGPH RecName: Full=Leucyl-tRNA synthetase;       
   35::198     8e-06  27%  823 aa  SYL_LEGPC RecName: Full=Leucyl-tRNA synthetase;       
   35::198     8e-06  27%  823 aa  SYL_LEGPA RecName: Full=Leucyl-tRNA synthetase;       
   34::207     8e-06  26%  813 aa  SYL_FRATO RecName: Full=Leucyl-tRNA synthetase;       
   34::224     8e-06  26%  813 aa  SYL_FRATN RecName: Full=Leucyl-tRNA synthetase;       
   34::207     8e-06  26%  813 aa  SYL_FRATH RecName: Full=Leucyl-tRNA synthetase;       
   34::207     8e-06  26%  813 aa  SYL_FRATF RecName: Full=Leucyl-tRNA synthetase;       
   34::224     8e-06  25%  813 aa  SYL_FRAP2 RecName: Full=Leucyl-tRNA synthetase;       
   35::198     8e-06  22%  861 aa  SYL_CAUSK RecName: Full=Leucyl-tRNA synthetase;       
   35::198     8e-06  22%  861 aa  SYL_CAUCR RecName: Full=Leucyl-tRNA synthetase;       
   35::198     8e-06  22%  861 aa  SYL_CAUCN RecName: Full=Leucyl-tRNA synthetase;       
   34::777     8e-06  26%  842 aa  SYL_BORHD RecName: Full=Leucyl-tRNA synthetase;       
   29::751     8e-06  32%  944 aa  SYL2_SULSO RecName: Full=Leucyl-tRNA synthetase 2;       
   60::100     8e-06  35%  943 aa  SYI_XYLFT RecName: Full=Isoleucyl-tRNA synthetase;       
   60::100     8e-06  35%  943 aa  SYI_XYLFM RecName: Full=Isoleucyl-tRNA synthetase;       
   60::100     8e-06  35%  943 aa  SYI_XYLFA RecName: Full=Isoleucyl-tRNA synthetase;       
   60::100     8e-06  35%  943 aa  SYI_XYLF2 RecName: Full=Isoleucyl-tRNA synthetase;       
   54::246     8e-06  29% 1028 aa  SYI_THEVO RecName: Full=Isoleucyl-tRNA synthetase;       
  575::713     8e-06  31%  930 aa  SYI_STRGC RecName: Full=Isoleucyl-tRNA synthetase;       
  527::667     8e-06  30% 1094 aa  SYI_RICFE RecName: Full=Isoleucyl-tRNA synthetase;       
  547::656     8e-06  32% 1092 aa  SYI_RICAE RecName: Full=Isoleucyl-tRNA synthetase;       
  593::652     8e-06  37%  944 aa  SYI_PSYIN RecName: Full=Isoleucyl-tRNA synthetase;       
   58::121     8e-06  32%  931 aa  SYI_LACDB RecName: Full=Isoleucyl-tRNA synthetase;       
   58::121     8e-06  32%  931 aa  SYI_LACDA RecName: Full=Isoleucyl-tRNA synthetase;       
   98::681     8e-06  38%  993 aa  SYIM_MACFA RecName: Full=Isoleucyl-tRNA synthetase, mitochondrial; 
  117::700     8e-06  38% 1012 aa  SYIM_HUMAN RecName: Full=Isoleucyl-tRNA synthetase, mitochondrial; 
   44::146     8e-06  31%  801 aa  SYFB_GEOMG RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::124     8e-06  41%  785 aa  SYFB_CHRVO RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   49::127     8e-06  41%  790 aa  SYFB_CHLTA RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   27::318     8e-06  30%  469 aa  SYC_THEAB RecName: Full=Cysteinyl-tRNA synthetase;       
  170::710     1e-05  34% 1108 aa  SYV_ARATH RecName: Full=Valyl-tRNA synthetase;       
  137::670     1e-05  38% 1065 aa  SYVM_RAT RecName: Full=Valyl-tRNA synthetase, mitochondrial;       
   35::225     1e-05  23%  860 aa  SYL_YERE8 RecName: Full=Leucyl-tRNA synthetase;       
   53::815     1e-05  25%  875 aa  SYL_SYNSC RecName: Full=Leucyl-tRNA synthetase;       
   36::115     1e-05  30%  946 aa  SYL_PYRCJ RecName: Full=Leucyl-tRNA synthetase;       
   35::225     1e-05  25%  868 aa  SYL_PSEU2 RecName: Full=Leucyl-tRNA synthetase;       
   35::231     1e-05  21%  910 aa  SYL_ACISJ RecName: Full=Leucyl-tRNA synthetase;       
   49::100     1e-05  32%  940 aa  SYI_WIGBR RecName: Full=Isoleucyl-tRNA synthetase;       
  575::797     1e-05  26%  930 aa  SYI_STRSV RecName: Full=Isoleucyl-tRNA synthetase;       
  589::654     1e-05  35%  940 aa  SYI_SHEHH RecName: Full=Isoleucyl-tRNA synthetase;       
  589::648     1e-05  38%  940 aa  SYI_SHEAM RecName: Full=Isoleucyl-tRNA synthetase;       
  547::656     1e-05  32% 1092 aa  SYI_RICPU RecName: Full=Isoleucyl-tRNA synthetase;       
  547::656     1e-05  32% 1092 aa  SYI_RICCN RecName: Full=Isoleucyl-tRNA synthetase;       
  588::697     1e-05  32% 1108 aa  SYI_RICBR RecName: Full=Isoleucyl-tRNA synthetase;       
  588::697     1e-05  32% 1108 aa  SYI_RICB8 RecName: Full=Isoleucyl-tRNA synthetase;       
  661::718     1e-05  40% 1005 aa  SYI_RHOPA RecName: Full=Isoleucyl-tRNA synthetase;       
  601::665     1e-05  36% 1042 aa  SYI_NOCFA RecName: Full=Isoleucyl-tRNA synthetase;       
  537::649     1e-05  33%  940 aa  SYI_NITOC RecName: Full=Isoleucyl-tRNA synthetase;       
  586::655     1e-05  31%  953 aa  SYI_COLP3 RecName: Full=Isoleucyl-tRNA synthetase;       
   51::89      1e-05  44% 1038 aa  SYI_CLONN RecName: Full=Isoleucyl-tRNA synthetase;       
   51::89      1e-05  34% 1035 aa  SYI_CLOAB RecName: Full=Isoleucyl-tRNA synthetase;       
   59::124     1e-05  31%  941 aa  SYI_ALHEH RecName: Full=Isoleucyl-tRNA synthetase;       
  617::682     1e-05  36%  967 aa  SYI2_BURPS RecName: Full=Isoleucyl-tRNA synthetase 2;       
   59::197     1e-05  30%  967 aa  SYI2_BURMA RecName: Full=Isoleucyl-tRNA synthetase 2;       
  536::708     1e-05  32%  943 aa  SYI1_PSEFL RecName: Full=Isoleucyl-tRNA synthetase 1;       
   47::143     1e-05  38%  792 aa  SYFB_XANOR RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::143     1e-05  38%  792 aa  SYFB_XANOM RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::125     1e-05  42%  825 aa  SYFB_SYNJB RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::123     1e-05  32%  804 aa  SYFB_SYNAS RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   45::124     1e-05  41%  800 aa  SYFB_STAAU RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   45::124     1e-05  41%  800 aa  SYFB_STAAR RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   45::124     1e-05  41%  800 aa  SYFB_STAAN RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   45::124     1e-05  41%  800 aa  SYFB_STAAM RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   45::124     1e-05  41%  800 aa  SYFB_STAAC RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   45::124     1e-05  41%  800 aa  SYFB_STAAB RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   45::124     1e-05  41%  800 aa  SYFB_STAA3 RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   48::127     1e-05  40%  792 aa  SYFB_CHLPN RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   58::131     1e-05  32%  525 aa  SYC_SYNJB RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     1e-05  30%  461 aa  SYC_ENTS8 RecName: Full=Cysteinyl-tRNA synthetase;       
   39::111     1e-05  33%  465 aa  SYC_BURXL RecName: Full=Cysteinyl-tRNA synthetase;       
   39::111     1e-05  30%  465 aa  SYC_BURTA RecName: Full=Cysteinyl-tRNA synthetase;       
   33::331     1e-05  36%  467 aa  SYC1_NOCFA RecName: Full=Cysteinyl-tRNA synthetase 1;       
   41::120     1e-05  33%  954 aa  SYV_PASMU RecName: Full=Valyl-tRNA synthetase;       
  120::168     1e-05  34% 1050 aa  SYV_CAEEL RecName: Full=Valyl-tRNA synthetase;       
  137::187     1e-05  35% 1064 aa  SYVM_MACMU RecName: Full=Valyl-tRNA synthetase, mitochondrial;     
  137::187     1e-05  35% 1063 aa  SYVM_HUMAN RecName: Full=Valyl-tRNA synthetase, mitochondrial;     
   36::199     1e-05  24%  876 aa  SYL_RHISN RecName: Full=Leucyl-tRNA synthetase;       
   32::790     1e-05  26%  868 aa  SYL_PSESM RecName: Full=Leucyl-tRNA synthetase;       
   35::796     1e-05  27%  871 aa  SYL_NOSP7 RecName: Full=Leucyl-tRNA synthetase;       
   30::668     1e-05  32%  943 aa  SYL_METKA RecName: Full=Leucyl-tRNA synthetase;       
   35::617     1e-05  28%  817 aa  SYL_METFK RecName: Full=Leucyl-tRNA synthetase;       
   41::232     1e-05  22%  881 aa  SYL_HERAR RecName: Full=Leucyl-tRNA synthetase;       
   35::231     1e-05  20%  910 aa  SYL_DIAST RecName: Full=Leucyl-tRNA synthetase;       
   35::198     1e-05  22%  864 aa  SYL_BURM1 RecName: Full=Leucyl-tRNA synthetase;       
   31::666     1e-05  31%  932 aa  SYL_ARCFU RecName: Full=Leucyl-tRNA synthetase;       
  559::606     1e-05  42%  815 aa  SYL_ALCBS RecName: Full=Leucyl-tRNA synthetase;       
  615::667     1e-05  40% 1086 aa  SYI_RICPR RecName: Full=Isoleucyl-tRNA synthetase;       
  602::654     1e-05  40% 1079 aa  SYI_RICCK RecName: Full=Isoleucyl-tRNA synthetase;       
   58::623     1e-05  36%  933 aa  SYI_PEDPA RecName: Full=Isoleucyl-tRNA synthetase;       
   45::94      1e-05  33% 1041 aa  SYI_MYCTU RecName: Full=Isoleucyl-tRNA synthetase;       
   45::94      1e-05  33% 1041 aa  SYI_MYCBO RecName: Full=Isoleucyl-tRNA synthetase;       
  533::647     1e-05  32%  937 aa  SYI_HAES2 RecName: Full=Isoleucyl-tRNA synthetase;       
  533::647     1e-05  32%  937 aa  SYI_HAES1 RecName: Full=Isoleucyl-tRNA synthetase;       
   60::142     1e-05  28%  918 aa  SYI_CAMC1 RecName: Full=Isoleucyl-tRNA synthetase;       
  117::700     1e-05  44% 1012 aa  SYIM_MOUSE RecName: Full=Isoleucyl-tRNA synthetase, mitochondrial; 
   47::125     1e-05  43%  807 aa  SYFB_SYNSC RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::125     1e-05  40%  807 aa  SYFB_SYNS9 RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   45::124     1e-05  37%  800 aa  SYFB_STAHJ RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   49::127     1e-05  41%  790 aa  SYFB_CHLMU RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   55::124     1e-05  42%  793 aa  SYFB_ACIAD RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   26::105     1e-05  32%  482 aa  SYC_ANADF RecName: Full=Cysteinyl-tRNA synthetase;       
   49::128     2e-05  34%  965 aa  SYV_YERPS RecName: Full=Valyl-tRNA synthetase;       
   49::128     2e-05  34%  965 aa  SYV_YERPE RecName: Full=Valyl-tRNA synthetase;       
  172::220     2e-05  35% 1093 aa  SYV_NEUCR RecName: Full=Valyl-tRNA synthetase, mitochondrial;      
   35::83      2e-05  30%  945 aa  SYV_NEIMA RecName: Full=Valyl-tRNA synthetase;       
   37::575     2e-05  35%  969 aa  SYV_HERAR RecName: Full=Valyl-tRNA synthetase;       
  444::591     2e-05  36%  940 aa  SYV_CHLAB RecName: Full=Valyl-tRNA synthetase;       
   40::565     2e-05  34%  955 aa  SYV_BURPS RecName: Full=Valyl-tRNA synthetase;       
   40::565     2e-05  34%  955 aa  SYV_BURMA RecName: Full=Valyl-tRNA synthetase;       
   62::786     2e-05  24%  884 aa  SYL_SYNS9 RecName: Full=Leucyl-tRNA synthetase;       
   36::673     2e-05  25%  876 aa  SYL_SINMW RecName: Full=Leucyl-tRNA synthetase;       
   35::198     2e-05  25%  870 aa  SYL_PSEMY RecName: Full=Leucyl-tRNA synthetase;       
   32::790     2e-05  24%  868 aa  SYL_PSEFS RecName: Full=Leucyl-tRNA synthetase;       
   36::121     2e-05  27%  878 aa  SYL_NITHX RecName: Full=Leucyl-tRNA synthetase;       
   35::120     2e-05  30%  872 aa  SYL_ANASP RecName: Full=Leucyl-tRNA synthetase;       
   25::784     2e-05  31%  942 aa  SYL2_SULAC RecName: Full=Leucyl-tRNA synthetase 2;       
  647::684     2e-05  47% 1134 aa  SYI_WOLTR RecName: Full=Isoleucyl-tRNA synthetase;       
  521::783     2e-05  27%  929 aa  SYI_STRTD RecName: Full=Isoleucyl-tRNA synthetase;       
  521::783     2e-05  27%  929 aa  SYI_STRT2 RecName: Full=Isoleucyl-tRNA synthetase;       
  521::783     2e-05  27%  929 aa  SYI_STRT1 RecName: Full=Isoleucyl-tRNA synthetase;       
  589::654     2e-05  35%  940 aa  SYI_SHEPA RecName: Full=Isoleucyl-tRNA synthetase;       
  531::671     2e-05  30% 1103 aa  SYI_RICAH RecName: Full=Isoleucyl-tRNA synthetase;       
  536::657     2e-05  29%  943 aa  SYI_PSEFS RecName: Full=Isoleucyl-tRNA synthetase;       
  532::667     2e-05  28%  931 aa  SYI_LEGPH RecName: Full=Isoleucyl-tRNA synthetase;       
  536::650     2e-05  32%  920 aa  SYI_HELP2 RecName: Full=Isoleucyl-tRNA synthetase;       
   52::99      2e-05  32% 1054 aa  SYI_CORGL RecName: Full=Isoleucyl-tRNA synthetase;       
   51::89      2e-05  45% 1039 aa  SYI_CLOPE RecName: Full=Isoleucyl-tRNA synthetase;       
   47::125     2e-05  40%  825 aa  SYFB_SYNJA RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::127     2e-05  37%  801 aa  SYFB_HELHP RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   36::124     2e-05  40%  798 aa  SYFB_DESVH RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   58::130     2e-05  47%  820 aa  SYFB_BACFR RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   58::130     2e-05  47%  820 aa  SYFB_BACFN RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   36::292     2e-05  27%  484 aa  SYC_PELTS RecName: Full=Cysteinyl-tRNA synthetase;       
  227::396     2e-05  32%  494 aa  SYC_GEOUR RecName: Full=Cysteinyl-tRNA synthetase;       
   36::602     2e-05  34%  980 aa  SYV_XANOR RecName: Full=Valyl-tRNA synthetase;       
   36::602     2e-05  34%  980 aa  SYV_XANOP RecName: Full=Valyl-tRNA synthetase;       
   36::602     2e-05  34%  980 aa  SYV_XANOM RecName: Full=Valyl-tRNA synthetase;       
   36::566     2e-05  34%  944 aa  SYV_XANCP RecName: Full=Valyl-tRNA synthetase;       
   36::566     2e-05  34%  944 aa  SYV_XANCB RecName: Full=Valyl-tRNA synthetase;       
   36::566     2e-05  34%  944 aa  SYV_XANC8 RecName: Full=Valyl-tRNA synthetase;       
   36::602     2e-05  34%  980 aa  SYV_XANC5 RecName: Full=Valyl-tRNA synthetase;       
   37::85      2e-05  34%  912 aa  SYV_THIDA RecName: Full=Valyl-tRNA synthetase;       
   50::129     2e-05  34%  973 aa  SYV_COLP3 RecName: Full=Valyl-tRNA synthetase;       
   49::618     2e-05  38%  911 aa  SYV_BIFLO RecName: Full=Valyl-tRNA synthetase;       
   49::618     2e-05  38%  911 aa  SYV_BIFLI RecName: Full=Valyl-tRNA synthetase;       
   49::618     2e-05  38%  911 aa  SYV_BIFLD RecName: Full=Valyl-tRNA synthetase;       
   59::592     2e-05  33%  950 aa  SYVM_SCHPO RecName: Full=Valyl-tRNA synthetase, mitochondrial;     
   34::203     2e-05  25%  857 aa  SYL_SILST RecName: Full=Leucyl-tRNA synthetase;       
  630::792     2e-05  28%  874 aa  SYL_RHOP2 RecName: Full=Leucyl-tRNA synthetase;       
   41::244     2e-05  23%  877 aa  SYL_RALSO RecName: Full=Leucyl-tRNA synthetase;       
   36::93      2e-05  38%  945 aa  SYL_PYRAE RecName: Full=Leucyl-tRNA synthetase;       
   35::790     2e-05  26%  868 aa  SYL_PSE14 RecName: Full=Leucyl-tRNA synthetase;       
   35::225     2e-05  22%  869 aa  SYL_NITEU RecName: Full=Leucyl-tRNA synthetase;       
   34::98      2e-05  33%  966 aa  SYL_METMA RecName: Full=Leucyl-tRNA synthetase;       
   34::98      2e-05  33%  966 aa  SYL_METBF RecName: Full=Leucyl-tRNA synthetase;       
   34::98      2e-05  33%  961 aa  SYL_METAC RecName: Full=Leucyl-tRNA synthetase;       
   35::666     2e-05  21%  859 aa  SYL_BUCAI RecName: Full=Leucyl-tRNA synthetase;       
   35::663     2e-05  26%  872 aa  SYL_BLOPB RecName: Full=Leucyl-tRNA synthetase;       
   35::787     2e-05  25%  870 aa  SYL_AZOVD RecName: Full=Leucyl-tRNA synthetase;       
   48::162     2e-05  25%  918 aa  SYL_AZOPC RecName: Full=Leucyl-tRNA synthetase;       
  532::667     2e-05  28%  931 aa  SYI_LEGPL RecName: Full=Isoleucyl-tRNA synthetase;       
  532::667     2e-05  28%  931 aa  SYI_LEGPC RecName: Full=Isoleucyl-tRNA synthetase;       
  532::667     2e-05  28%  931 aa  SYI_LEGPA RecName: Full=Isoleucyl-tRNA synthetase;       
  536::650     2e-05  32%  920 aa  SYI_HELPJ RecName: Full=Isoleucyl-tRNA synthetase;       
  536::650     2e-05  32%  920 aa  SYI_HELPH RecName: Full=Isoleucyl-tRNA synthetase;       
  644::708     2e-05  34% 1092 aa  SYI_CORJK RecName: Full=Isoleucyl-tRNA synthetase;       
   45::124     2e-05  40%  800 aa  SYFB_STAAW RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   45::124     2e-05  40%  800 aa  SYFB_STAAS RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   48::125     2e-05  40%  808 aa  SYFB_BACSK RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   48::125     2e-05  40%  804 aa  SYFB_BACLD RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   33::338     2e-05  34%  466 aa  SYC_THEFY RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     2e-05  30%  461 aa  SYC_SHISS RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     2e-05  30%  461 aa  SYC_SHIFL RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     2e-05  30%  461 aa  SYC_SHIF8 RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     2e-05  30%  439 aa  SYC_SHIBS RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     2e-05  30%  461 aa  SYC_SHIB3 RecName: Full=Cysteinyl-tRNA synthetase;       
  227::385     2e-05  33%  480 aa  SYC_GEOSM RecName: Full=Cysteinyl-tRNA synthetase;       
  227::407     2e-05  33%  481 aa  SYC_GEOSL RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     2e-05  30%  461 aa  SYC_ESCF3 RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     2e-05  30%  461 aa  SYC_ECOUT RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     2e-05  30%  461 aa  SYC_ECOSM RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     2e-05  30%  461 aa  SYC_ECOSE RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     2e-05  30%  461 aa  SYC_ECOLU RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     2e-05  30%  461 aa  SYC_ECOLI RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     2e-05  30%  461 aa  SYC_ECOLC RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     2e-05  30%  461 aa  SYC_ECOL6 RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     2e-05  30%  461 aa  SYC_ECOL5 RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     2e-05  30%  461 aa  SYC_ECOK1 RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     2e-05  30%  461 aa  SYC_ECOHS RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     2e-05  30%  461 aa  SYC_ECODH RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     2e-05  30%  461 aa  SYC_ECOBW RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     2e-05  30%  461 aa  SYC_ECO8A RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     2e-05  30%  461 aa  SYC_ECO81 RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     2e-05  30%  461 aa  SYC_ECO7I RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     2e-05  30%  461 aa  SYC_ECO5E RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     2e-05  30%  461 aa  SYC_ECO57 RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     2e-05  30%  461 aa  SYC_ECO55 RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     2e-05  30%  461 aa  SYC_ECO45 RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     2e-05  30%  461 aa  SYC_ECO27 RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     2e-05  30%  461 aa  SYC_ECO24 RecName: Full=Cysteinyl-tRNA synthetase;       
   36::84      3e-05  37%  942 aa  SYV_STRMK RecName: Full=Valyl-tRNA synthetase;       
   36::84      3e-05  37%  942 aa  SYV_STRM5 RecName: Full=Valyl-tRNA synthetase;       
   32::114     3e-05  32%  951 aa  SYV_SHIDS RecName: Full=Valyl-tRNA synthetase;       
   38::86      3e-05  37%  949 aa  SYV_PARUW RecName: Full=Valyl-tRNA synthetase;       
  141::691     3e-05  33% 1072 aa  SYVC_DICDI RecName: Full=Probable valyl-tRNA synthetase,
  366::420     3e-05  47%  556 aa  SYR_MICLC RecName: Full=Arginyl-tRNA synthetase;       
   41::117     3e-05  26%  910 aa  SYL_THEAC RecName: Full=Leucyl-tRNA synthetase;       
   34::97      3e-05  31%  852 aa  SYL_SILPO RecName: Full=Leucyl-tRNA synthetase;       
   35::198     3e-05  20%  860 aa  SYL_SHIF8 RecName: Full=Leucyl-tRNA synthetase;       
   35::198     3e-05  20%  860 aa  SYL_SALTI RecName: Full=Leucyl-tRNA synthetase;       
   36::673     3e-05  25%  876 aa  SYL_RHIE6 RecName: Full=Leucyl-tRNA synthetase;       
   41::204     3e-05  22%  873 aa  SYL_RALME RecName: Full=Leucyl-tRNA synthetase;       
   77::239     3e-05  27%  919 aa  SYL_PSYCK RecName: Full=Leucyl-tRNA synthetase;       
   74::236     3e-05  27%  921 aa  SYL_PSYA2 RecName: Full=Leucyl-tRNA synthetase;       
   32::120     3e-05  25%  866 aa  SYL_NITMU RecName: Full=Leucyl-tRNA synthetase;       
   47::611     3e-05  28%  805 aa  SYL_MYCGA RecName: Full=Leucyl-tRNA synthetase;       
   33::75      3e-05  40%  950 aa  SYL_METTP RecName: Full=Leucyl-tRNA synthetase;       
   40::83      3e-05  37% 1022 aa  SYL_IGNH4 RecName: Full=Leucyl-tRNA synthetase;       
   35::198     3e-05  20%  860 aa  SYL_ECOLU RecName: Full=Leucyl-tRNA synthetase;       
   35::198     3e-05  21%  863 aa  SYL_BURXL RecName: Full=Leucyl-tRNA synthetase;       
   33::121     3e-05  26%  847 aa  SYL_BUCCC RecName: Full=Leucyl-tRNA synthetase;       
   41::805     3e-05  24%  885 aa  SYL_BORA1 RecName: Full=Leucyl-tRNA synthetase;       
   35::796     3e-05  27%  873 aa  SYL_AZOSE RecName: Full=Leucyl-tRNA synthetase;       
   83::260     3e-05  21%  902 aa  SYLM_MOUSE RecName: Full=Probable leucyl-tRNA synthetase,
  615::667     3e-05  38% 1086 aa  SYI_RICTY RecName: Full=Isoleucyl-tRNA synthetase;       
   51::89      3e-05  29% 1036 aa  SYI_CLOTE RecName: Full=Isoleucyl-tRNA synthetase;       
  534::646     3e-05  33%  937 aa  SYI_ALCBS RecName: Full=Isoleucyl-tRNA synthetase;       
   54::124     3e-05  36%  791 aa  SYFB_CLOTE RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   55::125     3e-05  42%  806 aa  SYFB_BACHK RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   55::125     3e-05  42%  806 aa  SYFB_BACCZ RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   55::125     3e-05  42%  806 aa  SYFB_BACCR RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   55::125     3e-05  42%  806 aa  SYFB_BACC1 RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   55::125     3e-05  42%  806 aa  SYFB_BACAN RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
  230::314     3e-05  38%  465 aa  SYC_SULNB RecName: Full=Cysteinyl-tRNA synthetase;       
   37::110     3e-05  28%  459 aa  SYC_SHESH RecName: Full=Cysteinyl-tRNA synthetase;       
   37::110     3e-05  28%  459 aa  SYC_SHEPW RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     3e-05  30%  461 aa  SYC_SALTY RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     3e-05  30%  461 aa  SYC_SALTI RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     3e-05  30%  461 aa  SYC_SALSV RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     3e-05  30%  461 aa  SYC_SALPK RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     3e-05  30%  461 aa  SYC_SALPC RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     3e-05  30%  461 aa  SYC_SALPB RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     3e-05  30%  461 aa  SYC_SALPA RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     3e-05  30%  461 aa  SYC_SALNS RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     3e-05  30%  461 aa  SYC_SALHS RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     3e-05  30%  461 aa  SYC_SALG2 RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     3e-05  30%  461 aa  SYC_SALEP RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     3e-05  30%  461 aa  SYC_SALDC RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     3e-05  30%  461 aa  SYC_SALCH RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     3e-05  30%  461 aa  SYC_SALAR RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     3e-05  30%  461 aa  SYC_SALA4 RecName: Full=Cysteinyl-tRNA synthetase;       
   27::105     3e-05  34%  481 aa  SYC_ANASK RecName: Full=Cysteinyl-tRNA synthetase;       
   27::105     3e-05  34%  481 aa  SYC_ANADE RecName: Full=Cysteinyl-tRNA synthetase;       
   27::105     3e-05  34%  481 aa  SYC_ANAD2 RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     3e-05  27%  464 aa  SYC1_PHOPR RecName: Full=Cysteinyl-tRNA synthetase 1;       
   65::612     4e-05  36%  901 aa  SYV_HALMA RecName: Full=Valyl-tRNA synthetase;       
   41::576     4e-05  33%  954 aa  SYV_HAEIN RecName: Full=Valyl-tRNA synthetase;       
   37::88      4e-05  33%  957 aa  SYV_BLOPB RecName: Full=Valyl-tRNA synthetase;       
   38::617     4e-05  30%  948 aa  SYV_AZOSE RecName: Full=Valyl-tRNA synthetase;       
   30::201     4e-05  24%  819 aa  SYL_WOLPP RecName: Full=Leucyl-tRNA synthetase;       
   29::211     4e-05  26%  835 aa  SYL_RICRS RecName: Full=Leucyl-tRNA synthetase;       
   29::211     4e-05  26%  835 aa  SYL_RICRO RecName: Full=Leucyl-tRNA synthetase;       
   29::211     4e-05  26%  835 aa  SYL_RICCN RecName: Full=Leucyl-tRNA synthetase;       
   29::211     4e-05  22%  870 aa  SYL_RICAH RecName: Full=Leucyl-tRNA synthetase;       
   29::211     4e-05  26%  835 aa  SYL_RICAE RecName: Full=Leucyl-tRNA synthetase;       
   74::146     4e-05  27%  945 aa  SYL_RHOSR RecName: Full=Leucyl-tRNA synthetase;       
   47::679     4e-05  27%  885 aa  SYL_PSYWF RecName: Full=Leucyl-tRNA synthetase;       
   35::198     4e-05  25%  868 aa  SYL_PSEU5 RecName: Full=Leucyl-tRNA synthetase;       
   35::777     4e-05  23%  860 aa  SYL_PHOLL RecName: Full=Leucyl-tRNA synthetase;       
  706::757     4e-05  42%  946 aa  SYL_PARD8 RecName: Full=Leucyl-tRNA synthetase;       
   35::804     4e-05  27%  867 aa  SYL_DICNV RecName: Full=Leucyl-tRNA synthetase;       
  618::805     4e-05  28%  863 aa  SYL_COLP3 RecName: Full=Leucyl-tRNA synthetase;       
   45::236     4e-05  24%  852 aa  SYL_CLAMS RecName: Full=Leucyl-tRNA synthetase;       
   35::657     4e-05  25%  867 aa  SYL_BLOFL RecName: Full=Leucyl-tRNA synthetase;       
   35::804     4e-05  30%  872 aa  SYL_ANAVT RecName: Full=Leucyl-tRNA synthetase;       
   50::226     4e-05  22%  894 aa  SYLM_SACDO RecName: Full=Leucyl-tRNA synthetase, mitochondrial;    
  636::673     4e-05  45% 1111 aa  SYI_WOLPM RecName: Full=Isoleucyl-tRNA synthetase;       
  521::783     4e-05  28%  930 aa  SYI_STRA3 RecName: Full=Isoleucyl-tRNA synthetase;       
  536::650     4e-05  32%  920 aa  SYI_HELPS RecName: Full=Isoleucyl-tRNA synthetase;       
  536::650     4e-05  32%  920 aa  SYI_HELPG RecName: Full=Isoleucyl-tRNA synthetase;       
  595::655     4e-05  36%  932 aa  SYI_DECAR RecName: Full=Isoleucyl-tRNA synthetase;       
  539::653     4e-05  29%  916 aa  SYI_CAMFF RecName: Full=Isoleucyl-tRNA synthetase;       
  520::657     4e-05  28% 1101 aa  SYI_ANAMM RecName: Full=Isoleucyl-tRNA synthetase;       
   46::126     4e-05  40%  808 aa  SYFB_RHIME RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   44::153     4e-05  41%  809 aa  SYFB_RALSO RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::124     4e-05  47%  787 aa  SYFB_NEIMB RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::124     4e-05  37%  806 aa  SYFB_LACSS RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   41::118     4e-05  39%  800 aa  SYFB_DESDG RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   48::125     4e-05  40%  804 aa  SYFB_BACSU RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   23::110     4e-05  28%  467 aa  SYC_WOLSU RecName: Full=Cysteinyl-tRNA synthetase;       
   39::112     4e-05  28%  461 aa  SYC_SHESR RecName: Full=Cysteinyl-tRNA synthetase;       
   39::112     4e-05  28%  461 aa  SYC_SHESM RecName: Full=Cysteinyl-tRNA synthetase;       
   39::112     4e-05  28%  461 aa  SYC_SHESA RecName: Full=Cysteinyl-tRNA synthetase;       
   37::110     4e-05  28%  459 aa  SYC_SHEON RecName: Full=Cysteinyl-tRNA synthetase;       
   38::106     4e-05  29%  459 aa  SYC_RHOFD RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     4e-05  30%  461 aa  SYC_KLEP7 RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     4e-05  30%  461 aa  SYC_KLEP3 RecName: Full=Cysteinyl-tRNA synthetase;       
  227::385     4e-05  32%  480 aa  SYC_GEOBB RecName: Full=Cysteinyl-tRNA synthetase;       
   32::114     5e-05  31%  951 aa  SYV_SHIFL RecName: Full=Valyl-tRNA synthetase;       
   42::90      5e-05  30%  968 aa  SYV_RALSO RecName: Full=Valyl-tRNA synthetase;       
   38::86      5e-05  35%  939 aa  SYV_CHRVO RecName: Full=Valyl-tRNA synthetase;       
  352::590     5e-05  33%  939 aa  SYV_CHLMU RecName: Full=Valyl-tRNA synthetase;       
  352::591     5e-05  32%  940 aa  SYV_CHLCV RecName: Full=Valyl-tRNA synthetase;       
   36::579     5e-05  33%  956 aa  SYV_BUCBP RecName: Full=Valyl-tRNA synthetase;       
   30::652     5e-05  25%  865 aa  SYL_WOLTR RecName: Full=Leucyl-tRNA synthetase;       
   30::201     5e-05  24%  838 aa  SYL_WOLPM RecName: Full=Leucyl-tRNA synthetase;       
   29::114     5e-05  28%  835 aa  SYL_RICPU RecName: Full=Leucyl-tRNA synthetase;       
   29::211     5e-05  24%  835 aa  SYL_RICM5 RecName: Full=Leucyl-tRNA synthetase;       
   34::210     5e-05  22%  847 aa  SYL_RHOSK RecName: Full=Leucyl-tRNA synthetase;       
   34::210     5e-05  22%  847 aa  SYL_RHOS4 RecName: Full=Leucyl-tRNA synthetase;       
   34::210     5e-05  22%  847 aa  SYL_RHOS1 RecName: Full=Leucyl-tRNA synthetase;       
   36::747     5e-05  25%  876 aa  SYL_RHIEC RecName: Full=Leucyl-tRNA synthetase;       
   41::219     5e-05  23%  877 aa  SYL_RALPJ RecName: Full=Leucyl-tRNA synthetase;       
   41::126     5e-05  27%  873 aa  SYL_RALEJ RecName: Full=Leucyl-tRNA synthetase;       
   35::225     5e-05  22%  876 aa  SYL_NEIM0 RecName: Full=Leucyl-tRNA synthetase;       
   43::198     5e-05  21%  869 aa  SYL_HAMD5 RecName: Full=Leucyl-tRNA synthetase;       
   44::672     5e-05  26%  869 aa  SYL_DINSH RecName: Full=Leucyl-tRNA synthetase;       
   35::120     5e-05  26%  854 aa  SYL_CYAP7 RecName: Full=Leucyl-tRNA synthetase;       
  575::713     5e-05  26%  930 aa  SYI_STRZT RecName: Full=Isoleucyl-tRNA synthetase;       
  575::713     5e-05  26%  930 aa  SYI_STRZJ RecName: Full=Isoleucyl-tRNA synthetase;       
  575::713     5e-05  26%  930 aa  SYI_STRR6 RecName: Full=Isoleucyl-tRNA synthetase;       
  575::713     5e-05  26%  930 aa  SYI_STRPN RecName: Full=Isoleucyl-tRNA synthetase;       
  575::713     5e-05  26%  930 aa  SYI_STRPI RecName: Full=Isoleucyl-tRNA synthetase;       
  575::713     5e-05  26%  930 aa  SYI_STRP7 RecName: Full=Isoleucyl-tRNA synthetase;       
  575::713     5e-05  26%  930 aa  SYI_STRP4 RecName: Full=Isoleucyl-tRNA synthetase;       
  575::713     5e-05  26%  930 aa  SYI_STRP2 RecName: Full=Isoleucyl-tRNA synthetase;       
  521::643     5e-05  29%  930 aa  SYI_STRA5 RecName: Full=Isoleucyl-tRNA synthetase;       
  521::643     5e-05  29%  930 aa  SYI_STRA1 RecName: Full=Isoleucyl-tRNA synthetase;       
   47::120     5e-05  39%  802 aa  SYFB_PELUB RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::124     5e-05  38%  805 aa  SYFB_LACPL RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::143     5e-05  30%  801 aa  SYFB_GEOSL RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   46::124     5e-05  39%  816 aa  SYFB_DESPS RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::130     5e-05  42%  810 aa  SYFB_BURTA RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::130     5e-05  42%  810 aa  SYFB_BURPS RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::130     5e-05  42%  810 aa  SYFB_BURP1 RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::130     5e-05  42%  810 aa  SYFB_BURMA RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   26::115     5e-05  30%  474 aa  SYC_THEPD RecName: Full=Cysteinyl-tRNA synthetase;       
   39::112     5e-05  28%  461 aa  SYC_SHESW RecName: Full=Cysteinyl-tRNA synthetase;       
   39::112     5e-05  28%  461 aa  SYC_SHEPC RecName: Full=Cysteinyl-tRNA synthetase;       
   26::297     5e-05  31%  493 aa  SYC_RENSM RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     5e-05  27%  473 aa  SYC_POLNS RecName: Full=Cysteinyl-tRNA synthetase;       
   32::114     7e-05  31%  951 aa  SYV_SHISS RecName: Full=Valyl-tRNA synthetase;       
   32::114     7e-05  31%  951 aa  SYV_SHIBS RecName: Full=Valyl-tRNA synthetase;       
   35::114     7e-05  32%  951 aa  SYV_SALTY RecName: Full=Valyl-tRNA synthetase;       
   35::114     7e-05  32%  951 aa  SYV_SALTI RecName: Full=Valyl-tRNA synthetase;       
   35::114     7e-05  32%  951 aa  SYV_SALPA RecName: Full=Valyl-tRNA synthetase;       
   35::114     7e-05  32%  951 aa  SYV_SALCH RecName: Full=Valyl-tRNA synthetase;       
   32::114     7e-05  31%  951 aa  SYV_ECOL6 RecName: Full=Valyl-tRNA synthetase;       
   32::114     7e-05  31%  951 aa  SYV_ECO57 RecName: Full=Valyl-tRNA synthetase;       
   41::94      7e-05  33%  910 aa  SYL_THEVO RecName: Full=Leucyl-tRNA synthetase;       
   36::103     7e-05  31%  945 aa  SYL_PYRAR RecName: Full=Leucyl-tRNA synthetase;       
   32::790     7e-05  24%  868 aa  SYL_PSEPF RecName: Full=Leucyl-tRNA synthetase;       
   35::677     7e-05  25%  870 aa  SYL_DECAR RecName: Full=Leucyl-tRNA synthetase;       
   45::208     7e-05  22%  851 aa  SYL_CLAM3 RecName: Full=Leucyl-tRNA synthetase;       
   36::199     7e-05  25%  874 aa  SYL_BRASO RecName: Full=Leucyl-tRNA synthetase;       
  638::800     7e-05  29%  880 aa  SYL_BARHE RecName: Full=Leucyl-tRNA synthetase;       
   50::306     7e-05  22%  894 aa  SYLM_YEAST RecName: Full=Leucyl-tRNA synthetase, mitochondrial;    
  575::713     7e-05  26%  930 aa  SYI_STRZP RecName: Full=Isoleucyl-tRNA synthetase;       
  575::713     7e-05  26%  930 aa  SYI_STRPS RecName: Full=Isoleucyl-tRNA synthetase;       
  575::713     7e-05  26%  930 aa  SYI_STRPJ RecName: Full=Isoleucyl-tRNA synthetase;       
  591::659     7e-05  33%  939 aa  SYI_NITEU RecName: Full=Isoleucyl-tRNA synthetase;       
  524::630     7e-05  35%  907 aa  SYI_METI4 RecName: Full=Isoleucyl-tRNA synthetase;       
  609::673     7e-05  34% 1052 aa  SYI_CORDI RecName: Full=Isoleucyl-tRNA synthetase;       
   51::633     7e-05  39% 1034 aa  SYI_CLOK5 RecName: Full=Isoleucyl-tRNA synthetase;       
  540::654     7e-05  32%  917 aa  SYI_CAMJR RecName: Full=Isoleucyl-tRNA synthetase;       
   47::124     7e-05  41%  795 aa  SYFB_PHOLL RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   48::123     7e-05  34%  804 aa  SYFB_PELCD RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::149     7e-05  31%  795 aa  SYFB_HAEDU RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   55::123     7e-05  35%  773 aa  SYFB_CAMJE RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   35::126     7e-05  40%  802 aa  SYFB_BRAJA RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   46::124     7e-05  43%  807 aa  SYFB_AGRT5 RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   37::110     7e-05  35%  469 aa  SYC_MYCTA RecName: Full=Cysteinyl-tRNA synthetase;       
   46::325     7e-05  33%  477 aa  SYC_MYCS2 RecName: Full=Cysteinyl-tRNA synthetase;       
   37::110     7e-05  35%  469 aa  SYC_MYCBT RecName: Full=Cysteinyl-tRNA synthetase;       
   37::110     7e-05  35%  469 aa  SYC_MYCBP RecName: Full=Cysteinyl-tRNA synthetase;       
   36::298     7e-05  34%  473 aa  SYC_METMA RecName: Full=Cysteinyl-tRNA synthetase;       
  261::462     7e-05  26%  472 aa  SYC_LACF3 RecName: Full=Cysteinyl-tRNA synthetase;       
  222::440     7e-05  25%  465 aa  SYC_CLOTE RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     7e-05  33%  462 aa  SYC_ALHEH RecName: Full=Cysteinyl-tRNA synthetase;       
   33::291     7e-05  37%  469 aa  SYC_ACIC1 RecName: Full=Cysteinyl-tRNA synthetase;       
   37::110     7e-05  35%  469 aa  SYC1_MYCTU RecName: Full=Cysteinyl-tRNA synthetase 1;       
   37::110     7e-05  35%  469 aa  SYC1_MYCBO RecName: Full=Cysteinyl-tRNA synthetase 1;       
   41::122     9e-05  30%  954 aa  SYV_MANSM RecName: Full=Valyl-tRNA synthetase;       
   32::114     9e-05  31%  951 aa  SYV_ECOLI RecName: Full=Valyl-tRNA synthetase;       
   30::201     9e-05  24%  838 aa  SYL_WOLWR RecName: Full=Leucyl-tRNA synthetase;       
   58::147     9e-05  27%  954 aa  SYL_SALTO RecName: Full=Leucyl-tRNA synthetase;       
   56::145     9e-05  27%  952 aa  SYL_SALAI RecName: Full=Leucyl-tRNA synthetase;       
   29::205     9e-05  21%  828 aa  SYL_RICPR RecName: Full=Leucyl-tRNA synthetase;       
   41::204     9e-05  23%  890 aa  SYL_POLSQ RecName: Full=Leucyl-tRNA synthetase;       
   32::116     9e-05  24%  838 aa  SYL_ORITB RecName: Full=Leucyl-tRNA synthetase;       
  595::797     9e-05  29%  952 aa  SYL_METVS RecName: Full=Leucyl-tRNA synthetase;       
   41::212     9e-05  21%  881 aa  SYL_JANMA RecName: Full=Leucyl-tRNA synthetase;       
   35::211     9e-05  19%  864 aa  SYL_CELJU RecName: Full=Leucyl-tRNA synthetase;       
  535::658     9e-05  32% 1056 aa  SYI_TROWT RecName: Full=Isoleucyl-tRNA synthetase;       
  535::658     9e-05  32% 1056 aa  SYI_TROW8 RecName: Full=Isoleucyl-tRNA synthetase;       
   51::100     9e-05  36% 1059 aa  SYI_MYCLE RecName: Full=Isoleucyl-tRNA synthetase;       
  536::650     9e-05  31%  920 aa  SYI_HELPY RecName: Full=Isoleucyl-tRNA synthetase;       
  587::630     9e-05  43%  938 aa  SYI_HAEPS RecName: Full=Isoleucyl-tRNA synthetase;       
   95::166     9e-05  25% 1034 aa  SYIM_DICDI RecName: Full=Probable isoleucyl-tRNA synthetase,
   46::121     9e-05  40%  764 aa  SYFB_HELPJ RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   34::126     9e-05  41%  822 aa  SYFB_GLUOX RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   50::125     9e-05  38%  790 aa  SYFB_FRATT RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   37::109     9e-05  29%  454 aa  SYC_THIDA RecName: Full=Cysteinyl-tRNA synthetase;       
   25::108     9e-05  30%  466 aa  SYC_SULDN RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     9e-05  29%  461 aa  SYC_SHIDS RecName: Full=Cysteinyl-tRNA synthetase;       
   38::93      9e-05  34%  461 aa  SYC_PSEU5 RecName: Full=Cysteinyl-tRNA synthetase;       
   37::359     9e-05  31%  473 aa  SYC_MYCLB RecName: Full=Cysteinyl-tRNA synthetase;       
   37::106     9e-05  31%  471 aa  SYC_KINRD RecName: Full=Cysteinyl-tRNA synthetase;       
   38::106     9e-05  28%  487 aa  SYC_GEOLS RecName: Full=Cysteinyl-tRNA synthetase;       
  228::311     9e-05  35%  461 aa  SYC_AZOVD RecName: Full=Cysteinyl-tRNA synthetase;       
   94::299     9e-05  32%  466 aa  SYC_ANAMM RecName: Full=Cysteinyl-tRNA synthetase;       
   37::359     9e-05  31%  473 aa  SYC1_MYCLE RecName: Full=Cysteinyl-tRNA synthetase 1;       
   35::83      1e-04  34%  958 aa  SYV_SHEON RecName: Full=Valyl-tRNA synthetase;       
   41::89      1e-04  35%  954 aa  SYV_HAES2 RecName: Full=Valyl-tRNA synthetase;       
   41::89      1e-04  32%  954 aa  SYV_HAEIE RecName: Full=Valyl-tRNA synthetase;       
   41::576     1e-04  34%  954 aa  SYV_ACTPJ RecName: Full=Valyl-tRNA synthetase;       
   41::576     1e-04  34%  954 aa  SYV_ACTP7 RecName: Full=Valyl-tRNA synthetase;       
   41::576     1e-04  34%  954 aa  SYV_ACTP2 RecName: Full=Valyl-tRNA synthetase;       
   34::216     1e-04  26%  865 aa  SYL_RHOCS RecName: Full=Leucyl-tRNA synthetase;       
   32::787     1e-04  27%  844 aa  SYL_PARDP RecName: Full=Leucyl-tRNA synthetase;       
   35::225     1e-04  22%  876 aa  SYL_NEIG2 RecName: Full=Leucyl-tRNA synthetase;       
   35::225     1e-04  22%  876 aa  SYL_NEIG1 RecName: Full=Leucyl-tRNA synthetase;       
   94::165     1e-04  28%  976 aa  SYL_MYCUA RecName: Full=Leucyl-tRNA synthetase;       
   94::165     1e-04  28%  976 aa  SYL_MYCMM RecName: Full=Leucyl-tRNA synthetase;       
  605::783     1e-04  30%  861 aa  SYL_MARAV RecName: Full=Leucyl-tRNA synthetase;       
   49::744     1e-04  29%  921 aa  SYL_CYTH3 RecName: Full=Leucyl-tRNA synthetase;       
   36::218     1e-04  25%  875 aa  SYL_BARBK RecName: Full=Leucyl-tRNA synthetase;       
   52::733     1e-04  27%  832 aa  SYL_ACIC1 RecName: Full=Leucyl-tRNA synthetase;       
   58::109     1e-04  32%  928 aa  SYI_LACSS RecName: Full=Isoleucyl-tRNA synthetase;       
   55::145     1e-04  32%  788 aa  SYFB_NITEU RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   30::124     1e-04  38%  792 aa  SYFB_MYCPE RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   55::123     1e-04  35%  773 aa  SYFB_CAMJR RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::130     1e-04  41%  809 aa  SYFB_BURS3 RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   26::105     1e-04  29%  447 aa  SYC_STRPM RecName: Full=Cysteinyl-tRNA synthetase;       
   26::105     1e-04  29%  447 aa  SYC_STRP8 RecName: Full=Cysteinyl-tRNA synthetase;       
   26::105     1e-04  29%  447 aa  SYC_STRP6 RecName: Full=Cysteinyl-tRNA synthetase;       
   26::105     1e-04  29%  447 aa  SYC_STRP3 RecName: Full=Cysteinyl-tRNA synthetase;       
   26::105     1e-04  29%  447 aa  SYC_STRP1 RecName: Full=Cysteinyl-tRNA synthetase;       
   37::110     1e-04  27%  459 aa  SYC_SHEWM RecName: Full=Cysteinyl-tRNA synthetase;       
   37::110     1e-04  27%  459 aa  SYC_SHEB9 RecName: Full=Cysteinyl-tRNA synthetase;       
   37::110     1e-04  27%  459 aa  SYC_SHEB8 RecName: Full=Cysteinyl-tRNA synthetase;       
   37::110     1e-04  27%  459 aa  SYC_SHEB5 RecName: Full=Cysteinyl-tRNA synthetase;       
   37::110     1e-04  27%  459 aa  SYC_SHEB2 RecName: Full=Cysteinyl-tRNA synthetase;       
  264::311     1e-04  44%  470 aa  SYC_RUBXD RecName: Full=Cysteinyl-tRNA synthetase;       
   39::111     1e-04  29%  465 aa  SYC_RALSO RecName: Full=Cysteinyl-tRNA synthetase;       
   47::119     1e-04  30%  490 aa  SYC_PROAC RecName: Full=Cysteinyl-tRNA synthetase;       
   25::109     1e-04  29%  460 aa  SYC_CAMLR RecName: Full=Cysteinyl-tRNA synthetase;       
  466::615     2e-04  30%  950 aa  SYV_PSEAE RecName: Full=Valyl-tRNA synthetase;       
   49::584     2e-04  33%  965 aa  SYV_PHOLL RecName: Full=Valyl-tRNA synthetase;       
   35::563     2e-04  33%  945 aa  SYV_NEIG1 RecName: Full=Valyl-tRNA synthetase;       
   41::576     2e-04  33%  954 aa  SYV_HAEIG RecName: Full=Valyl-tRNA synthetase;       
   41::576     2e-04  33%  954 aa  SYV_HAEI8 RecName: Full=Valyl-tRNA synthetase;       
   41::89      2e-04  33%  961 aa  SYV_HAEDU RecName: Full=Valyl-tRNA synthetase;       
   35::577     2e-04  31%  951 aa  SYV_ERWCT RecName: Full=Valyl-tRNA synthetase;       
   35::619     2e-04  31%  960 aa  SYV_BUCAP RecName: Full=Valyl-tRNA synthetase;       
   29::211     2e-04  21%  828 aa  SYL_RICTY RecName: Full=Leucyl-tRNA synthetase;       
   32::121     2e-04  31%  876 aa  SYL_RHOPT RecName: Full=Leucyl-tRNA synthetase;       
   32::121     2e-04  31%  876 aa  SYL_RHOPA RecName: Full=Leucyl-tRNA synthetase;       
   36::199     2e-04  21%  877 aa  SYL_BRUSU RecName: Full=Leucyl-tRNA synthetase;       
   36::199     2e-04  21%  877 aa  SYL_BRUSI RecName: Full=Leucyl-tRNA synthetase;       
   36::199     2e-04  21%  877 aa  SYL_BRUO2 RecName: Full=Leucyl-tRNA synthetase;       
   36::199     2e-04  21%  877 aa  SYL_BRUME RecName: Full=Leucyl-tRNA synthetase;       
   36::199     2e-04  21%  877 aa  SYL_BRUMB RecName: Full=Leucyl-tRNA synthetase;       
   36::199     2e-04  21%  877 aa  SYL_BRUC2 RecName: Full=Leucyl-tRNA synthetase;       
   36::199     2e-04  21%  877 aa  SYL_BRUAB RecName: Full=Leucyl-tRNA synthetase;       
   36::199     2e-04  21%  877 aa  SYL_BRUA2 RecName: Full=Leucyl-tRNA synthetase;       
   36::199     2e-04  21%  877 aa  SYL_BRUA1 RecName: Full=Leucyl-tRNA synthetase;       
   82::154     2e-04  23%  990 aa  SYL_BIFAA RecName: Full=Leucyl-tRNA synthetase;       
  638::686     2e-04  37%  880 aa  SYL_BARQU RecName: Full=Leucyl-tRNA synthetase;       
   48::99      2e-04  30%  939 aa  SYI_BUCBP RecName: Full=Isoleucyl-tRNA synthetase;       
   84::135     2e-04  37% 1002 aa  SYIM_YEAST RecName: Full=Isoleucyl-tRNA synthetase, mitochondrial; 
   88::147     2e-04  28%  973 aa  SYIM_SCHPO RecName: Full=Isoleucyl-tRNA synthetase, mitochondrial; 
   46::123     2e-04  37%  792 aa  SYFB_WOLTR RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::124     2e-04  41%  795 aa  SYFB_SALTY RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::124     2e-04  41%  795 aa  SYFB_SALTI RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::124     2e-04  41%  795 aa  SYFB_SALPA RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::124     2e-04  34%  793 aa  SYFB_LEGPL RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::124     2e-04  34%  793 aa  SYFB_LEGPH RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::124     2e-04  34%  793 aa  SYFB_LEGPA RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   48::125     2e-04  37%  808 aa  SYFB_BACHD RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   52::124     2e-04  30%  506 aa  SYC_SYNJA RecName: Full=Cysteinyl-tRNA synthetase;       
   39::111     2e-04  29%  463 aa  SYC_RALPJ RecName: Full=Cysteinyl-tRNA synthetase;       
   38::93      2e-04  33%  461 aa  SYC_PSEMY RecName: Full=Cysteinyl-tRNA synthetase;       
   38::106     2e-04  28%  462 aa  SYC_POLSJ RecName: Full=Cysteinyl-tRNA synthetase;       
   27::116     2e-04  35%  483 aa  SYC_PELLD RecName: Full=Cysteinyl-tRNA synthetase;       
  236::326     2e-04  38%  481 aa  SYC_MYCSS RecName: Full=Cysteinyl-tRNA synthetase;       
  236::326     2e-04  38%  481 aa  SYC_MYCSK RecName: Full=Cysteinyl-tRNA synthetase;       
  236::326     2e-04  38%  481 aa  SYC_MYCSJ RecName: Full=Cysteinyl-tRNA synthetase;       
   27::116     2e-04  31%  480 aa  SYC_CHLCH RecName: Full=Cysteinyl-tRNA synthetase;       
   25::111     2e-04  31%  466 aa  SYC1_TROWT RecName: Full=Cysteinyl-tRNA synthetase 1;       
   25::111     2e-04  31%  466 aa  SYC1_TROW8 RecName: Full=Cysteinyl-tRNA synthetase 1;       
  519::621     2e-04  30%  853 aa  PLPL_CANAL RecName: Full=Patatin-like phospholipase
   38::86      2e-04  35%  998 aa  SYV_AZOSB RecName: Full=Valyl-tRNA synthetase;       
   44::207     2e-04  26%  955 aa  SYL_METM7 RecName: Full=Leucyl-tRNA synthetase;       
   41::126     2e-04  26%  885 aa  SYL_BORPD RecName: Full=Leucyl-tRNA synthetase;       
   36::199     2e-04  24%  876 aa  SYL_AGRVS RecName: Full=Leucyl-tRNA synthetase;       
   67::132     2e-04  30% 1111 aa  SYLC_SCHPO RecName: Full=Putative leucyl-tRNA synthetase,
   36::75      2e-04  38%  945 aa  SYL1_SULTO RecName: Full=Leucyl-tRNA synthetase 1;       
   33::72      2e-04  38%  942 aa  SYL1_SULAC RecName: Full=Leucyl-tRNA synthetase 1;       
  540::654     2e-04  31%  917 aa  SYI_CAMJE RecName: Full=Isoleucyl-tRNA synthetase;       
   45::124     2e-04  35%  795 aa  SYFB_VIBCH RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   34::130     2e-04  37%  819 aa  SYFB_PORGI RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   49::124     2e-04  32%  792 aa  SYFB_CLOAB RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   38::106     2e-04  28%  459 aa  SYC_VARPS RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     2e-04  26%  473 aa  SYC_POLSQ RecName: Full=Cysteinyl-tRNA synthetase;       
   36::108     2e-04  27%  485 aa  SYC_LAWIP RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     2e-04  29%  461 aa  SYC_ENT38 RecName: Full=Cysteinyl-tRNA synthetase;       
  227::391     2e-04  28%  461 aa  SYC_EDWI9 RecName: Full=Cysteinyl-tRNA synthetase;       
   38::106     2e-04  28%  458 aa  SYC_DIAST RecName: Full=Cysteinyl-tRNA synthetase;       
  230::315     2e-04  34%  484 aa  SYC_CYAP8 RecName: Full=Cysteinyl-tRNA synthetase;       
   38::106     2e-04  28%  458 aa  SYC_ACISJ RecName: Full=Cysteinyl-tRNA synthetase;       
  482::585     2e-04  29%  815 aa  PLPL_LODEL RecName: Full=Patatin-like phospholipase
   36::749     3e-04  29%  945 aa  SYL_THENV RecName: Full=Leucyl-tRNA synthetase;       
   47::135     3e-04  29%  867 aa  SYL_SYNS3 RecName: Full=Leucyl-tRNA synthetase;       
   34::197     3e-04  28%  848 aa  SYL_ROSDO RecName: Full=Leucyl-tRNA synthetase;       
  584::676     3e-04  30%  942 aa  SYL_METJA RecName: Full=Leucyl-tRNA synthetase;       
   77::149     3e-04  23%  987 aa  SYL_BIFLO RecName: Full=Leucyl-tRNA synthetase;       
   77::149     3e-04  23%  987 aa  SYL_BIFLD RecName: Full=Leucyl-tRNA synthetase;       
  626::809     3e-04  22%  867 aa  SYL_ALTMD RecName: Full=Leucyl-tRNA synthetase;       
   41::231     3e-04  24%  873 aa  SYL_ACIAD RecName: Full=Leucyl-tRNA synthetase;       
  658::704     3e-04  36% 1119 aa  SYI_LEIXX RecName: Full=Isoleucyl-tRNA synthetase;       
   47::124     3e-04  41%  795 aa  SYFB_PSEHT RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   46::121     3e-04  38%  764 aa  SYFB_HELPY RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   46::145     3e-04  38%  804 aa  SYFB_BARHE RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   27::106     3e-04  28%  448 aa  SYC_STREM RecName: Full=Cysteinyl-tRNA synthetase;       
   26::105     3e-04  28%  447 aa  SYC_STRA5 RecName: Full=Cysteinyl-tRNA synthetase;       
   26::105     3e-04  28%  447 aa  SYC_STRA3 RecName: Full=Cysteinyl-tRNA synthetase;       
   26::105     3e-04  28%  447 aa  SYC_STRA1 RecName: Full=Cysteinyl-tRNA synthetase;       
   36::105     3e-04  29%  471 aa  SYC_METBF RecName: Full=Cysteinyl-tRNA synthetase;       
   37::110     3e-04  27%  456 aa  SYC_DECAR RecName: Full=Cysteinyl-tRNA synthetase;       
   33::81      4e-04  35%  929 aa  SYV_NITOC RecName: Full=Valyl-tRNA synthetase;       
   37::85      4e-04  31%  937 aa  SYV_LARHH RecName: Full=Valyl-tRNA synthetase;       
  687::809     4e-04  26%  925 aa  SYL_PORGI RecName: Full=Leucyl-tRNA synthetase;       
  687::809     4e-04  26%  925 aa  SYL_PORG3 RecName: Full=Leucyl-tRNA synthetase;       
   35::225     4e-04  22%  876 aa  SYL_NEIMF RecName: Full=Leucyl-tRNA synthetase;       
   35::225     4e-04  22%  876 aa  SYL_NEIMB RecName: Full=Leucyl-tRNA synthetase;       
   35::818     4e-04  25%  910 aa  SYL_NEIMA RecName: Full=Leucyl-tRNA synthetase;       
   44::207     4e-04  28%  955 aa  SYL_METMP RecName: Full=Leucyl-tRNA synthetase;       
   65::228     4e-04  23%  855 aa  SYL_KINRD RecName: Full=Leucyl-tRNA synthetase;       
  724::775     4e-04  38%  962 aa  SYL_FLAPJ RecName: Full=Leucyl-tRNA synthetase;       
   28::199     4e-04  24%  829 aa  SYL_EHRCR RecName: Full=Leucyl-tRNA synthetase;       
   28::730     4e-04  23%  829 aa  SYL_EHRCJ RecName: Full=Leucyl-tRNA synthetase;       
   45::124     4e-04  35%  795 aa  SYFB_VIBVY RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   45::124     4e-04  35%  795 aa  SYFB_VIBVU RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::126     4e-04  39%  798 aa  SYFB_SILPO RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::124     4e-04  34%  795 aa  SYFB_SHEON RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   46::127     4e-04  35%  802 aa  SYFB_RHILO RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   48::125     4e-04  40%  802 aa  SYFB_LISIN RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   46::123     4e-04  30%  808 aa  SYFB_LEPIN RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   46::123     4e-04  30%  808 aa  SYFB_LEPIC RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   48::125     4e-04  36%  804 aa  SYFB_GEOKA RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   54::149     4e-04  29%  793 aa  SYFB_CLOPE RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   50::146     4e-04  31%  813 aa  SYFB_BDEBA RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   37::105     4e-04  29%  460 aa  SYC_THISH RecName: Full=Cysteinyl-tRNA synthetase;       
   27::116     4e-04  35%  480 aa  SYC_THET2 RecName: Full=Cysteinyl-tRNA synthetase;       
   27::295     4e-04  28%  469 aa  SYC_THEM4 RecName: Full=Cysteinyl-tRNA synthetase;       
  222::314     4e-04  38%  464 aa  SYC_RHOSR RecName: Full=Cysteinyl-tRNA synthetase;       
  222::314     4e-04  38%  464 aa  SYC_RHOOB RecName: Full=Cysteinyl-tRNA synthetase;       
   39::111     4e-04  32%  462 aa  SYC_RALEJ RecName: Full=Cysteinyl-tRNA synthetase;       
   31::104     4e-04  34%  463 aa  SYC_MYCVP RecName: Full=Cysteinyl-tRNA synthetase;       
  226::294     4e-04  40%  468 aa  SYC_MYCUA RecName: Full=Cysteinyl-tRNA synthetase;       
  226::294     4e-04  40%  468 aa  SYC_MYCMM RecName: Full=Cysteinyl-tRNA synthetase;       
  224::292     4e-04  41%  467 aa  SYC_MYCGI RecName: Full=Cysteinyl-tRNA synthetase;       
   39::111     4e-04  27%  464 aa  SYC_JANMA RecName: Full=Cysteinyl-tRNA synthetase;       
   37::110     4e-04  28%  459 aa  SYC_HAES2 RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     4e-04  26%  462 aa  SYC_ERWT9 RecName: Full=Cysteinyl-tRNA synthetase;       
   36::405     4e-04  28%  485 aa  SYC_DESAD RecName: Full=Cysteinyl-tRNA synthetase;       
   33::105     4e-04  27%  474 aa  SYC_BEUC1 RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     4e-04  29%  462 aa  SYC_BAUCH RecName: Full=Cysteinyl-tRNA synthetase;       
  245::310     4e-04  35%  488 aa  SYC_ARTCA RecName: Full=Cysteinyl-tRNA synthetase;       
  466::567     5e-04  34%  948 aa  SYV_PSEU2 RecName: Full=Valyl-tRNA synthetase;       
  352::590     5e-04  31%  939 aa  SYV_CHLTB RecName: Full=Valyl-tRNA synthetase;       
  352::590     5e-04  31%  939 aa  SYV_CHLT2 RecName: Full=Valyl-tRNA synthetase;       
   36::103     5e-04  26%  945 aa  SYL_PYRIL RecName: Full=Leucyl-tRNA synthetase;       
  630::672     5e-04  37%  870 aa  SYL_PARL1 RecName: Full=Leucyl-tRNA synthetase;       
   34::197     5e-04  26%  962 aa  SYL_METBU RecName: Full=Leucyl-tRNA synthetase;       
   28::190     5e-04  22%  830 aa  SYL_EHRRW RecName: Full=Leucyl-tRNA synthetase;       
   28::190     5e-04  23%  830 aa  SYL_EHRRG RecName: Full=Leucyl-tRNA synthetase;       
   35::120     5e-04  27%  856 aa  SYL_CHRSD RecName: Full=Leucyl-tRNA synthetase;       
   35::120     5e-04  27%  861 aa  SYL_BUCBP RecName: Full=Leucyl-tRNA synthetase;       
   41::81      5e-04  37% 1058 aa  SYLC_DICDI RecName: Full=Leucyl-tRNA synthetase, cytoplasmic;    
   33::73      5e-04  34%  938 aa  SYL1_METS5 RecName: Full=Leucyl-tRNA synthetase 1;       
  511::623     5e-04  27% 1024 aa  SYI_PICTO RecName: Full=Isoleucyl-tRNA synthetase;       
   47::143     5e-04  32%  792 aa  SYFB_XYLFA RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::124     5e-04  40%  795 aa  SYFB_SALCH RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   54::125     5e-04  38%  815 aa  SYFB_PROMM RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::73      5e-04  59%  792 aa  SYFB_COXBU RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::156     5e-04  39%  807 aa  SYFB_COLP3 RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   46::126     5e-04  40%  804 aa  SYFB_BRUSU RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   46::126     5e-04  40%  804 aa  SYFB_BRUAB RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   46::126     5e-04  40%  804 aa  SYFB_BRUA2 RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   36::293     5e-04  24%  454 aa  SYC_THEVO RecName: Full=Cysteinyl-tRNA synthetase;       
  226::341     5e-04  31%  464 aa  SYC_SACEN RecName: Full=Cysteinyl-tRNA synthetase;       
  150::304     5e-04  29%  519 aa  SYC_RHOSK RecName: Full=Cysteinyl-tRNA synthetase;       
   33::299     5e-04  33%  471 aa  SYC_NOCSJ RecName: Full=Cysteinyl-tRNA synthetase;       
   37::117     5e-04  30%  459 aa  SYC_HALHL RecName: Full=Cysteinyl-tRNA synthetase;       
  266::311     5e-04  46%  467 aa  SYC_ARCFU RecName: Full=Cysteinyl-tRNA synthetase;       
   36::84      6e-04  35%  994 aa  SYV_XYLFT RecName: Full=Valyl-tRNA synthetase;       
   36::84      6e-04  35%  991 aa  SYV_XYLFM RecName: Full=Valyl-tRNA synthetase;       
   36::84      6e-04  35%  994 aa  SYV_XYLFA RecName: Full=Valyl-tRNA synthetase;       
   36::84      6e-04  35%  994 aa  SYV_XYLF2 RecName: Full=Valyl-tRNA synthetase;       
  469::570     6e-04  30%  881 aa  SYV_WIGBR RecName: Full=Valyl-tRNA synthetase;       
  476::577     6e-04  33%  953 aa  SYV_PHOPR RecName: Full=Valyl-tRNA synthetase;       
  563::590     6e-04  54%  939 aa  SYV_CHLTR RecName: Full=Valyl-tRNA synthetase;       
  563::590     6e-04  54%  939 aa  SYV_CHLTA RecName: Full=Valyl-tRNA synthetase;       
  638::811     6e-04  29%  880 aa  SYL_XANAC RecName: Full=Leucyl-tRNA synthetase;       
   41::204     6e-04  20%  890 aa  SYL_POLNS RecName: Full=Leucyl-tRNA synthetase;       
  727::775     6e-04  39%  962 aa  SYL_GRAFK RecName: Full=Leucyl-tRNA synthetase;       
  588::631     6e-04  34%  940 aa  SYI_BUCAT RecName: Full=Isoleucyl-tRNA synthetase;       
  588::631     6e-04  34%  938 aa  SYI_BUCAP RecName: Full=Isoleucyl-tRNA synthetase;       
  588::631     6e-04  34%  940 aa  SYI_BUCAI RecName: Full=Isoleucyl-tRNA synthetase;       
  588::631     6e-04  34%  940 aa  SYI_BUCA5 RecName: Full=Isoleucyl-tRNA synthetase;       
   47::122     6e-04  42%  800 aa  SYFB_STRR6 RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::125     6e-04  37%  785 aa  SYFB_GLOVI RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   48::125     6e-04  38%  807 aa  SYFB_ENTFA RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::144     6e-04  36%  799 aa  SYFB_CAUCR RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   46::124     6e-04  40%  804 aa  SYFB_BRUME RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   37::110     6e-04  27%  459 aa  SYC_SHELP RecName: Full=Cysteinyl-tRNA synthetase;       
   37::110     6e-04  26%  459 aa  SYC_SHEDO RecName: Full=Cysteinyl-tRNA synthetase;       
  224::335     6e-04  37%  476 aa  SYC_PYRAR RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     6e-04  35%  473 aa  SYC_NEIMB RecName: Full=Cysteinyl-tRNA synthetase;       
   37::109     6e-04  27%  459 aa  SYC_HAEDU RecName: Full=Cysteinyl-tRNA synthetase;       
  227::294     6e-04  36%  494 aa  SYC_GEOSF RecName: Full=Cysteinyl-tRNA synthetase;       
  470::560     8e-04  33%  955 aa  SYV_RALEJ RecName: Full=Valyl-tRNA synthetase;       
  466::567     8e-04  34%  948 aa  SYV_PSESM RecName: Full=Valyl-tRNA synthetase;       
   33::81      8e-04  33%  951 aa  SYV_PSEHT RecName: Full=Valyl-tRNA synthetase;       
  466::567     8e-04  34%  948 aa  SYV_PSE14 RecName: Full=Valyl-tRNA synthetase;       
   48::96      8e-04  33%  971 aa  SYV_ACIAD RecName: Full=Valyl-tRNA synthetase;       
   35::120     8e-04  27%  864 aa  SYL_WIGBR RecName: Full=Leucyl-tRNA synthetase;       
   36::121     8e-04  23%  875 aa  SYL_RHILO RecName: Full=Leucyl-tRNA synthetase;       
   36::199     8e-04  20%  870 aa  SYL_PSEA6 RecName: Full=Leucyl-tRNA synthetase;       
  628::664     8e-04  43%  877 aa  SYL_OCHA4 RecName: Full=Leucyl-tRNA synthetase;       
   80::151     8e-04  26%  950 aa  SYL_MYCSS RecName: Full=Leucyl-tRNA synthetase;       
   80::151     8e-04  26%  950 aa  SYL_MYCSK RecName: Full=Leucyl-tRNA synthetase;       
   80::151     8e-04  26%  950 aa  SYL_MYCSJ RecName: Full=Leucyl-tRNA synthetase;       
   86::157     8e-04  25%  972 aa  SYL_MYCLE RecName: Full=Leucyl-tRNA synthetase;       
   86::157     8e-04  25%  972 aa  SYL_MYCLB RecName: Full=Leucyl-tRNA synthetase;       
  598::690     8e-04  32%  955 aa  SYL_METM5 RecName: Full=Leucyl-tRNA synthetase;       
   45::124     8e-04  31%  795 aa  SYFB_VIBF1 RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::124     8e-04  38%  795 aa  SYFB_SHISS RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::124     8e-04  38%  795 aa  SYFB_SHIFL RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::124     8e-04  38%  795 aa  SYFB_SHIDS RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::124     8e-04  38%  795 aa  SYFB_SHIBS RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   46::123     8e-04  41%  785 aa  SYFB_EHRCJ RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::124     8e-04  38%  795 aa  SYFB_ECOLI RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::124     8e-04  38%  795 aa  SYFB_ECOL6 RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
   47::124     8e-04  38%  795 aa  SYFB_ECO57 RecName: Full=Phenylalanyl-tRNA synthetase beta chain;  
  224::420     8e-04  28%  473 aa  SYC_PYRIL RecName: Full=Cysteinyl-tRNA synthetase;       
  262::306     8e-04  38%  457 aa  SYC_NANEQ RecName: Full=Cysteinyl-tRNA synthetase;       
   36::105     8e-04  29%  473 aa  SYC_METAC RecName: Full=Cysteinyl-tRNA synthetase;       
   37::110     8e-04  27%  459 aa  SYC_HAES1 RecName: Full=Cysteinyl-tRNA synthetase;       
   36::110     8e-04  28%  459 aa  SYC_FRAP2 RecName: Full=Cysteinyl-tRNA synthetase;       
  229::381     8e-04  29%  470 aa  SYC_FERNB RecName: Full=Cysteinyl-tRNA synthetase;       
  229::299     8e-04  33%  472 aa  SYC_EUBE2 RecName: Full=Cysteinyl-tRNA synthetase;       
  222::293     8e-04  35%  465 aa  SYC_CALS8 RecName: Full=Cysteinyl-tRNA synthetase;       
  222::293     8e-04  35%  465 aa  SYC_ANATD RecName: Full=Cysteinyl-tRNA synthetase;       
    1::618

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MEKVFYVTTPIYYVNAEPHLGHAYTTVVADFLARWHRLDGYRTFFLTGTDEHGETVYRAAQAAGEDPKAF
SYM_THET8       MEKVFYVTTPIYYVNAEPHLGHAYTTVVADFLARWHRLDGYRTFFLTGTDEHGETVYRAAQAAGEDPKAF
SYM_DEIRA       -DREFFITAAIDYANGTPHIGHVYEKILADAIARYQRLAGRDVTFVMGTDEHGEKISKAAAKGGVTPQEL
SYM_THEMA       ----FYITTPIYYVNSEPHIGSAYTTIVADIIARYKRFMGYDVFFLTGTDEHGQKVLQAAQQAGKDPQEF
SYM_THETN       MKKTFYITTPIYYPSDKLHIGHSYTTVAADAMARFKRLTGYDVMFLTGTDEHGQKIQRIAREKGMSPKEY
SYM_BACHD       -QKTFYLTTPIYYPSDKLHIGHAYTTVAGDAMARYKRLRGYNVMYLTGTDEHGQKIEQKAEAKGLTPKQF
SYM_BACST       -KKTFYLTTPIYYPSDKLHIGHAYTTVAGDAMARYKRLRGYDVMYLTGTDEHGQKIQRKAQEKGVTPQQY
SYM_CLOTE       -KKTFYITTPIYYPSAKLHIGNTYTTVAADALARFKRLTGHDVLFLTGTDEHGQKIQRVAEEKGLKPKEY
SYM1_BACCR      --KSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYNVHYLTGTDEHGQKIQKKAEELNITPQAY
SYM1_BACAN      --KSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKCMQGYNVHYLTGTDEHGQKIQKKAEELNVTPQAY
SYM_BACSU       ----FYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRLKGFDVRYLTGTDEHGQKIQQKAEQENITPQEY
SYM_STAHJ       -KETFYITTPIYYPSGNLHIGHAYSTVAGDVISRYKRMQGYDVRYLTGTDEHGQKIQEKAQKAGKTELEY
SYM_CLOPE       ------------------HIGNTYTTVAADAIARFKRLTGHEVMFLTGTDEHGQKIERIANEKGITPKEH
SYM_STAES       ----FYITTPIYYPSGNLHIGHAYSTVAGDVIARYKRMQGYDVRYLTGTDEHGQKIQEKAQKAGKTELEY
SYM_STAEQ       ----FYITTPIYYPSGNLHIGHAYSTVAGDVIARYKRMQGYDVRYLTGTDEHGQKIQEKAQKAGKTELEY
SYM_STAAR       -KETFYITTPIYYPSGNLHIGHAYSTVAGDVIARYKRMQGYDVRYLTGTDEHGQKIQEKAQKAGKTEIEY
SYM_STAAW       -KETFYITTPIYYPSGNLHIGHAYSTVAGDVIARYKRMQGYDVRYLTGTDEHGQKIQEKAQKAGKTEIEY
SYM_STAAS       -KETFYITTPIYYPSGNLHIGHAYSTVAGDVIARYKRMQGYDVRYLTGTDEHGQKIQEKAQKAGKTEIEY
SYM_STAAN       -KETFYITTPIYYPSGNLHIGHAYSTVAGDVIARYKRMQGYDVRYLTGTDEHGQKIQEKAQKAGKTEIEY
SYM_STAAM       -KETFYITTPIYYPSGNLHIGHAYSTVAGDVIARYKRMQGYDVRYLTGTDEHGQKIQEKAQKAGKTEIEY
SYM_STAAC       -KETFYITTPIYYPSGNLHIGHAYSTVAGDVIARYKRMQGYDVRYLTGTDEHGQKIQEKAQKAGKTEIEY
SYM_FUSNN       MKKNFFVSTPIYYVNGDPHVGSAYTTIAADVINRYNKAMGMDTHFVTGLDEHGQKVEQAAKQNGFTPQAW
SYM_ENTFA       -KETFYITTPIYYPSGKLHIGNSYTTIACDAMARYKRLMGFDVFYLTGVDEHGQKIEKKAAELNVTPKEY
SYM_OCEIH       -ENAFYITTPIYYPSGKLHIGNAYTTIACDVMARYKRMRGFDVFYLTGSDEHGQKIEQKAKEMNISPKAY
SYM_LISIN       -KNTFYITTPIYYPSGKAHIGHAYTTVAGDAMARYKRLKGYDVFYLTGTDEHGQKIQAKAKERGISEQEY
SYM_LISMF       -KNTFYITTPIYYPSGKAHIGHAYTTVAGDAMARYKRLKGYDVFYLTGTDEHGQKIQAKAKERGISEQEY
SYM_AQUAE       --KKFYVTTPIYYVNDVPHLGHAYTTIAADTIARYYRLRDYDVFFLTGTDEHGLKIQKKAEELGISPKEL
SYM_LISMO       -KNTFYITTPIYYPSGKAHIGHAYTTVAGDAMARYKRLKGYDVFYLTGTDEHGQKIQAKAKERGISEQEY
SYM_STAS1       -KETFYITTPIYYPSGNLHIGHAYTTTAGDVIARYKRMQGYDVRYLTGTDEHGQKIQEKAQKAGKSEIEY
SYM_LACLA       --KTFYITTPIYYPSGKLHLGSSYTTIACDVLARYKRLMGFDTFYLTGLDEHGMKIQRKAEELGMTPKEY
SYM_CLOAB       -KKKFYITTPIYYPSAKLHIGNTYTTVASDALVRFKRLQGYDAFMLTGTDEHGQKIQRIAEDKGITPKAY
SYM_STRR6       -EKNFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGYDVFYLTGLDEHGQKIQQKAEEAGITPQAY
SYM_STRPN       -EKNFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGYDVFYLTGLDEHGQKIQQKAEEAGITPQAY
SYM_CAMJE       -----YITTPIYYVNDVPHLGHAYTTIIADTLARFYRLQGHETRFLTGTDEHGQKIEEAAKLRNSTPQEY
SYM_STRCO       --KAYYVSTPIYYVNDAPHLGHAYTTVAGDVLTRWHRQRGEKVWYLTGTDEHGQKIMRTAEANGVTPQAW
SYM_HELPJ       ------ITTPIYYVNDIPHIGHAYTTLIADTLKKYYTLQGEEVFFLTGTDEHGQKIEQSARLRNQSPKAY
SYM_HELPY       ------ITTPIYYVNDIPHIGHAYTTLIADTLKKYYTLQGEEVFFLTGTDEHGQKIEQSARLRNQSPKAY
SYM_RICFE       MKNTYYITTPIYYVNDVPHIGHAYTSVASDVIARFIRLCGFDVMFLTGTDEHGQKVEKAAINKNIDPQKF
SYM_STRP8       MKKPFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGHEVFYLTGLDEHGQKIQTKAKEAGISPQTY
SYM_STRP1       MKKPFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGHEVFYLTGLDEHGQKIQTKAKEAGITPQTY
SYM_STRP3       MKKPFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGHEVFYLTGLDEHGQKIQTKAKEAGITPQTY
SYM_STRP6       MKKPFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGHEVFYLTGLDEHGQKIQTKAKEAGITPQTY
SYM_BRUSU       ----YYITTAIAYPNGKPHIGHAYELIATDAMARFQRLNGMDVYFLTGTDEHGIKMLQSARKEGITPREL
SYM_BRUME       ----YYITTAIAYPNGKPHIGHAYELIATDAMARFQRLNGMDVYFLTGTDEHGIKMLQSARKEGITPREL
SYM_SYNY3       ----FSVTTPLYYVNDVPHLGSAYTTVVADTLARFKRLQGYDVLMITGTDEHGQKIQRTAEAQELDPQTH
SYM_ANASP       -EKTFALTTPLYYVNDVPHIGSAYTTMAADAVARFQKLLGRDVLLITGTDEHGQKIQRSAESLGKAPQEF
SYM_RHIME       ----FYITTAISYPNGKPHIGHAYELIATDAMARFQRLDGREVFFLTGTDEHGQKMQQTAKKEGISPQEL
SYM_RHILO       ----YYLTTPIFYPNGKPHIGHAYTVIATDALARFQRLDGKDVFFLTGTDEHGLKMQQTAEKEGITPQAL
SYM_RICBR       -------------VNDVPHIGHAYTSVASDVIARFMRLSGHEVMFLTGTDEHGQKVEKAAIDKNIDPQKF
SYM_THEEB       MSPHFSLTTPLYYVNALPHIGSAYTTIAADVLARFYRLQGYQVRFITGTDEHGQKIERTAQQRGLSPQAH
SYM_AGRT5       ----FYITTAISYPNGKPHIGHAYELIATDAMARFQRLDGMDVFFLTGTDEHGQKMQQTARAEGISPEEL
SYM_RICPR       MKNTYYITTPIYYVNDVAHIGHAYTSVASDVIARFMRFCGKDVMFLTGTDEHGQKVEKAAINQNIDPQTF
SYM_MYCBO       --KPYYVTTAIAYPNAAPHVGHAYEYIATDAIARFKRLDGYDVRFLTGTDEHGLKVXXXXXXXXXXXXXX
SYM_MYCLE       ----YYITTAIAYPNAAPHIGHAYEYIATDAIARFKRLDGLDVRFLTGTDEHGLKVAQAAEAAGVPTAQL
SYM_MYCTU       --KPYYVTTAIAYPNAAPHVGHAYEYIATDAIARFKRLDRYDVRFLTGTDEHGLKVXXXXXXXXXXXXXX
SYM_RICTY       MKNTYYITTPIYYVNDVSHIGHAYTSVASDVIARFMRCCGKDVMFLTGTDEHGQKVEKAAINKNIDPQSF
SYM_RICCN       -------------VNDIPHIGHAYTSVASDVIARFMRLRGFDVMFLTGTDEHGQKVEKAAINKNIDPQKF
SYM_LACPL       ------------------HIGNSYTTIACDTLARYKRAMGYDVYFLTGTDEHGLKIEEKAEKLNTDPKSY
SYMM_TAKRU      ----YYITTPIFYVNASPHLGHLYSAVIADCFHRHKQLQGFNSRFATGTDEHGLKIQQAAEAAGKEPLEF
SYM_UREPA       -QKKFFISTPIYYSSGNPHIGHAYTTIIADVLARYKRLFGYDVFFLTGMDEHGQKIQQKAFEENISPKAL
SYMM_NEUCR      --KPFYVTTPIFYVNASPHVGHMYSMVLGDVLKRWQTLKGNQAILCTGTDEHGTKVQRAAIANDMDPKQF
SYMM_BOVIN      -----YFTTPIFYVNAAPHIGHLYSALLADALCRHHRLSDAATGFSTGTDEHGLKIXXXXXXXGLAPSEL
SYMM_HUMAN      -----YFTTPIFYVNAAPHIGHLYSALLADALCRHRRLRGPSTAFSTGTDEHGLKIQQAAATAGLAPTEL
SYMM_XENLA      -------TTPIFYVNAAPHLGHVYSALLADVQHRYSAMCGIESKLSTGTDEHGMKVQQAASALGLDPQTF
SYMM_MOUSE      -----YFTTPIFYVNAAPHIGHLYSALLADALCRHRRLGSASTRFSTGTDEHGLKIQQAAATAGLAPIEL
SYMM_DICDI      -KKKVLITTPIFYVNGPPHIGHLYSALLGDALGRWNRFIGNDTLFMTGTDEHGSKVDEAAKKNGLKTIDY
SYM_METTH       MSKVF-ITCALPYANGPTHLGHLRSTYIADIYARYRRLRGDDVLFVCATDEHGTPIAVKAEAEGRTPLEV
SYMM_DROME      -----YVTTPIFYVNAAPHIGHLYSAVIADAHCRYQRLPEQDVRLCTGTDEHGTKIQQAASLHGVPVAKY
SYM_METKA       ------VTTALAYTNGPLHIGHVRSTYLADVYTRFLKMRGIDAIHIGGTDNHGVPIALQAELEGKDPEEI
SYM_METS3       MSKIF-ISCALPYANGPCHLGHIRSTYLADIYARYNRMIDNDVLLVCATDEHGTPIAVKADKENKKPIEI
SYM_METST       MSKLF-ISCALPYANGPCHLGHLRSTYIADIYARYNRMTGVDTLMVCSTDEHGTPIAVRAEQEKKNPKDI
SYM_METM7       ------VTTALAYTNGPLHLGHARSTYIADIYTRYLRLKGEEVVHVGGTDNHGVPITLTAEREGVKPIDI
SYM_MYCPU       MKKTIYITTPIYYPSGDLHLGHIYSTNIAWVLRNYKKIQGYETFFSTGSDEHGQKIFNKAQELKLETQDY
SYM_METM5       ------VTTALAYTNGPLHLGHARSTYIADIYTRYLRLKGEEVIHVGGTDNHGVPITLTAEREGVKPIDI
SYM_MYCPN       -----YITTPIYYASGKPHIGHAFTTILADVIKRYKQQNGYEAYFLTGTDEHGNKIESKAKSLGLDPQTF
SYM_METMP       ------VTTALAYTNGPLHLGHARSTYIADIFTRYLKLKGEEVIHVGGTDNHGVPITLTAEKEGVKPIDI
SYMM_SCHPO      -KKPYFLTTPIFYVNAAPHLGHLYSLVLTDAIARFQNLKDVSVISSTGTDEHGLKVQTVAQTEGVSPLQL
SYM_MYCGE       -----YITTPIYYASGKPHIGHAFTTILADVIKRFKIQNGYEAFLLVGSDEHGNKIESKAKSLNLDPKTF
SYM_METHJ       ------VTCGLPYTNGPCHLGHLRTYVPADFYVRFMRRKGEEVVFICGSDNHGTPIVVSAEKEGTTPRQI
SYM_ARCFU       ------VTCGLPYANGKAHVGHLRTYVPADVYVRYLRMSGEEVVFVCGSDCHGTPIVVNAEQQGLSPKEL
SYM_METLZ       ------VTCGLPYTNGFCHLGHLRTYIPGDFYVRYLRRLGDDIVFICGSDNHGTPIVVTAEAEKTTPRAV
SYM_METVS       ------VTTALAYTNGPLHLGHARSTYIADIFTRYLRLKRENVFHVGGTDNHGVPITLKAEKEGVTPLDI
SYM_METTP       ------VTCGLPYANGPAHIGHLRTYVPADIFVRALRRMGHDVLFICGSDAHGTPIVVNAESRGMSPREL
SYMM_YEAST      --KVSHVTTPIFYPNAKPHLGHLYSSLLSDVYHRWQLFKGNLSFFTTGTDEHGLKIQCASESNGFDPKKF
SYM_METB6       ------VTCGLPYTNGPCHLGHLRTYVPADCYVRYMRRTGEEVVFVSGSDNHGTPIVVSAEEQGTTPRAL
SYMM_CANAL      --KAFYITTPIFYVNAAPHIGHLYSMLIADTRNKWEKLNPSKSFMLTGTDEHGLKIQSTAEKLGLEPKVL
SYM_METMJ       --KPLLVTCGLPYTNGPCHIGHLRTYVPADFYVRYMRRSGEEVVFVCGSDNHGTPIVISAEQEGSTPRVL
SYM_CHLT3       ------VTTALPYANGPVHLGHAGVYLPADIYVRFKRLKGEDVIHIGGSDEHGVPITLTADKEGVSPQVV
SYM_PARD8       MEKHFLITTALPYANGPVHIGHAGVYVPADIYARYLRLKGEEVLMIGGSDEHGVPITLRAKKEGITPQDV
SYM_BACTN       MEKKFKVTSALPYANGPVHIGHAGVYVPADIYVRYLRLKKEDVLFIGGSDEHGVPITIRAKKEGVTPQDV
SYM_BACFR       MEKNFKVTSALPYANGPVHIGHAGVYVPADIYVRYLRLKKEDVLFIGGSDEHGVPITIRAKKEGITPQDV
SYM_BACFN       MEKNFKVTSALPYANGPVHIGHAGVYVPADIYVRYLRLKKEDVLFIGGSDEHGVPITIRAKKEGITPQDV
SYM_METJA       ----YLITTALAYTNGPLHLGHARSTYIADIIYKYLKLRGEDVIHVGGTDNHGVPITLTAEKEGKSPEEI
SYM_PORG3       ------ITTALPYANGPVHIGHAGVYVPADIYARYLRLRGRDCLLIGGSDEHGVPIALKAKAEGCTPQEV
SYM_METPE       ------VTCGLPYTNGPCHLGHLRTYVPGDMYVRYLRHRGEEVVFVCGSDNHGTPIVVSAEEQGVTPKEL
SYM_GRAFK       ----FTITAALPYTNGPIHIGHAGVYVPADIYSRFLRMQGYDVAFVCGSDEHGVPITIKAKKEGVTPQDV
SYM_UNCMA       -DKPVLVTCGLPYANGSAHIGHLRTYIPADMFVRTLRMMGQETVFVCGSDAHGTPIIVNAEEQKISPRQL
SYM_PORGI       ------ITTALPYANGPVHIGHAGVYVPADIYARYLRLRGRDCLLIGGSDEHGVPIALKAKAEGCTPQEV
SYM_BACV8       ------VTSALPYANGPVHIGHAGVYVPADIYVRYLRLKKEDVLFIGGSDEHGVPITIRAKKEGITPQDV
SYM_ALHEH       MTRKILVTSALPYANGPIHLGHLVEYIQTDIWARFQRLRGHDCHYVCADDAHGTPIMLKARERGITPEAL
SYM_FLAPJ       --KRYTITAALPYTNGPIHIGHAGVYMPSDIYSRYLRLQGKDVAFMCGSDEHGVAISMKAKKEGITPQEV
SYM_DIAST       -----FVTTALPYANGNFHIGHIMEYIQADTWVRAQRMQGNAVNFVGADDAHGAPIMIAAEKAGKTPQQF
SYM_ACISJ       -----FVTTALPYANGNFHIGHIMEYIQADTWVRAQRMQGNAVNFVGADDAHGAPIMIAAEKAGKTPQQF
SYM_PELPB       ------VTTALPYANGPVHLGHAGVYLPADLYVRYMRLKGEDIIHIGGSDEHGVPITITAEREGISPKDV
SYM_NITOC       MPRRILVTSALPYANGPIHLGHLVEYIQTDIWVRFQRMRGHECYYVCADDAHGTPIMLRAQQEGVTPETL
SYM_CYTH3       ----YTITSALPYANGPVHIGHAGVYVPADIYARFLRSKGENVLFIGGSDEHGVPITIRAKKEGVTPQQV
SYM_CHLCH       ------VTTALPYANGPVHLGHAGVYLPADLYVRYKRLKGEDIIHIGGSDEHGVPITISAEKEGISPRDV
SYM_PELLD       ------VTTALPYANGPVHLGHAGVYLPADIYVRHKRLKGEEVLHIGGSDEHGVPITITAEKEGISPRDV
SYM_LEPBP       MSKHILVTSALPYANGSIHLGHILEAVQTDIWVRFQKLIGNECYFFCADDTHGTPIMIAAKKAGKTPESM
SYM_LEPBA       MSKHILVTSALPYANGSIHLGHILEAVQTDIWVRFQKLIGNECYFFCADDTHGTPIMIAAKKAGKTPESM
SYM_CHRSD       ------VTSALPYANGSIHLGHLLEYIQTDIWVRFQKSRGHECHYVCADDAHGTAIMLRAEQEGITPEQL
SYM_POLSJ       -QRRLFVTTALPYANGNFHIGHIMEYIQADIWVRYQRMQGHEVNFVGADDAHGAPIMIAAEKAGKTPQQF
SYM_HALHL       MARRILVTSALPYANGPIHLGHLVEYIQTDIWARFQRLRGNECYYVCADDAHGTPIMLKARERGVDPEQL
SYM_PHOPR       ------VTCALPYANGSIHLGHMLEHVQADIWVRYQRLRGNEVHFICADDAHGTPIMLKAQQMGMEPEQM
SYM_LEPCP       MTRQLFVTTALPYANGKFHIGHIMEYIQADIWVRFQRLMGHQVHFVGADDAHGAPIMIAAEKAGKTPQQF
SYM_AERHH       --RTMLVTCALPYANGSIHLGHMLEHIQADIWVRYQRMRGHQVHFVCADDAHGTPIMLKAQQLGITPEEM
SYM_RALSO       -ERRILVTSALPYANGPIHIGHMVEYIQTDIWVRFQRMRGHETYYVGADDTHGTPVMLRAEKEGITPRQL
SYM_MARAV       ------VTSALPYANGPIHLGHLLEYIQTDIWVRFQNMRGHNCYYVCADDAHGTAIMLRAEREGITPEQL
SYM_HAHCH       ------VTSALPYANGPIHLGHLLEYIQTDIWVRFQKLRGHQCTYVCADDAHGTAIMLKAEQMGITPEQL
SYM_METBU       -EKPVLVTCGLPYANGKAHVGHLRTYVPADIFTRSLKKTGQEVTFVCGSDTHGTPIVFNAEELKTTPTEI
SYM_ACIF5       MKRRILITSALPYANGPIHLGHLVEYTQTDIWARYQRLRGHDCVYVCADDAHGTPIMLRAQSEGITPEEL
SYM_ACIF2       MKRRILITSALPYANGPIHLGHLVEYTQTDIWARYQRLRGHDCVYVCADDAHGTPIMLRAQSEGITPEEL
SYM_DICNV       -----FVSSALPYANGSIHLGHMVEHIQTDIWVRFQQLRGHECYYVCADDAHGTAIMLHAEKKGVTPEVL
SYM_PARUW       MTQKILITSALPYANGPLHFGHAGAYLPADCYARFQRLMKKDVLYICGSDEYGIAITLSADLAGRTPQEH
SYM_ACIAD       MRKIL-VTNALPYANGPIHMGHLLGYIQADIWVRAMRAMGHDVTYVCADDAHGTAIMLRAEANGISPEKQ
SYM_VIBVY       -QRKLLVTCALPYANGSIHLGHMLEHIQADIWVRYQRLRGNIVNFICADDAHGTPIMLKAQQMGMSPEEM
SYM_VIBVU       -QRKLLVTCALPYANGSIHLGHMLEHIQADIWVRYQRLRGNIVNFICADDAHGTPIMLKAQQMGMSPEEM
SYM_THICR       ------ITSALPYANGPIHLGHLVEYIQTDIWARFQKMRGHECYYVCADDAHGTPIMLRAQAEGIDPEDL
SYM_DECAR       MSRKILVTSALPYANGAIHLGHLVEYIQTDIWVRFQKMSGNECWYVCADDTHGTPIMLRAEKEGITPEQL
SYM_VIBC3       ------VTCALPYANGSIHLGHMLEHIQADIWVRYQRLRGNTVNFICADDAHGTPIMLKAQQMGMTPEAM
SYM_VIBHB       ------VTCALPYANGSIHLGHMLEHIQADIWVRYQRLRGNTVNFICADDAHGTPIMLKAQQMGITPEEM
SYM_VIBCH       ------VTCALPYANGSIHLGHMLEHIQADIWVRYQRLRGNTVNFICADDAHGTPIMLKAQQMGMTPEAM
SYM_RALEH       ------VTSALPYANGQIHIGHLVEYIQTDIWVRFQRMMGNEVYYVGADDTHGTPVMLRAEKEGITPKAL
SYM_VIBPA       ------VTCALPYANGSIHLGHMLEHIQADIWVRYQRLRGNTVNFICADDAHGTPIMLKAQQMGITPEEM
SYM_PASMU       ------VTCALPYANGAIHLGHLLEHIQADIWVRFQRMRGHKVHFICADDAHGTPIMLNADKLGITPEAL
SYM_METPP       MPRQLFVTTALPYANGHFHIGHIMEYIQADIWVRFQRMQGHAVHFVGADDAHGAPIMIAAEKAGKTPQQF
SYM_BDEBA       ------ITCALPYANGYIHLGHLVEYLQADFWARFQNMRGNECVFICADDTHGTPIMVKARELGITPEAL
SYM_VIBSL       ------VTCALPYANGSIHLGHMLEHIQADIWVRYQRLRGNTVNFICADDAHGTPIMLKAQQMGITPEEM
SYM_TOLAT       ------VTCALPYANGSIHLGHMLEHVQADIWVRFQRMRGHNIHFICADDAHGTPIMLKAQQLGITPEEM
SYM_ACTP2       MSRKMLVTCALPYANGAIHLGHMLEHIQADIWVRFQRMRGNEIYFVCADDAHGTPIMLNAAKQGITPEQL
SYM_ACTPJ       MSRKMLVTCALPYANGAIHLGHMLEHIQADIWVRFQRMRGNEIYFVCADDAHGTPIMLNAAKQGITPEQL
SYM_ACTP7       MSRKMLVTCALPYANGAIHLGHMLEHIQADIWVRFQRMRGNEIYFVCADDAHGTPIMLNAAKQGITPEQL
SYM_METFK       ------VTSALPYANGSIHLGHMVEYVQSDIWVRFQKMQGHTVHYVCADDTHGTPIMLRAEKEGITPEEL
SYM_LEGPC       -ERKMLVTSALPYANGHLHLGHLVEHIQTDIWVRTHKMLGIQCISVCGDDAHGTPIMLKAEQLGITPEAL
SYM_BORA1       MSRTLFVTTALPYANGSFHIGHIMEYIQADIWVRSMRMAGHTVHFVGADDAHGAPIMLKAEKEGITPQAL
SYM_PSEE4       ------VTSALPYANGSIHLGHMLEYIQTDMWVRFQKLRGNQCVYVCADDAHGSAIMLRAEKEGITPEQL
SYM_RHOBA       MTRRLLVTAALPYANGPIHIGHLVEYLQTDIWVRFQKLRGNRCLYICADDTHGTAIMIRARGEGRSEIEL
SYM_PSEPG       ------VTSALPYANGSIHLGHMLEYIQTDMWVRFQKMRGNQCIYVCADDAHGSAIMLRAEKEGITPEQL
SYM_NATPD       ------VTCGLPYANGDLHVGHLRTYVSGDAYARALESLGQSVAFVSGSDMHGTPIAVNAAEEGVDPESF
SYM_LEGPH       -ERKMLVTSALPYANGHLHLGHLVEHIQTDIWVRTHKMLGIQCISVCGDDAHGTPIMLKAEQLGITPEAL
SYM_PSEPW       ------VTSALPYANGSIHLGHMLEYIQTDMWVRFQKLRGNQCIYVCADDAHGSA